Advanced search

   List of keywords

Keywords



18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal hemodynamic maneuverabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabdominopelvic regionabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectacromioclavicular jointactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive listening testactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive rehabilitationactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadherenceadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgohallucinosisalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpha-1 constrictionalpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer diseaseAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangiogramangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal osteopathyanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior neck indurationanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic enlargementaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplicationsapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painarmsaromatherapyarousalarrhythmiaarrythmiaartarterialarterial hypertensionarterial occlusive diseasesarterial oxygenationarterial pressurearterial rulearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular soundarticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial lung ventilationartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetric tonic neck reflexasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical diabetesatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiabenralizumabberberineBertolotti syndromebest practicebeta blockerbeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybicuspid aortic valvebifocal integrationbilaminar zonebilateral blood pressure measurementbile acid diarrheabiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanical responsebiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblackblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone metastasisbone mineral densitybone painbone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel dysfunctionbowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboxingboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachiocephalic vesselsbrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous emphysemabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbutton batteriesbypassC-fiber painC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcar accidentcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac apex anglecardiac arrestcardiac cirrhosiscardiac controlcardiac electrophysiologycardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac physiologycardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCBTCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectionCECScecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular accidentcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachial paincervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchest wall painchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild abuse: neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic exertional compartment syndromechronic fatiguechronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic orchialgiachronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcircuit interval trainingcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical encountersclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical informaticsclinical learningclinical medicineclinical modelsclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclothingclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachescoachingCobb anglecocainecoccidioidomycosiscoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycold water exposurecold water exposure therapycoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicineCollège Ostéopathique Européencollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscolorectal screeningcolostomycomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity exercisecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconference registrationconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital heart diseasecongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostovertebral jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniocervical musclescraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreative kinasecreativitycredentialingcredentialscreepcremaster veinscrenotherapyCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescyclingcynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep fibular nervedeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademodex folliculitisdemographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentoalveolar systemdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdermoscopydescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental delaydevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic reliabilitydiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital diarydigital healthdigital imagedigital learningdigital mediadigital neuromadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscolorationdiscontinued trialsdiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisembarkment syndromedisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal kyphosisdorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug approvaldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydual-degree programsdually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenal perforationduodenojejunal junctionduodenumdupilumabduplex scanningDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdynamometric clogsdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadysrhythmiadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. Lütjen-DrecollE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear canalear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaeczema herpeticumedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational neuroscienceeducational opportunitieseducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRejection fractionelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTembarrassmentEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentemersiologyEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityempowermentEMTRATSemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendoscopyendothelial dysfunctionendothelial functionendovascular retrievalenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental factorsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilic fasciitiseosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequestrian simulatorequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocyteserythropoietinescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercise-induced muscle damageexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal auditory canal exostosisexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubationextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyelidseyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial neuropathyfacial painfacial paralysisfacial structurefacial swellingfacial tapingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfall preventionfall riskfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial glidingfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfearfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfebrile neutrophilic dermatosisfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfeesfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoral neuropathyfemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilmsfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirearm safetyfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfoetal breechfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood aversionfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenforamen magnumFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesForestier operculaformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional disorderfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctional testfunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyfuzzy logicG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgardeninggas exchangegas gangrenegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal comorbiditiesgastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisGazagelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender representationgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiant cell arteritisgiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsGitelman syndromeglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucoseglucose metabolismgluteal claudicationgluteal regionglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonadal veingonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGossip testGOTgoutgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegritgroingroin injurygroin paingroove signgross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth failuregrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguideguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH. SzurmantH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth assessmenthealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth motivationhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionalhealth professionalshealth professionshealth promotionhealth sciences librarieshealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemochromatosishemodialysishemodynamichemodynamic controlhemodynamic effectshemodynamicshemoglobinhemoglobinshemorrhagehepatic areahepatic pathologyhepatic pumping techniquehepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehereditary spherocytosisHermansky-Pudlak syndromehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupsHigh fidelity manikinhigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexHofmann ligamentsholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghorseshospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital settinghospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitarian crisishumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrogenhydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxemiahypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPICUideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumil-1?il-1?ileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial band syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimposter syndromeimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincident painincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinduction testinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processinginformation sheetInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury pronenessinjury recoveryinjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstitutionsinstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative indicatorintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureinterstitiumintersubjectivityintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview cycleinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarater reliability studyintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischemic strokeischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseisotretinoinIsraelITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. BockJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournal policyjournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansaskaposi varicelliform eruptionKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney diseasekidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic angleKyrgyzstanl-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage disorderslanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngeal cancerlaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelifestyle modificationlift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimited functionlimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliterary reviewliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar painlumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung cancerlung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph node mappinglymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniquelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. masseterm. piriformism. rectus capitis posterior minorm. temporalisM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalleolusmalnourishmentmalocclusionmalpracticeMALSMALTmaltreatmentmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular mobilitymandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmaskmask mandatemasksMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch gapmatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial areamaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMay-Thurner syndromeMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie exerciseMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanobiologymechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedical writingmedicalitymedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomamelatoninMelicien Tettambelmember satisfactionmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic markersmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastatic gastrointestinal adenocarcinomametastudiesmetatarsalgiametatarsophalangeal jointmetaversemethanemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylacetatemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicrolearningmicropolarizationmicroRNAmicrosurgerymicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body approachmind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsMini Balance Evaluation Systems Testminimal change diseaseminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymitral valve prolapsemix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile phonesmobile units in a mobile systemmobilisationmobilitymobility aidsmobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsMongolian medicinemongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonoclonal antibodiesmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality rateMorton neuromamothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor performancemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinaritymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretchingmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymuscular kinematicsmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal healthcaremusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sphincter Oddimusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial linesmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotensive techniquemyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasolacrimal duct obstructionnasomaxillary regionnasopharyngitisnational academyNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural dysfunctionneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine responseneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular inhibition techniqueneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurostimulationneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusOADobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsObstetrical simulationobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive airway diseaseobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOFTOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen arteryopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen oval windowopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral mucosaoral stageoral submucous fibrosisoral surgeryorbitorbitaorbitopathyORC-NZOregonorgan donationorgan mobilityorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational behaviororganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorofacial skillsorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic exerciseosteopathic family physiciansosteopathic fascial treatmentosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatient clinicsoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen supplyoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain memorypain neurophysiologypain neuroscience educationpain perceptionpain phenotype stratificationpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain sensitivitypain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletsPanamapancreaspancreatic diseasespancreatic stimulationpancreatitispandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillary fibroelastomapapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepatent ductus arteriosuspatent foramen ovalepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient liftspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPBMPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepedaling powerpediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer instructionpeer physical examinationpeer recoverypeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic mobilitypelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic scarspelvic stabilitypelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferencepercutaneous coronary interventionperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericarditispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperioperative outcomeperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languageperson-first languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSphantom limbpharmacologic treatmentpharmacological interventionspharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphoniatryphonoticsphosphatidylinositol 3-kinasephotobiomodulationphotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical medicine and rehabilitationphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepolitical advocacypoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagesPonseti methodpoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepositivismpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-operative scarpost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostprandial hypotensionpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural deficiency syndromepostural diseasepostural imbalancepostural instabilitypostural neck painpostural orthostatic tachycardia syndromepostural patternpostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostural-perceptual dizzinesspostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-surgical carepre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprehabilitationprehypertensionprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature epiphyseal closurepremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbycusispresbyopiapresbyvestibulopathypreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm birthpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprimordial motor integration techniqueprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivacyprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentprobioticsproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional sportsprofessional staff committeesprofessional statusprofessional titlesprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotective sensitivityprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularispruritic rashprurituspseudo sciaticapseudoradicular painpseudoresistancepseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric distresspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoactive medicationpsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTHSPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication biaspublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary abscesspulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSpyelonephritispyoderma gangrenosumQ angleq-testQEEGqi gongqigongQLQ-C30qtc intervalquackeryquadratus lumborumquadrilateral spacequalification requirementsqualitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of evidencequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnaire validityquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreadershipreadingreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundrealismreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecord keepingrecordingrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared blood cellsred flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefractive errorsrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulationsregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch outputresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory healthcarerespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory mechanismrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityresponsivenessrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of liferiverboardingRL1-803rlq painRLSRobert Fulfordrobotic surgeryroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic AssociationRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalt wastingsalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent detectionscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerodermasclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescrambler therapyscreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch interestsearch strategysearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedationsedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-harmself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsseroprevalenceserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice dogsservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual and gender minoritysexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36SFTSGLT2 inhibitorsshadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort term effectsshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshort-sightednessshortageshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromeShulman syndromeSibson fasciasick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin toneskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull morphologyskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmartphonessmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTSNAP technicsnapping hip syndromesneezingsnowboardingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialtyspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentSpecific back exercisesspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatic cordspermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphincter of Oddisphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal dura materspinal dysfunctionspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal kinematicsspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manipulative treatmentspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervespinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasespontaneous versionsportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinesports therapyspotted fever rickettsiosissprains and strainsspringing techniquesprintsprintingSQOR-V questionnainnairesquamous cell carcinomasquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystates of mindstaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth SanatoriumStill-Laughlin functional techniquestillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain injurystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategic developmentstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorStroop effectstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial painsubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous emphysemasubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital decompressionsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital muscle inhibition techniquesuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking disordersucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicidal ideationsuicidesuicide preventionSummer Olympicssunbathingsunscreening agentssunshinesuperficial heatsuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperior vena cava syndromesuperoxide anion radicalssupervised exercisesupervised injection sitessupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesuprapleural membranesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical necksurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgSweets syndromeswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic hyperactivitysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynchronysynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam physiciansteam-based learningteamUP Short-FormteamUP-SFteamworktear ductstechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbookstezepelumabTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal asymmetrythermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermodiagnosticsthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic biomechanicsthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic surgerythoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthromboembolismthrombolytic therapythrombosisthrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue hardnesstissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocilizumabtocilizumab therapytocolysistoetoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatracheobronchial casttrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse diaphragmtransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment algorithmstreatment choicetreatment contracttreatment costtreatment credibilitytreatment documentationtreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment preferencetreatment procedurestreatment processtreatment protocoltreatment refusaltreatment resistancetreatment settingtreatment strategytreatment studytreatment successtreatment tacticstreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestribal healthcaretrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetubulopathytumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUgandaUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaurticarial bullous pemphigoidUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine flexionuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterine retroversionuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccination statusvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginaVaginal deliveryvaginal treatmentvaginismusvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvalvular heart diseasevancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular physiologyvascular surgeryvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena cava filtervena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral dynamicsvertebral dysfunctionvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexvestibuloplastyveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvibrotactile trainingvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral pumping techniquevisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsvisceral-fascial modelviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual observationvisual perceptionvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitamin deficienciesvitaminsvocal compassvocal dysfunctionvocal function exercisesvocal performancevocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolatile organic compoundsvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noisewhitewater kayakingWHOwhole body-vibrationwhole person approachwhole-body cryotherapywholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework hourswork schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysxeroderma pigmentosumyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingzero?crossingzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygapophysial jointszygomazygomatic trauma
 
 80.8% of the records
 
 19.2 % of the records
 
 58.3 % of the records
 
 
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

6944 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
2

Syndrome des releveurs de l’anus, troubles fonctionnels intestinaux et anomalies articulaires du petit bassin, place du traitement ostéopathiqueLevator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment
(Levator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment)
Riot, F. M., Goudet, P., Mouraux, J. P., Cougard, P.
La Presse Medicale, Jul 31
3

Proposal for Manual Osteopathic Treatment of the Phrenic Nerve
Bordoni, B., Escher, A. R., Duczyński, M.
Cureus, Apr
4

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
5

The use of superficial heat in the management of low back pain by chiropractors and osteopaths in Australia: an observational cross-sectional survey
McCann, P. J., McGlynn, P. J., Vitiello, A. L., Fernandez, M., de Luca, K.
Chiropractic & Manual Therapies, 2026/12
6

Health profession students' anxiety, depression, and imposter syndrome in a rural versus urban setting
Sperling, E. L., Kennedy, K., Mehrazar, T., Takahashi, M., Rezayee, S., Zitek, C., Gresner, E., Hudson, M. G.
BMC Medical Education, 2026/12
Free full text
7

Artificial Intelligence in Osteopathic Medical Education: Opportunity, Risk, and the Call for Intentional Integration; A Letter to the Editor
Richards, S.
International Journal of Osteopathic Medicine, 2026/12
8

Assessing content validity of the Osteo-TAQ(Aus) using cognitive interviews: cross-jurisdictional evidence from UK osteopathic practice​​
Thomson, O. P., Golder, E., McLeod, G. A., Draper-Rodi, J., Vogel, S., Vaughan, B.
BMC Research Notes, 2026/12
Free full text
9

A testable theoretical framework linking cranial osteopathic still-point induction to altered consciousness via convergent autonomic, default-mode, and interoceptive mechanisms
Nikam, S., Narayan, N. S.
Explore, 2026/11
10

Delivering a student osteopath placement in a community NHS musculoskeletal outpatient clinic: a service evaluation
Chan, Y. C. E., Grogut, R., Talebnejad, M., Clarke, O., Kreutzfeldt, S., Alderton, H.
Physiotherapy, 2026/10
11

Effects of osteopathic manipulative treatment on protective sensitivity in patients with type 2 diabetes: A randomized clinical trial
de Mendonça, Alissa Izetti, Pivetta, Renan Omil Pravatta, de Souza, Hamilton Mendes, Ribeiro, Dhiego Cassimiro, de Araújo, Fagno Medeiros Rocha
Journal of Bodywork and Movement Therapies, 2026/10
12

How students of osteopathy and physiotherapy view and perceive each other's practice
Donaldson, H., Rickard, A.
Physiotherapy, 2026/10
13

Trends in Medical Student Publications in the Pass/Fail Licensing Examination Era
Long-Mills, E., Qiu, X., Eldridge, D. L., Tumin, D.
Southern Medical Journal, 2026/10
14

Integrating pain phenotype stratification into osteopathic clinical reasoning: A pilot feasibility study
Lanza, M., Kuntz-Guyot, M.
Journal of Bodywork and Movement Therapies, 2026/10
15

Person-centred care in osteopathic practice in Australia: Results from a national health service use survey
Draper-Rodi, J., Vaughan, B., Fleischmann, M., Sinderholm Sposato, N.
Advances in Integrative Medicine, 2026/09
16

A national survey of clinical informatics educational opportunities in United States medical schools
Lee, G. Y., Li, K., Patil, A., Jiang, S., Zheng, C., Baral, J., You, J., Kim, E.
Journal of the American Medical Informatics Association, 2026/09
17

Resolution of Idiopathic Bile Acid Diarrhea with Osteopathic Manipulative Treatment: A Mind-Body Approach
Gordon, T.
The AAO Journal, 2026/09
18

Exploring Roles of OMT in Dental Education: Promoting Interdisciplinary Collaboration and Reducing Occupational Injuries
Shi, C., Chang, Y. W., Nichols, J.
The AAO Journal, 2026/09
19

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/09
Free full text
20

The effectiveness of osteopathic treatment in cervical whiplash: a randomized controlled trial
Larios-Ortega, J., Díaz-Acuña, A. M., Colón-Fraile, M. T., Rivera-Sequeiros, A., Albornoz-Cabello, M., Ruiz-Romero, M. V.
Journal of Osteopathic Medicine, 2026/09
Free full text
21

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/09
Free full text
22

Cultivating calm: Gardening as a nature-based intervention to reduce anxiety symptoms in osteopathic medical students
Barrueta-Alvarez, B., Singer, M. S., Bishayee, A., Syed, M.
Advances in Integrative Medicine, 2026/09
23

Response to artificial intelligence in osteopathy education: A critical analysis of educators' and researchers' perspectives
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2026/09
24

Response to the letter regarding 'Fatigue in long COVID: An exploratory pragmatic randomized trial of osteopathic care plus physical therapy versus physical therapy alone'
Curi, A. C. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Filho, N. M., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2026/09
25

An osteopathic treatment approach to the median arcuate ligament syndrome and other chronic abdominal pain disorders: A case report with a proposed osteopathic treatment protocol
Crow, W. T., Robertson, W.
International Journal of Osteopathic Medicine, 2026/09
26

Osteopathic manipulation treatment to improve glenohumeral and thoracic spine range of motion in collegiate swimmers: A pilot study
Kleis, R. R., Hora, N. J., Rich, J. R., Gady, A., Hansen, C., Furlano, A. J.
International Journal of Osteopathic Medicine, 2026/09
27

Die Osteopathische Presbyvestibulopathie-Studie – Teil 2: Behandlung von Patient*innen mit Schwindel und Fallneigung: Studienergebnisse und Diskussion
(Die Osteopathische Presbyvestibulopathie-Studie – Teil 2: Behandlung von Patient*innen mit Schwindel und Fallneigung: Studienergebnisse und Diskussion)
Beck, M., Höss, B., Beck, A.
Osteopathische Medizin, 2026/09
28

Können wir als Osteopathinnen und Osteopathen zu Gaza schweigen? Ein Standpunkt zur humanitären Verantwortung eines Gesundheitsberufs
(As osteopaths, can we remain silent about Gaza? A Perspective on the Humanitarian Responsibility of a Healthcare Profession)
Franke, H., Prediger, G.
Osteopathische Medizin, 2026/09
29

Pädiatrische Osteopathie: Säuglinge mit frühkindlichen Regulationsproblemen und -störungen in der osteopathischen Praxis
(Pediatric Osteopathy: Infants with Early Childhood Regulatory Problems and Disorders in the Osteopathic Practice)
Goßner, M.
Osteopathische Medizin, 2026/09
30

Osteopathische Identität neu denken: Inhibition, Fazilitation und Lernen als konzeptioneller Rahmen osteopathischer Praxis
(Rethinking Osteopathic Identity: Inhibition, Facilitation, and Learning as a Conceptual Framework for Osteopathic Practice)
Moser, U.
Osteopathische Medizin, 2026/09
31

Die Entwicklung der Osteopathie in der Schweiz
(The Development of Osteopathy in Switzerland)
Newiger, C.
Osteopathische Medizin, 2026/09
32

Aus der digitalen Welt: Das Herz
(From the Digital World: The Heart)
Sonntag, M.
Osteopathische Medizin, 2026/09
33

The effect of osteopathic manipulative treatment on the immune system: A critical review of the evidence and proposed mechanisms
Matis, L., Boucherat, J.B., Traboulsie, A.
International Journal of Osteopathic Medicine, 2026/09
34

Attitudes and beliefs of early-career German osteopaths about the management of chronic pain and integration of the biopsychosocial model: A qualitative interview study
Schreiner, B., Porthun, J., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2026/09
35

Emotional exhaustion and poor psychological well-being among osteopathic medical school matriculants and graduates
Himmelberger, Z. M., Guercio, E., Barrow, J. R., Best, M., Tibbetts, Y., Barron, K. E., Speicher, M. R., Hulleman, C. S.
Academic Medicine, 2026/09
Free full text
36

Efficacy of Dry Needling Versus Cranial Osteopathic Manipulative Therapy in Patients with Cervicogenic Headache: A Pilot Randomized Controlled Feasibility Trial
Katiyar, M., Sidiq, M., Jayavelu, J.
Indian Journal of Physiotherapy and Occupational Therapy, 2026/09
Free full text
37

Integrative Approaches to Atopic Dermatitis: Exploring Biomarkers, Current Therapies, and the Potential Role of Osteopathic Manipulative Medicine
Sawicki, S., Dhawan, A., Devkota, D., Elway, M., Maskey, A. R.
International Journal of Molecular Sciences, 2026/09
Free full text
38

Complementary and Alternative Medicine Therapies in relation to Self-Reported Better Sleep across Racial and Ethnic Groups in the United States
Singh, R., Gaston, S. A., Payne, C., Neo, D. T., Bertisch, S. M., Jonas, W. B., Jackson, C. L.
medRxiv, 2026/09
Free full text
39

Response to Zakariyah et al.: Bridging the knowing-doing gap in psychologically informed osteopathic education - a response
Ronchi, M., Maggiani, A., Dognini, S., Giusti, E.
International Journal of Osteopathic Medicine, 2026/09
40

Patients' experiences and perceived outcomes of manual therapy: a qualitative systematic review with framework synthesis
Zhang, Y., Liang, S., Chen, H., Sun, Y., Yu, C.
Frontiers in Pain Research, 2026/09
41

Letter to the editor: Methodological anomalies and outcome claims in a pragmatic clinical trial of osteopathic and physical therapy for long COVID patients
Saripudin, M.
International Journal of Osteopathic Medicine, 2026/09
42

Letter to the editor: Bridging the knowing-doing gap in psychologically informed osteopathic education: beyond awareness toward clinical readiness
Zakariyah, M. F., Nugroho, R., Lestari, G. D., Alisyahbana, I. B.
International Journal of Osteopathic Medicine, 2026/09
43

AI Tool Use Among Osteopathic Medical Students: Pilot Digital Diary Study
Brody, C., Schwindt, S., Thakur, A., von Steinbergs, P.
JMIR Formative Research, 2026/09
Free full text
44

Doctor of osteopathic medicine degree still faces recognition challenges in the United States: Suggested ways to improve awareness
Garcia, R., English, K.
World Journal of Methodology, 2026/09
Free full text
45

Patient safety and regulatory gaps in manipulative therapy practices in Indian physiotherapy- A commentary
Sidiq, M.
International Journal of Osteopathic Medicine, 2026/09
46

Osteopathie und kPNI: ein integrativer Ansatz für Regulation und Gesundheit
(Osteopathy and kPNI: An Integrative Approach to Regulation and Health)
D&rsquo, havé, T., Golenvaux, A.
DO - Deutsche Zeitschrift für Osteopathie, 2026/09
47

Über Verletzungsanfälligkeit zwischen Bank und Büro
(On Injury Proneness: From the Bench to the Office)
Golenvaux, A.
DO - Deutsche Zeitschrift für Osteopathie, 2026/09
48

Behandlungsdokumentation in der osteopathischen Praxis
(Treatment Documentation in Osteopathic Practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/09
49

Thoracic Biomechanics or Autonomic Modulation? Reframing the Respiratory Effects of Osteopathic Manipulative Therapy
Wahyudin, H.
International Journal of Osteopathic Medicine, 2026/09
50

The impact of osteopathic correction on the clinical course of knee osteoarthritis and the need for analgesic therapy in patients with metabolic syndrome: First results of a controlled randomized study
(Влияние остеопатической коррекции на клиническое течение остеоартрита коленного сустава и потребность в анальгетической терапии у пациентов с метаболическим синдромом: первые результаты контролируемого рандомизированного исследования)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Zhugrova, E. S.
Russian Osteopathic Journal, 2026/09
51

Outcomes of non-pharmacological treatments for postural balance disorders
(Результаты немедикаментозного лечения нарушений постурального баланса)
Potekhina, Y. P., Yakovlev, D. K., Polismak, O. V.
Russian Osteopathic Journal, 2026/09
52

Osteopathic manipulative treatment vs. standard therapy in the management of acute neck and low back pain in the emergency department
Hochman, S. M., Vlasica, K., LaPietra, A., Patel, B. K., Ju, C., Mota, N. J., Wilder, S.
Journal of Osteopathic Medicine, 2026/09
Free full text
53

Specifics of teaching fundamental human anatomy to students enrolled in the higher education specialist program in osteopathy
(Особенности преподавания фундаментальной анатомии человека для студентов, обучающихся по программе высшего образования (специалитет) по специальности «остеопатия»)
Svirin, S. V.
Russian Osteopathic Journal, 2026/09
54

Practical tools for developing a personal brand in the field of professional osteopathy
(Практический инструментарий формирования личного бренда в сфере профессиональной остеопатии)
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2026/09
55

Оsteopathic correction of somatic dysfunctions in children with speech delay living in the regions of Kyrgyzstan
Usupbekov, E., Shabieva, A. M., Kim, A. Y., Belov, G. V., Mokhov, D. E.
Russian Osteopathic Journal, 2026/09
56

The national academy of medicine fellowship in osteopathic medicine: an investment in the future
Jaqua, B.
Journal of Osteopathic Medicine, 2026/09
Free full text
57

Parallels and progress: osteopathic integration into urology and other competitive specialties
Megafu, M., Glykos, S.
Journal of Osteopathic Medicine, 2026/09
Free full text
58

Self-perceptions of medical students and educators regarding LGBTQ+ and sexual and gender minority (SGM) healthcare and SGM patients: cross-sectional survey
Muder, S. J., Malik, K., Maguire, M., Hutak, C., Jung, M.K., McMahon, D., Walker, A., Alvarado, L.
Journal of Osteopathic Medicine, 2026/09
Free full text
59

Research Preparedness Among Osteopathic Medical Students in the Post-Pass/Fail Licensing Examination Era: Bridging the Gap Between Rising Expectations and Student Confidence
Niewchas, A., Clark, T., Swiastyn, J., Hamdan, D., Stewart, C., Zoungrana, M., Dobson, J. R.
Cureus, 2026/09
Free full text
60

Efficacy of osteopathic manipulative treatment in reducing monthly migraine days: a meta-analysis
Roberti, C., Estevez, V. M., Vootukuri, P., Pothen, S., Yasuda, K., Esch, Z., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2026/09
Free full text
61

Osteopathic manipulative treatment for management of feeding dysfunction in breastfed newborns
Fons, D., Watts, K. B., Vannitamby, H., Rainey, S., Ford-Davis, J., Wang, Y., Van Heukelom, S., Wright, A.
Journal of Osteopathic Medicine, 2026/08
Free full text
62

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2026/08
Free full text
63

Differences in attitudes among health professions students and educators toward people experiencing homelessness: Novel correlations with physical comfort, prior experiences, and interest in learning
Gilmore, E., Szeto, C., Spector, E., Shono, Y., Pumerantz, A.
Journal of Investigative Medicine, 2026/08
Free full text
64

Osteopathic Visceral Manipulation on Functional Constipation in Obese Adults: A Randomized Controlled Clinical Trial
Zidan, M. S., Elfahl, A. M., Elrefaey, B. H., Ibrahim, Z. M., Elfeky, H. M.
Journal of Integrative and Complementary Medicine, 2026/08
Free full text
65

Growth of a novel osteopathic manipulative treatment for trauma program integrated into a level 1 trauma center
Baltazar, G. A., Thadathil, L., Noor, S., Weiss, L., Joutovsky, B., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Machado, F., Joseph, D. K.
Journal of Osteopathic Medicine, 2026/08
Free full text
66

Ultrasonographic evaluation of the effect of osteopathic manipulative techniques on thoracic outlet syndrome: a preliminary study
Kondrashov, P., Wang, M. Y.F., Kondrashova, T., Rasputkov, E., Snider, E. M., Ayers, J., Lundquist, L., Newell, S., Palmer, E., Snider, K. T.
Journal of Osteopathic Medicine, 2026/08
Free full text
67

Exploring PM&R interest and resources among osteopathic medical students: bridging educational gaps
Kumar, A., Keller, R. B., Averell, N., Elwert, N.
Journal of Osteopathic Medicine, 2026/08
Free full text
68

Surgeon Health and Well-Being Initiative: A Survey of General and Orthopedic Surgery Residents' Reports of Musculoskeletal Pain
Mohamed, M., Kim, G. J., Conrad-Schnetz, K., Yang, Z., Carneval, M.
Cureus, 2026/08
Free full text
69

Osteopathic Manipulative Treatment as an Adjunctive Therapy for Post-mastectomy Pain Syndrome: A Case Report
Natesan, S., Young, G., Khattak, M., Beverley-Waters, K., Conrad-Schnetz, K.
Cureus, 2026/08
Free full text
70

A Feasibility and Acceptability Study of Virtual Reality-Based Training for Thoracic Spine Assessment: First-Year Osteopathic Medical Student Perceptions and Motivational Responses
Piscitelli, E., Jose, J., Ahmed, E., Jose, R., Toma, M., Stout, R., Yao, S.
Eng, 2026/08
Free full text
71

Evaluating the mental health of medical students during their dedicated study period for COMLEX Level 1 vs. Level 2 after the change of COMLEX Level 1 to pass/fail
Zaman, T., Politis, K., Lee, R., Magalhaes, E., West, D., Redden, D.
Journal of Osteopathic Medicine, 2026/08
Free full text
72

Pharmacological and non-pharmacological interventions for managing sleep disorders in children with cerebral palsy: A systematic review
Jaiswal, N., Fisher, L., Ciminata, G., Mulholland, R., Noel-Storr, A., Nutton, L., Orr, V., Eunson, P., Cooper, N. J., Sutton, A., Wu, O., Quinn, T.
Developmental Medicine & Child Neurology, 2026/08
Free full text
73

Osteopathic treatment in horses increases blood concentration of beta-endorphin, erythropoietin and interleukin-6
Musso, A., Garza, F., Liu, C.C., Keowen, M., Andrews, F. M.
Equine Veterinary Education, 2026/08
74

Osteopathic Manipulative Medicine Enhances Tracer Uptake and Sentinel Node Mapping During Breast-Conserving Surgery: A Randomized Controlled Trial
Stejskal, I., Clutts, B., Ribar, J., Erdrich, J., Ditillo, M., Baatz, M., Butts, L., Verdugo, C., Yao, G., Hsu, C.H., Abdelsattar, J., Foster, N.
Annals of Surgical Oncology, 2026/08
75

The use of high-velocity, low-amplitude techniques in paediatric osteopathic care: two multinational cross-sectional surveys on clinical practice and educational curricula
van Dun, P. L. S., Bohlen, L., Ellwood, J., Ferreira, A. P. A., Steel, A., Draper-Rodi, J., Vaucher, P.
Chiropractic & Manual Therapies, 2026/08
76

Osteopathic manipulative medicine among injured emergency department patients: a nationwide study
Harris, H., DiStefano, A., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2026/08
Free full text
77

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/08
Free full text
78

Osteopathic manipulative treatment for enhanced pitch performance in collegiate baseball players: a feasibility study on shoulder and hip interventions
Rosten, C., Brown, S., Nandedkar, T., Pearson, A., Worthington, E., Fastring, D.
Journal of Osteopathic Medicine, 2026/08
Free full text
79

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2026/08
80

EXPRESS: Differences in Attitudes among Health Professions Students and Educators toward People Experiencing Homelessness: Novel Correlations with Physical Comfort, Prior Experiences, and Interest in Learning
Gilmore, E., Szeto, C., Spector, E., Shono, Y., Pumerantz, A.
Journal of Investigative Medicine, 2026/08
81

Treatment with osteopathic techniques for Meralgia Paresthetica: two case reports
Nunes, A., Campos, B.
Journal of Bodywork and Movement Therapies, 2026/07
82

Gemütszustände, Subjektivität und verkörperte Beziehung in der osteopathischen Praxis
(Mental States, Subjectivity, and Embodied Relationships in Osteopathic Practice)
Kamp, R.
DO - Deutsche Zeitschrift für Osteopathie, 2026/07
83

Osteopathische Ansätze bei Dysmenorrhö und Uterusretroversion/-flexion
(Osteopathic Approaches to Dysmenorrhea and Uterine Retroversion/Flexion)
Lebesmühlbacher, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/07
84

Scham bei postmenopausaler Harninkontinenz
Wetterich, H.T.
DO - Deutsche Zeitschrift für Osteopathie, 2026/07
85

The importance of osteopathic mentorship during medical school, residency, and beyond for surgical subspecialties: review of literature
Agollari, K., Modica, A., Bitterman, A.
Journal of Osteopathic Medicine, 2026/07
Free full text
86

Beyond Immersion: A Stage-Based Framework for Cross-Modal Immersive Technologies in Medical Education
Ahmad, C. M., Ngo, A. L. T., Kastle, R.A., Rufino, L., Amin, S., Evan, B., Zolnierz, M.
Cureus, 2026/07
Free full text
87

Osteopathic manipulative treatment in pediatric care: from the inception of osteopathic medicine to 1950, a historical literature review
Baroni, F., Corisio, A., Lunghi, C., Liem, T.
Journal of Osteopathic Medicine, 2026/07
Free full text
88

Differences in Residency Advising and Mentorship for Osteopathic and Allopathic Emergency Medicine Applicants
Kelner, R. H., Fix, M., Hughes, P., Stephen, R., Merritt, B., Ruggieri, J., Beaulieu, A. M.
Cureus, 2026/07
Free full text
89

The efficacy of osteopathic manipulative medicine in the treatment of low back pain: a scoping review and meta-analysis of patient-reported outcomes
Putnam, K., Harrington, K., Zapata, I., Fisher, J., Cruz, M., Tuttle, V.
Journal of Osteopathic Medicine, 2026/07
Free full text
90

The use of local infrared thermometry to objectify the results of osteopathic correction in patients with cervical dorsopathy
(Применение локальной инфракрасной термометрии для объективизации результатов остеопатической коррекции у пациентов с дорсопатией шейного отдела позвоночника)
Belash, V. O., Mokhov, D. E.
Russian Osteopathic Journal, 2026/07
91

Multidisciplinary approach to the treatment of patients with voice disorders
(Мультидисциплинарный подход в терапии пациентов с нарушением голосовой функции)
Demidov, E. E., Mikheeva, E. I., Revina, M. B.
Russian Osteopathic Journal, 2026/07
92

Development of the training system in the field of osteopathy
(Развитие системы подготовки кадров в области остеопатии)
Ilyina, L. A., Tregubova, E. S., Mokhov, D. E., Postnikov, M. A., Kolsanov, A. V.
Russian Osteopathic Journal, 2026/07
93

Strategic development of the Russian Osteopathic Association as a driver of professional community consolidation
(Стратегическое развитие Российской остеопатической ассоциации как драйвера консолидации профессионального сообщества)
Likhaya, Y. S., Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2026/07
94

Medical record keeping procedures for osteopathic physicians providing osteopathy-based medical care in outpatient clinics
(Порядок ведения медицинской документации врачами-остеопатами при оказании медицинской помощи по профилю «остеопатия» в амбулаторно-поликлинических учреждениях)
Mokhov, D. E., Tregubova, E. S., Belash, V. O., Nenashkina, E. N.
Russian Osteopathic Journal, 2026/07
95

Evaluation of the clinical effectiveness of osteopathic correction as part of the complex treatment of chronic pyelonephritis in pregnant women based on evidence-based medicine indicators
(Оценка клинической эффективности остеопатической коррекции в составе комплексного лечения хронического пиелонефрита у беременных на основе показателей доказательной медицины)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O., Gavrilova, T. A.
Russian Osteopathic Journal, 2026/07
96

Neurophysiological and psychological phenomena of the doctor–patient diet interaction at the osteopathic appointment
(Нейрофизиологические и психологические феномены взаимодействия диады врач–пациент на остеопатическом приеме)
Piskunova,  G. Y., Osetrova, M. A.
Russian Osteopathic Journal, 2026/07
97

The effectiveness of osteopathic intervention on the diaphragm in intensive care unit patients on long-term mechanical ventilation
(Эффективность остеопатического воздействия на диафрагму у пациентов отделения реанимации, длительно находящихся на искусственной вентиляции легких)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2026/07
98

Support in Singing-A Pilot Prospective Randomized Crossover Study of Osteopathy and Singing Technique in 15 Amateur Singers
Bie, J. M., Tempesta, M., Sadolin, C., Aaen, M.
Journal of Voice, 2026/07
Free full text
99

A hands-on approach to personalizing palliative care: the role of osteopathic manipulative treatment
Bryant, M., Dennison, M., Kim, S.
Frontiers in Medicine, 2026/07
Free full text
100

Clinically significant lung function improvement for collegiate soccer players after OMT with restrictive ribcage motion correlated with Expanded Zink screen
Leung, D. Y., Stiles, E. G.
Journal of Osteopathic Medicine, 2026/07
Free full text
101

Establishing international expert consensus on core competencies and best practices in osteopathic education: a modified Delphi study protocol
Kovanur Sampath, K., Engel, R., Keter, D.
BMJ Open, 2026/07
Free full text
102

Board exam preparation resource trends in academic health sciences libraries serving colleges of osteopathic medicine programs
Muellenbach, J., Robinson, K., Chen, H. L., Bright, H. S. IV., Fitterling, L.
Journal of the Medical Library Association, 2026/07
103

Non-Pharmacologic Manual Therapies for Postoperative Bowel Dysfunction: A Systematic Review and Meta-Analysis
Ponce, A., Stack, E. R., Perrine, O., Hawes, C.
Journal of Clinical Medicine, 2026/07
Free full text
104

Imaging predictors of short term clinical response to osteopathic manipulative treatment in patients with knee osteoarthritis
Zhang, B., Pang, Y., Bai, Y., Yin, S., Yan, Y., Li, X., Wang, X., Zhang, Y., Wang, C., Tian, X., Du, S.
Scientific Reports, 2026/07
105

A biodynamic osteopathic approach with attentive touch improves postural stability in healthy adults: a randomized controlled trial
Bettoni, R., Consorti, G., Scattolin, M., Scattolin, D., Abenavoli, A.
Journal of Osteopathic Medicine, 2026/07
Free full text
106

Identifying and Treating Concurrent Referred and Musculoskeletal Back Pain Using an Osteopathic Approach
De Castro, P. C., Zaremski, K. A.
Osteopathic Family Physician, 2026/07
Free full text
107

Integrating Osteopathic Manipulative Medicine Into Hospice Care
Najadifar, T., Savory, R.
Osteopathic Family Physician, 2026/07
Free full text
108

Does visceral OMT improve urinary incontinence in adult women?
Amheiser, A., Tyler, C.
Evidence-Based Practice, 2026/07
109

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/07
Free full text
110

Regarding “Where are the Black men in osteopathic medical schools?”
Bohler, F., Garden, A. R.
Journal of Osteopathic Medicine, 2026/07
Free full text
111

Response to: Regarding “Where are the Black men in osteopathic medical schools?”
Megafu, M.
Journal of Osteopathic Medicine, 2026/07
Free full text
112

Pain Management Across Special Populations: Pediatrics, Geriatrics, and Pregnancy
Poliak-Tunis, M., Khakhkhar, S., Ayres, B.
Physical Medicine and Rehabilitation Clinics, 2026/06
113

Combined effects of photobiomodulation and osteopathic manipulation on the physical performance of young adults subjected to exercise-induced muscle damage: a randomized placebo-controlled trial
Freitas, J. C., Bocchi, M., Rodrigues Junior, B. A., Machado, M. R. F., Rezende, H. H. A., de Oliveira, D. M., Fernandes, E. V.
Lasers in Medical Science, 2026/06
Free full text
114

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2026/06
Free full text
115

Artificial Intelligence in Osteopathy Education: A Critical Analysis of Educators' and Researchers' Perspectives
Suherman, U., Ulfah., Krinanda, V. D., Suhardita, K., Saputra, R., Putra
International Journal of Osteopathic Medicine, 2026/06
116

Role of osteopathic manipulative treatment in the management of persistent post-COVID-19 symptoms and functional outcomes: study protocol of a prospective pilot study
Degenhardt, B. F., Rehman, Y., Luebbering, C., Divine, W. H., Jackson, M.
Journal of Osteopathic Medicine, 2026/06
Free full text
117

It’s All in Your Head: A Case Report of Persistent Postural-Perceptual Dizziness and Chronic Anxiety Treated Simultaneously With Osteopathic Cranial Manipulative Medicine
Libman, A. E., Volokitin, M. I., Lee, D., Wang, K., Maydan, D., Benyaminov, T., Tarbay, L. N., Petrov, K. M.
Cureus, 2026/06
Free full text
118

Long-term chronic pain outcomes among patients treated by osteopathic physicians: per-protocol analysis of a retrospective cohort study
Licciardone, J. C., Raphi, R., McKnight, K. N., Warnesuriye, R. N., Kim, J., Black, J., Aryal, S.
Journal of Osteopathic Medicine, 2026/06
Free full text
119

Osteopathic manipulative treatment among long-term opioid prescribed patients
Yorkgitis, B. K., Harmon, I., Khan, A., Webb, F., Brat, G.
Journal of Osteopathic Medicine, 2026/06
Free full text
120

Letter to the editor: Thoracic biomechanics or autonomic modulation? Reframing the respiratory effects of osteopathic manipulative therapy
Wahyudin, H.
International Journal of Osteopathic Medicine, 2026/06
121

Fellowship Training Trends Among Spine Neurosurgeons in Florida: A Cross-Sectional Analysis
Fioletova, M., Gill, U., Lugo, A., Echevarria Cruz, E. C., Sees, J. P.
Cureus, 2026/06
Free full text
122

Emerging treatment options for vaginismus: a comprehensive review of current evidence and future directions
Lauver, A., Addison, D., Anderson, J., Boyle, B., McDonald, H., Rizzo, D., Schraml, A., Jedynak-Bell, C., Mansour, T., Ashurst, J.
Journal of Osteopathic Medicine, 2026/06
Free full text
123

Effects of Osteopathic Manipulative Treatment in a 3-Year-Old With Pitt-Hopkins Syndrome
Duggal, V., Radigan, R., Finkelstein, A., Yao, S.
Case Reports in Pediatrics, 2026/06
Free full text
124

Responsiveness of Outcome Measures in Chronic Non-Specific Low Back Pain: A Secondary Analysis of a Randomized Controlled Trial
Fonseca, C. L., Ribeiro, P. A. S., de Carvalho, K. C. N., Andraus, R. A. C., de Moura, R. C. F., da Trindade, A. M. V., Dumont, A. J. L., Fernandes, T. V., Marconi, D. G., Pasin Neto, H., Armbrust, D., Oliveira, C. S.
Journal of Personalized Medicine, 2026/06
Free full text
125

Osteopathic Manipulative Treatment as a Complementary and Integrative Approach for Cancer Supportive Care: A Systematic Review
Patel, S., Thimons, C. J., Steele, H., Mathur, M., Boesler, D., Bishayee, A.
Cancers, 2026/06
Free full text
126

Osteopathic manipulative treatment for refractory chronic traumatic pain and mobility restrictions at a level 1 trauma center
Baltazar, G. A., Cao, M., Van Vleet, J., Hart, S., Jakubowski, A., Suree, N., Petrone, P., Islam, S., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2026/06
Free full text
127

Predictability of cranial base strains as related to birth presentation: a review of literature
McElwain, S. K., Schmidt, D.
Journal of Osteopathic Medicine, 2026/06
Free full text
128

The role of osteopathic manipulative medicine in cerebral palsy: bridging treatment gaps and enhancing care
Ngo, A. L., Gharavi Alkhansari, N., Tadakamalla, R., Hess, M., Nguyen, U. T., Yazji, J., Rogers, R. S.
Journal of Osteopathic Medicine, 2026/06
Free full text
129

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2026/06
130

Traumatic Injury in the Elderly: Exploring Injuries Associated With the Use of Mobility and Disability Aids in Adults 65 Years and Older
Brown, A., Wong, M., Ramkumar, V., Patel, P., Shah, S., Aldret, S.
Osteopathic Family Physician, 2026/06
Free full text
131

Fatigue in long COVID: An exploratory pragmatic randomized trial of osteopathic care plus physical therapy versus physical therapy alone
Curi, A. C. C., Antunes Ferreira, A. P., Nogueira, L. A. C., Meziat Filho, N., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2026/06
Free full text
132

Pain-related knowledge and attitudes of osteopaths practicing in Switzerland: Insights from a cross-sectional study
Dumolard, C., Jaquier, V., Delalay, G., Kebbi Beghdadi, S., Zryd, S., Haller, F., Iglesias, K.
International Journal of Osteopathic Medicine, 2026/06
Free full text
133

Professionalization and identity construction of French osteopathy: Toward a hybrid model
Garnier, F., Gobert, J., Braccini, V., Kepka, S.
International Journal of Osteopathic Medicine, 2026/06
134

Perceptions of osteopaths with specific undergraduate psychologically informed osteopathic training regarding its usefulness in clinical practice: a mixed-methods study with implications for education
Ronchi, M., Dognini, S., Giusti, E., Maggiani, A.
International Journal of Osteopathic Medicine, 2026/06
135

Osteopathic manipulative treatment, pain neuroscience education and clinical hypnosis as pain management interventions in chronic low back pain: a randomized sham-controlled feasibility pilot trial
Luchesi, G. L. S., da Silva, A. K. F., Chaves, T. C., Jassi, F. J.
Journal of Bodywork and Movement Therapies, 2026/06
136

A survey of United Kingdom (UK) animal osteopaths: Training and clinical practice
Wingate, P.
International Journal of Osteopathic Medicine, 2026/06
137

Exploring the dynamics of a multi-professional care approach in pediatric oncology: insights from the Sport Therapy Project - a focus group study
Zangoni, G., Raineri, S., Pini, S., Chinellato, E., Dognini, S., Frittoli, C., Rivolta, C., Abenavoli, A.
International Journal of Osteopathic Medicine, 2026/06
138

Impact of Osteopathic Manipulative Technique and Circuit Interval Training on Sympathetic Hyperactivity in Pcos Women
Palanisamy, S., Janakiraman, B., Balasubramaniam, A., Kandasamy, M., Velliyangiri, S., Venkatachalam, M.
International Journal of Drug Delivery Technology, 2026/06
Free full text
139

Response to: “From documentation to judgment: What peer-supported audit really changes in IFOMPT implementation”
Bailey, D., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2026/06
140

From documentation to judgment: What peer-supported audit really changes in IFOMPT implementation
Wahyudin, H., Putri, S. N. J., Megawati, M., Khotimah, H., Prabowo, A. S.
International Journal of Osteopathic Medicine, 2026/06
141

Response to “Thoracic biomechanics or autonomic modulation? Reframing the respiratory effects of osteopathic manipulative therapy”
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Pivetta, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/06
142

Effectiveness of an algorithm for approaching temporomandibular disorders with osteopathic manipulative treatment in patients with fibromyalgia: A randomized, controlled trial protocol
De La Iglesia, L., Bravo, C., Rubí-Carnacea, F.
International Journal of Osteopathic Medicine, 2026/06
Free full text
143

Exploring the utility of ChatGPT as a learning tool in osteopathic medical education
Martin, P., Pate, N., Benmerzouga, I.
International Journal of Osteopathic Medicine, 2026/06
144

Methodological considerations for evaluating ChatGPT as a learning tool in osteopathic medical education
Saripudin, M., Hamdan, A. H., Asiah, N.
International Journal of Osteopathic Medicine, 2026/06
145

Journal Club 2026 – 2
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/06
146

Ein osteopathischer Ansatz für den ganzen Körper: Multiple Schmerz- und Stressstimuli
(An osteopathic approach to the whole body: Multiple pain and stress stimuli)
Jarvis, L.
Osteopathische Medizin, 2026/06
147

Konzeptualisierung der osteopathischen Praxis: Das 4-Stufen-Modell zur Synchronisation von Patient*in, Behandler*in und Umwelt
(Conceptualization of Osteopathic Practice: The 4-Step Model for Synchronizing Patient, Practitioner, and Environment)
Lunghi, C., Baroni, F., D&rsquo, Alessandro, G., Zegarra-Parodi, R., Liem, T.
Osteopathische Medizin, 2026/06
148

ADHS und chronische Schmerzen: Gibt es Hinweise auf eine gemeinsame Pathophysiologie?
(ADHD and Chronic Pain: Is There Evidence of a Shared Pathophysiology?)
Nibler, R.
Osteopathische Medizin, 2026/06
149

Revolutionizing Osteopathic Education: Integrating ChatGPT and Virtual Reality for Immersive Learning
Wahyudin, H., Oktasari, M., Megawati, M., Mufarida, H., Elviana, E., Kuswandi, A.
International Journal of Osteopathic Medicine, 2026/06
150

Aus der digitalen Welt: Das Herz und der Vagus
(From the Digital World: The Heart and the Vagus Nerve)
Sonntag, M.
Osteopathische Medizin, 2026/06
151

Können wir mit Osteopathie immunologische Wirkungen erzielen? Interview zum Artikel „COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial”
(Can osteopathy produce immunological effects? Interview regarding the article “COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial”)
Szurmant, H., Kramme, P., Eichhorn, V.
Osteopathische Medizin, 2026/06
152

Effect of osteopathic technique on respiratory parameters and pain in thoracic outlet syndrome
Elshinnawy, A. M., Eraky, Z. S., Abdallah, E. A., Elmasry, H. M., El-Samouly, H. M.
Journal of Bodywork and Movement Therapies, 2026/06
153

INIOST-Studienreport 2025: Eine bibliometrische Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2025
(INIOST Study Report 2025: A Bibliometric Overview of Osteopathic Studies Published Worldwide in 2025)
Franke, H.
Osteopathische Medizin, 2026/06
154

Ein osteopathischer Ansatz für den ganzen Körper: Multiple Schmerz- und Stressstimuli
(An osteopathic approach to the whole body: Multiple pain and stress stimuli)
Jarvis, L.
Osteopathische Medizin, 2026/06
155

Osteopathie in Österreich
(Osteopathy in Austria)
Newiger, C.
Osteopathische Medizin, 2026/06
156

Osteopathie in Österreich
(Osteopathy in Austria)
Newiger, C.
Osteopathische Medizin, 2026/06
157

Können wir mit Osteopathie immunologische Wirkungen erzielen? Interview zum Artikel „COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial”
Szurmant, H., Kramme, P., Eichhorn, V.
Osteopathische Medizin, 2026/06
158

On the Privilege of Being an Osteopathic Trauma Surgeon
Akam, E.
The AAO Journal, 2026/06
159

Tinnitus Tone Change Following OMT and Implementation of a Heel Lift: A Case Study
Ring, A., Kurian, A., Llanio, L., Rundquist, L., Shih, S., Schneider, N., Qureshi, Y.
The AAO Journal, 2026/06
160

Health profession students' anxiety, depression, and imposter syndrome in a rural versus urban setting
Sperling, E. L., Kennedy, K., Mehrazar, T., Takahashi, M., Rezayee, S., Zitek, C., Gresner, E., Hudson, M. G.
BMC Medical Education, 2026/05
Free full text
161

Knowledge, Utilization, and Perceptions of Artificial Intelligence in Medical Education Among Preclinical Osteopathic Medical Students and Faculty: A Cross-Sectional Study
Panta, R., Francois, L., Cordash, H., Orent, J.
Cureus, 2026/05
Free full text
162

Osteopathic manipulative treatment in the management of headaches associated with musculoskeletal dysfunction: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Ying-Fang Wang, M., Johnston, R., Will, M., Gibson, E., Spencer, D., Garcia, C., Snider, K. T.
Journal of Osteopathic Medicine, 2026/05
Free full text
163

Osteopathic manipulative treatment for stress, anxiety, and depression: Toward mechanism-informed evidence
Ariyadi, S., Syarifah, E. F., Hermawatie, N. A., Lakilaki, E., Adha, A., Putri, R. D., Ilahi, A.
Explore (NY), 2026/05
164

Untangling the Osteopathic Gordian Knot: Reconceptualized Principles for Sustainable and Contemporary Clinical Practice-A Conceptual Perspective
Lunghi, C., Baroni, F., D'Alessandro, G., Longobardi, M., Consorti, G., Vanacore, N., Tramontano, M.
Healthcare, 2026/05
Free full text
165

Effectiveness of Manual Therapy in Patients with Obstructive Airway Disorders: A Scoping Review
Mankad, D. A., Chokshi, T. R., Satani, K.
Journal of Clinical and Diagnostic Research, 2026/05
Free full text
166

The definition of an osteopathic physician trained in the United States
Fleming, R. K., Giusti, R. E., Snider, K. T., Gebhardt, G. P., Seals, R., Zajdel, B., Heinking, K.
Journal of Osteopathic Medicine, 2026/05
Free full text
167

Correlation Between Screen Time, Sleep Duration, and Stroop Effect Among First-Year Osteopathic Medical Students: A Cross-Sectional Study
Panta, R., Del Corral, P., Hales, S., Fernandez, P., Ahearn, E., Parsamian, M.
Cureus, 2026/05
Free full text
168

Osteopathic Treatment of Postprandial Cardiovascular Symptoms Suggestive of Altered Autonomic Regulation: A Case Report
Shehadeh, H.
Cureus, 2026/05
Free full text
169

Short-term benefits of osteopathic manipulative treatment for chronic low back pain: systematic review and meta-analysis
Sheppard, M., Blades, K., Kabbara, J., Bui, A., Hendryx, J.
Journal of Osteopathic Medicine, 2026/05
Free full text
170

Integrating Focused Assessment With Sonography for Trauma (FAST) Ultrasound Training Into the Osteopathic Medical Student – Year 1 (OMS-I) Curriculum: A Prospective Observational Study of Student Perceptions and Confidence
Tomassetti, C., Van Hoozier, H. G., Divaker, J., Persaud, N. A., Brecher, L.
Cureus, 2026/05
Free full text
171

Peer instruction in preclinical osteopathic microbiology education: a single-group pre-post quasi-experimental study of short-term performance outcomes and student perceptions
Nepal, H. P., Bramblett, D. E., Benson, M.
BMC Medical Education, 2026/05
Free full text
172

Efficacy of treatment for subacromial pain in older adults: a systematic review and meta-analysis with GRADE recommendations
de Castro Mariz, G., Xavier, D. M., Ferreira Barroso, M. M., de Carvalho Bastone, A., Arrieiro, A. N., de Oliveira, V. C., de Oliveira, M. X.
European Geriatric Medicine, 2026/05
Free full text
173

Crowdsourcing Medical School Admissions Data: Development and Analysis of the CycleTrack Platform
Amusin, D. B., Hua, I., Kozhumam, A. S.
Journal of Medical Internet Research, 2026/05
Free full text
174

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2026/04
Free full text
175

Evaluating the acute effect of osteopathic manipulative treatment on sprint performance in young adults
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., McKinlay, K. J., Roush, A. J., Cosgrave, C.
Journal of Osteopathic Medicine, 2026/04
Free full text
176

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2026/04
Free full text
177

Teaching the next generation of physicians: Evaluating addiction medicine curriculum interventions across two U.S. Medical schools
Walsh, M., Greenberg, I. S., Reilly, J. M., Poland, C.
Journal of Addictive Diseases, 2026/04
Free full text
178

Osteopathic manipulative medicine lymphatic drainage techniques for venous insufficiency and peripheral arterial disease: a review
Agha, I., Susla, L., Ryder, E., Udhwani, G. N., Yao, S. C.
Journal of Osteopathic Medicine, 2026/04
Free full text
179

Investigating the efficacy of osteopathic manipulative treatment for intractable hiccups: a pilot study
Bowman, D. E., Jamo, E. C., Bloch, R. R., Tepper, Z., Poland, E. M., Kempa, M., O&rsquo, Brien, C., Fong, K., Shahbain, A., Kamm, M. A., O&rsquo, Hara, J. R., Lee, A. S., Lippert, J.A.
Journal of Osteopathic Medicine, 2026/04
Free full text
180

21st century osteopathic medicine: a modern perspective
Dery, M.A.
Journal of Osteopathic Medicine, 2026/04
Free full text
181

Evaluating median nerve stiffness in patients with mild to moderate-severe idiopathic carpal tunnel syndrome receiving OMT and conservative therapy: a pilot study
Gazaille, R., Knox, C., Pershing, M., Pugar, K. D., Bamberger, H. B., Schoen, J., Hess, N., Nickolson, C., Vickery, T., Flowers, D., Marati, A., LaCombe, K., Mall, S.
Journal of Osteopathic Medicine, 2026/04
Free full text
182

Demographics of physicians in family medicine residencies during the transition to single GME accreditation
Ginoza, J. A., Weaver, J. M., Meyer, D. L., Maier, R. G.
Journal of Osteopathic Medicine, 2026/04
Free full text
183

A Nationwide Survey of the Spine Education of Medical Students
Henn, M. C., Rae, A., Fecker, A. L., McIntyre, M., Larsen, A., Wright, J.
Cureus, 2026/04
Free full text
184

Osteopathic manipulative treatment and cervicogenic headache: a randomized controlled trial
Klemm, S. T., Klemm, W., Semmler-Ludwig, R., Witt, M.
Journal of Osteopathic Medicine, 2026/04
Free full text
185

Potential Adjunctive Role of Osteopathic Manipulative Medicine in the Management of Cancer-Related Bone Pain: A Narrative Review
Ngo, A. L. T., Gharavi Alkhansari, N., Pham, C., Nguyen, H., Rubi, M., Tanner, D.
Cureus, 2026/04
Free full text
186

Osteopathic Manipulative Treatment for Complex Regional Pain Syndrome: A Scoping Review of Current Evidence
Ponce, A., Nguyen, P., Reves, J.
Cureus, 2026/04
Free full text
187

Manual therapy modalities and depression: a systematic review
Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2026/04
Free full text
188

Factors Influencing Interest in Urology Among Osteopathic and Allopathic Medical Students: A Single-Institution Cross-Sectional Survey
Woodworth, E., Sheppard, C., Wong, R., Mayrovitz, H. N.
Cureus, 2026/04
Free full text
189

Osteopathic Manipulative Treatment for the Breastfeeding Dyad: A Scoping Review
Chen, A. I., Mercer, A., Conaway, E., Heskett, K. M., Tobey, A. H., Campbell, M., Panza, M., Wolf, K.
Journal of Human Lactation, 2026/04
190

Integrating Osteopathic Care Into Treatment of the Breastfeeding Dyad: Anatomic and Physiologic Considerations
Conaway, E., Tobey, A. H., Chen, A. I., Mercer, A., Wolf, K.
Journal of Human Lactation, 2026/04
191

Multidisciplinary Care Models for Managing Fibromyalgia
Reynolds, C., Nair, S., Agnello, R.
Osteopathic Family Physician, 2026/04
192

A mechanistic hypothesis: osteopathic manipulative therapy may modulate immune cell function in chronic low back pain
Tehrani, L., Gamer, J., Ballarin, S., Arango, S., Widboom, N., Barry, P., Sandhouse, M., Wallace-Ross, J., Qureshi, Y., Nathanson, L.
Frontiers in Pain Research, 2026/04
Free full text
193

Medical and Non-Surgical Strategies for Mild Traumatic Brain Injury
Kim, M. S.
Korean Journal of Neurotrauma, 2026/04
Free full text
194

An Osteopathic Perspective on the Mastitis Spectrum
Oshay, R. R., Loveless, B. J.
Osteopathic Family Physician, 2026/04
Free full text
195

Pain: a century-old approach to treatment with objective documentation
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2026/04
Free full text
196

Correlational analysis of COMAT FBS and COMLEX-USA Level 1 scores
Liu, J., Barnum, S., Dukat, R., Liang, M.
Journal of Osteopathic Medicine, 2026/04
Free full text
197

From guidelines to practice: collective learning through clinical audit of the IFOMPT cervical framework
Bailey, D., Fawkes, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2026/03
198

Barriers and facilitators to the use of Patient Reported Outcome Measures by Australian osteopaths
Eaves, S., Kalatzis, G.
International Journal of Osteopathic Medicine, 2026/03
199

Osteopathischer Ansatz zur Verbesserung der Vaskularisation und Sauerstoffversorgung
(An osteopathic approach to improving blood flow and oxygen supply)
Peeters, L.
DO - Deutsche Zeitschrift für Osteopathie, 2026/03
200

Osteopathie bei chronischen Schmerzen und Adenomyose (qualitative Studie)
(Osteopathy for Chronic Pain and Adenomyosis)
Welge, O.
DO - Deutsche Zeitschrift für Osteopathie, 2026/03
201

Umsetzung osteopathischer Prinzipien in der Ausbildung
Weyland, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/03
202

Non-drug treatment methods in the treatment of pain syndrome in patients with cervical dorsopathy
(Немедикаментозные методы в терапии болевого синдрома у пациентов с дорсопатией шейного отдела позвоночника)
Belash, V. O.
Russian Osteopathic Journal, 2026/03
203

Integrative approaches to the treatment of idiopathic facial neuropathy
(Интегративные подходы к лечению идиопатической невропатии лицевого нерва)
Novikov, Y. O., Musina, G. M., Akopian, A. P., Musina, S. M.
Russian Osteopathic Journal, 2026/03
204

Kritische Einordnung einer Stellungnahme der Französischen Akademie für Medizin: Anlass ist die Pressemitteilung zur viszeralen und kranialen Osteopathie bei Neugeborenen seitens der Académie Nationale de Médecine
(Critical assessment of a statement by the French Academy of Medicine: The occasion is the press release on visceral and cranial osteopathy in newborns by the Académie Nationale de Médecine)
Eichhorn, V., Franke, H.
Osteopathische Medizin, 2026/03
205

A case of closure of the patent ductus arteriosus and patent foramen ovale in a 12-year-old patient during a course of osteopathic correction
(Случай закрытия открытого артериального протока и открытого овального окна у пациента 12 лет на фоне курса остеопатической коррекции)
Pervushkin, E. S., Potekhina, Y. P.
Russian Osteopathic Journal, 2026/03
206

Stabilometry as a method of the osteopathic correction effectiveness assessment in patients with postoperative scars on the anterior abdominal wall and chronic nonspecific lower back pain
(Стабилометрия как метод оценки эффективности остеопатической коррекции у пациенток с послеоперационными рубцами на передней брюшной стенке и хронической неспецифической болью в нижней части спины)
Polismak, O. V., Potekhina, Y. P., Khatkevich, A. V.
Russian Osteopathic Journal, 2026/03
207

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03
208

Methods for assessing the state of the musculoskeletal system in children-athletes and osteopathic correction of functional disorders
(Методы оценки состояния опорно-двигательного аппарата у детей-спортсменов и остеопатическая коррекция функциональных нарушений)
Popov, K. O., Gayduk, A. A.
Russian Osteopathic Journal, 2026/03
209

Placebo-Effekte in der Osteopathie und anderen manuellen Therapien – Teil 2: Bedeutung für die klinische Praxis, Ausbildung und Forschung
(Placebo effects in osteopathy and other manual therapies – Part 2: Significance for clinical practice, training, and research)
Hohenschurz-Schmidt, D., Liem, T.
Osteopathische Medizin, 2026/03
210

Ein osteopathischer Ansatz für den ganzen Körper: Kompensationsstrategien
(An osteopathic approach for the whole body: compensation strategies)
Jarvis, L.
Osteopathische Medizin, 2026/03
211

Technology for creating a personal brand for an osteopathic physician
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2026/03
212

Wirksamkeit von Osteopathie und Übungsbehandlung bei Fehlbissen: Eine fallstudienbasierte Untersuchung
(Effectiveness of osteopathy and exercise therapy for malocclusion: A case study-based investigation)
Mach, T.
Osteopathische Medizin, 2026/03
213

Spezifische, kontextuelle und unspezifische Effekte in der Osteopathie
(Specific, contextual, and non-specific effects in osteopathy)
Tripodi, N., Lawton, A., Corcoran, D., Feehan, J.
Osteopathische Medizin, 2026/03
214

413 Student-Led Pathology Elective Expands Early Exposure and Strengthens Specialty Interest at an Osteopathic Medical School
Barron, N., Herman, M., Leung, M., Kowalski, P.
Laboratory Investigation, 2026/03
215

Osteopathic Manipulative Treatment as Supportive Care for a Pediatric Patient with a Cerebral Cavernous Malformation: A Case Study
Christian, A. B., Crull, C. J., Agnello, R. N., Motyka, T. M.
The AAO Journal, 2026/03
216

Physiological changes of cortisol and oxytocin following manual therapy: a scoping review
Cao, A. T., Alanazi, M. S., Billings, R., Reed, W. R.
Frontiers in Rehabilitation Sciences, 2026/03
Free full text
217

Construction and reflection of the core outcome set for clinical trials of Mongolian orthopedic manipulation therapy for humerus surgical neck fracture
(蒙医整骨手法治疗肱骨外科颈骨折临床试验的核心指标集构建与思考)
Chen, X., Jin, A., Yang, L., Fan, Z., Gele, T., Guo, X., Liu, S.
Zhongguo gu shang (China Journal of Orthopaedics and Traumatology), 2026/03
218

Osteopathic Manipulation to Increase Lactation Quantity: The OMILQ Study Protocol
Conaway, E. M., O'Donnell, A. E.
The AAO Journal, 2026/03
219

Dual-degree programs in undergraduate medical education: a scoping review
Landau, R., Caplan, C., Hale, E., Harris, J., Albuquerque, E., Agarwal, G. G., Taldone, S.
Academic Medicine, 2026/03
220

An Osteopathic Approach to Hereditary Angioedema Attacks with Predominant Gastrointestinal Features and Concomitant Back Pain: A Case Report
Rowane, M. J., Petro, J., Shilian, R., Rajan, J., Rowane, M. P, Hostoffer, R. W.
The AAO Journal, 2026/03
221

Unexpected Resolution of Chronic Hyposmia Following Osteopathic Manipulative Treatment Applied with Area of Greatest Restriction and Sequencing: A Case Report
Sandoval, A. P., Schneider, R. M.
The AAO Journal, 2026/03
222

Osteopathic manipulative treatment for mental health: Methodological considerations and the potential integration of reality therapy principles
Sona, D., Habsy, B. A., Purwoko, B., Pratiwi, T. I., Nursalim, M., Irawan, A. W.
Explore (NY), 2026/03
223

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03
224

Assessing the use of cardiac ultrasound as an adjunct to physiology education at the medical school level
Sudler, S. R., Vroegop, S. A., McDonald, H. M., Weiss, E., Dennard, D., Irwin, C., Finch, C., Al-Nakkash, L.
Advances in Physiology Education, 2026/03
Free full text
225

Immediate Effects of Osteopathic Manipulative Therapy on Thoracoabdominal Mobility, Respiratory Muscle Strength and Pulmonary Function in Healthy Men: Preliminary Crossover Trial
Zago, J., Rondinel, T., Urueña, B., Amatuzzi, F., Queiroz, R., Nascimento, L., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2026/03
226

Integrative medicine for pain among adolescent and young adult patients with cancer: a scoping review
Wu, H. V., Lam, C. S., Chimonas, S., Tap, W. D., Bender, J. G., Mao, J. J.
Journal of Cancer Survivorship, 2026/03
227

Effect of osteopathic vs sham treatment and test-retest improvements on smooth pursuit eye movements
Wogue, R., Paire, A., Cornille, C., Pillevesse, I., Demoury, L., Gharmaoui, M., Paeye, C.
Complementary Therapies in Medicine, 2026/03
228

Interprofessional Education at Colleges of Osteopathic Medicine Improve Confidence in Interprofessional Teamwork and Patient Handoffs
Driesenga, S. J., Burrington, R. G., Jain, A., Selinsky, S., Waseem, R. A., Divito, C. B.
Cureus, 2026/03
Free full text
229

Role of Osteopathic Manipulative Treatment in Perioperative Pain Management: A Systematic Review With Exploratory Meta-Analysis
Ghotra, K., Iyer, A., Uberti, J., Armstrong, N., Lai, S., Whittaker, A., Scherer, T., Iyer, K.
Cureus, 2026/03
Free full text
230

Gender and Osteopathic Representation in U.S. General Surgery Residency, 2024-2025: Divergent Patterns Across Postgraduate Training
Mehdiyar, D., Baule, S. M., Nguyen, J., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J. K., Sees, J. P.
Cureus, 2026/03
Free full text
231

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text
232

Perspectives of Anatomy Education Among Osteopathic Medical Students: A Cross-Sectional Survey
Heins, R. J., Mindrup, M., Hemaya, J., Sloan, S. S.
Cureus, 2026/03
Free full text
233

Improvement of Chronic Lateral Knee Pain Through Osteopathic Manipulative Treatment Targeting Anterior Fibular Head Somatic Dysfunction: A Case Report
Libman, A. E., Volokitin, M., Speiser, J., Rocchio, L., Benyaminov, T., Tai, N., Naseer, S.
Cureus, 2026/03
Free full text
234

Osteopathic Manipulative Treatment for Asthma: A Systematic Review of Objective Pulmonary Function Outcomes
Ponce, A., Perrine, O., Heintzelman, K. A.
Cureus, 2026/03
Free full text
235

Shifting Focus: An Advocacy-Focused Analysis of Omega Beta Iota’s Membership and Political Engagement Strategies
Rashid, M. F., Rizvi, S. A.
Cureus, 2026/03
Free full text
236

Osteopathic Manipulative Treatment (OMT) After Vestibular Schwannoma Resection: Methods and Framework From a Recent Retrospective Study
Chen, A. I., Mercer, A., Loader, T., Friedman, R. A., Schwartz, M. S.
Journal of Neurological Surgery, Part B: Skull Base, 2026/03
237

Addressing physician shortage in medically underserved rural and tribal communities through residency program collaboration
Bray, N. N., Raischel, M., McGuire, D., Newhardt, R., Nolan, D., Snyder, T., Som, M., VanVolkinburg, L., Landgraf, C., Wheeler, D.
Journal of Osteopathic Medicine, 2026/03
Free full text
238

Conceptualizing osteopathic medical professionalism: an institutional self-assessment rubric for colleges of osteopathic medicine
Fleming, R. K., Jones, A. C., Shelnutt, M., Slieman, T. A., White, S., Williams, B. R.
Journal of Osteopathic Medicine, 2026/03
Free full text
239

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2026/03
240

Profile of patients presenting to Australian osteopaths: Results from a national health service use survey
Vaughan, B., Fleischmann, M., Sinderholm Sposato, N., Draper-Rodi, J., Kovanur Sampath, K., Treffel, L., McIntyre, C., Morin, C., Muddle, L., Thomson, O. P.
Advances in Integrative Medicine, 2026/03
Free full text
241

Resolution of Chemotherapy-Induced Intractable Hiccups Following Osteopathic Manipulative Treatment: A Case Report
Aluri, P. S. C., Ansari, A. Z., Jorden, J. L., Ahmed, F., Hafeez, S.
Cureus, 2026/02
Free full text
242

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text
243

Impact of the Council of State Neurosurgical Societies (CSNS) Fellowship on the Development of Neurosurgical Careers: A Retrospective Study
Rawson, C., Tenhoeve, S., Oladipo, O., Carter, A., Bauer, S., Lucke-Wold, B., Benzil, D., Adogwa, O., Sharma, A., Karsy, M.
Cureus, 2026/02
Free full text
244

Pericardium-Focused Osteopathic Treatment in Chronic Cervicothoracic Pain Following Median Sternotomy for Cardiac Surgery
Shehadeh, H.
Cureus, 2026/02
Free full text
245

DO and MD Enrollment in U.S. Dermatology Residencies Following the Graduate Medical Education Merger: Implications for Access
Park, L., Beach, S., Glick, B. P., Benedetto, A. V.
Clinical Dermatology, 2026/02
246

Chronic Pelvic Pain in Females. A Multisystem Perspective for the Osteopathic Physician
Chacko, N., Abu-Sbaih, R., Ventimiglia, M., Yao, S. C.
Osteopathic Family Physician, 2026/02
247

Osteopathic Manipulative Treatment in 564 Children with Congenital Heart Disease: A Project Report
Petracca, M., Turinetto, M., Sciomachen, P., Baroni, F., Lunghi, C., Accorsi, A., Longobardi, M., Pandey, R., Pozzi, M.
Children, 2026/02
Free full text
248

Students' Research Experiences at DO-Granting and MD-Granting US Medical Schools
Shapiro, D., Franz, B., Long-Mills, E., Linares, J. I., Eldridge, D. L., Tumin, D.
Medical Science Educator, 2026/02
249

Musculoskeletal Treatments: Physical Modalities
Kobayashi, L., Carter, K. M.
FP Essentials, 2026/02
250

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2026/02
Free full text
251

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2026/02
Free full text
252

Identifying risk factors for burnout and self-harm thoughts among medical students: a multi-institutional survey study
Eddy, A. J., Bray, N. N., Place, A. J.
Journal of Osteopathic Medicine, 2026/02
Free full text
253

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01
254

Interrater Reliability of a Manual Diagnostic Protocol for Pancreatic Functional Visceral Dysfunction
Faria, M., Machado, N., de Sousa, M. C., Pires, P. M., Pires, T.
Journal of Integrative and Complementary Medicine, 2026/01
255

Refractory chronic C7 cervicobrachial algia: complete resolution after lateral manipulation of C7: a case report
Bœuf, M., Alipour, H.
Douleur et Analgesie, 2026/01
256

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2026/01
Free full text
257

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text
258

Osteopathic Manipulative Treatment for Chronic Obstructive Pulmonary Disease: A Systematic Review
Ponce, A., Paek, K. H., Heintzelman, K.
Cureus, 2026/01
Free full text
259

Effects of a myofascial and lymphatic osteopathic manipulative treatment protocol on mood and body connection: a randomized pilot study
Levy, E. C., Jung, M.K.
Journal of Osteopathic Medicine, 2026/01
Free full text
260

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text
261

Early osteopathic treatment delivered to patients with an acute lateral ankle sprain improves recovery: an investigative study
Bournon, C., Prin-Conti, D., Douay, J., Montfajon, P.A., Kanagaratnam, L., Gennai, S.
Journal of Osteopathic Medicine, 2026/01
Free full text
262

Touch-based treatments and infantile colic - Parental perceptions of treatment outcomes related to infants' crying and sleeping
Hannula, L., Rinne, S., Väänänen, T., Aarva, P., Suvilehto, J., Kemppainen, T.
Journal of Pediatric Nursing, 2026/01
Free full text
263

Development, implementation, and evaluation of interprofessional events on climate change in health professions curricula
Ly, K., Cariddi, A., Cote, M., Hall, K.
Frontiers in Medicine, 2026/01
Free full text
264

Graduate Degree Holders in the U.S. Residency Match: Trends and Outcomes (2016-2024)
Barron, D. W., Yu, H., Pendse, R. S., Barzee, B. M., Rappaport, D. E.
Journal of Medical Education and Curricular Development, 2026/01
Free full text
265

Quand l’ostéopathe attire plus que l’hôpital : réflexions sur la centralisation informelle des soins musculosquelettiques autour d’un praticien rare au Cameroun
(When the osteopath attracts more than the hospital: Reflections on the informal centralization of musculoskeletal care around a rare practitioner in Cameroon)
Npochinto Moumeni, I.
Kinesitherapie, 2026/01
266

Osteopathic manipulative treatment as a complementary and integrative approach to mitigate stress, anxiety, and depression: A systematic review
Lorenz, N., Mathur, M., Saleem, N., Penn, A., Boesler, D., Bishayee, A.
Explore (NY), 2026/01
267

Die Stimme im Einfluss des kraniosakralen Systems
(The voice under the influence of the cranio-sacral system)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
268

Einfluss der osteopathischen Behandlung auf das Verdauungssystem von Säuglingen
(Influence of osteopathic treatment on the digestive system of infants)
Pernikar, N.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
269

Wann kann man ein Ausfallhonorar berechnen?
(When can you charge a cancellation fee?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01
270

Osteopathic Manipulative Treatment for Pain With Medication and Opioid-Sparing Effects: A Narrative Review
Buroker, A. J., Savallo, M. A., Relyea, R., Eximond, M., Besong, D.
HCA Healthcare Summerville Hospital, 2026
Free full text
271

Osteopathie bei unspezifischen Rückenschmerzen (online)
, 2026
Free full text
272

The possibility of using osteopathic correction in combination with psychotherapeutic techniques in the treatment of tension headaches
(Возможность применения остеопатической коррекции в сочетании с психотерапевтическими техниками в терапии головной боли напряжения)
Rozhdestvenskiy, V. A., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/12
273

Results of manual treatment methods for functional disorders of the digestive system and problems associated with breastfeeding in children of the first year of life
(Результаты мануальных методов лечения при функциональных расстройствах органов пищеварения и проблемах, связанных с грудным вскармливанием, у детей первого года жизни)
Ulitina, N. G., Mokhova, E. S., Tregubova, E. S., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/12
274

The influence of osteopathic correction on the functional activity of the palatine tonsils in the complex therapy of chronic tonsillitis
(Влияние остеопатической коррекции на функциональную активность нёбных миндалин в комплексной терапии хронического тонзиллита)
Vedyashkina, A. S., Mokhov, D. E., Dmitrieva, I. A.
Russian Osteopathic Journal, 2025/12
275

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text
276

Welchen Einfluss haben Kenntnisse in der Embryologie auf die Befundung und Therapie in der osteopathischen Praxis - Eine Expert:innen-Interviewstudie
(The Influence of Embryological Knowledge on Diagnostic and Therapeutic Processes in Osteopathic Practice: A Qualitative Expert Interview Study)
Forstner, R.
Unpublished MSc thesis, 2025/12
Free full text
277

Effects of the COVID-19 Pandemic on the Practice of Osteopathic Manipulative Medicine: A Survey Study
Luebbering, C. J., Johnson, J. C., AminiRad-Hall, S., Kelley-Franklin, G., Degenhardt, B. F.
International Journal of Osteopathic Medicine, 2025/12
278

Effect of osteopathic manipulative treatment on primary pelvic pain - A systematic review with meta-analysis
Parada, J. G., da Silva, E. B., Fernandes, A. P., Portugal, G. B.
International Journal of Osteopathic Medicine, 2025/12
279

The Impact of Preclinical Curriculum Based Serving-Learning on Osteopathic Medical Students’ Understanding of the Social Determinants of Health
Touma, O., Lacaze, M.
Journal of Osteopathic Medicine, 2025/12
280

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12
281

Osteopathic Medical Students’ Perspectives on Osteopathic Manipulative Therapy during Third- Year Clerkships: A Cross-sectional Study of Three Osteopathic Medical Schools
Longley, S., Spears, E., Domingo, F. S., Kymes, E., Dixon, C., Weir, S.B.
Journal of Osteopathic Medicine, 2025/12
282

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12
283

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12
284

Trends in retention and attrition among osteopaths in Australia: Insights from the workforce retention and Attrition Project
Lathlean, T., Orrock, P., Malon, R., McNamara, T., Tan, J., Divakar, R., Barclay, L., Woodward, C., Saar, E.
International Journal of Osteopathic Medicine, 2025/12
Free full text
285

Educating tomorrow’s osteopaths and the crucial role of ethics teaching. Where we are now? A position paper of the Italian Academy of Osteopathic Medicine
Ferioli, E.
Medicina e Morale, 2025/12
286

A Cross-Sectional Study of Biopsychosocial Factors Associated with Utilization of Osteopathic Manipulative Treatment Among US Adults
Agostini, K., Manzaro, A., Helms, M., Bringhurst, M., Gish, E., Motyka, T.
Journal of Osteopathic Medicine, 2025/12
287

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12
288

Evaluating the Accuracy and Educational Utility of ChatGPT in Osteopathic Manipulative Medicine (OMM) and Treatment (OMT): A Cross-Sectional Performance Study
Babar, M., Arain, A., Jordan, R., Badeuax, M., Voth, S.
Journal of Osteopathic Medicine, 2025/12
289

Osteopathic Manipulative Treatment for Trauma as Adjunct for Pain and Mobility Limitations after Chest Wall Injury
Baltazar, G. A., Lopez, N., Beaulieu, D., Arrillaga, A., Ripley, D., Ippolito, M., Machado, F., Rubano, J.
Journal of Osteopathic Medicine, 2025/12
290

Evaluating Artificial Intelligence’s Accuracy in Identifying Anatomical Structures on Cadavers: Implications for Osteopathic Medical Education
Gray, J.
Journal of Osteopathic Medicine, 2025/12
291

Utilizing Osteopathic Manipulative Technique to Alleviate Restriction at the Hip from the Tibio-Fibular Joint
Barros, M., Fotopoulos, T. J., Kochno, T., Bennett, A., Salehi, J., Tehrani, N.
Journal of Osteopathic Medicine, 2025/12
292

General Osteopathic Treatment: Status quo – Teil 2
(General Osteopathic Treatment: Status Quo – Part 2)
Engel, M.
Osteopathische Medizin, 2025/12
293

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12
294

Comparative Efficacy of Anesthesia Versus Osteopathic Manipulative Treatment for Pain Outcomes in Postpartum Women: A Systematic Review and Meta-Analysis
Belli, J., Ramaraju, R., Myers, N.
Journal of Osteopathic Medicine, 2025/12
295

Exploration de l’effet de la thérapie ostéopathique viscérale (TMOv) sur la douleur et l’anxiété des personnes atteintes de lombalgies chroniques non spécifiques : une étude pilote randomisée
(Exploration of the effect of visceral osteopathic manipulative treatment (vOMT) on pain and anxiety in persons with non-specific chronic low back pain: A randomized pilot study)
Beaupré, A.
Unpublished MSc thesis, 2025/12
Free full text
296

Physician and Resident Physician knowledge of childhood obesity management guidelines
Chaar, S., Chaaban, A., Bitar, R., Hill Guseman, E.
Journal of Osteopathic Medicine, 2025/12
297

Addressing Chronic Disease Burden and Healthcare Access Gaps in People Experiencing Homelessness: A Community-Based Study Through Osteopathic Medical Student-Led Interventions in Detroit
Figueroa, K., Nallabelli, N., Abu-Zama, A., Bryce, R., Restini, C.
Journal of Osteopathic Medicine, 2025/12
298

Geschichte des osteopathischen Ansatzes für den ganzen Körper
(History of the osteopathic approach to the whole body)
Jarvis, L.
Osteopathische Medizin, 2025/12
299

Characterization and comparison of osteopathic medical student performance in pathology and laboratory medicine: an analysis of competency in an integrated organ-systems curriculum
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2025/12
300

Prämenstruelle Beschwerden: Mögliche Auswirkungen auf das PMS durch eine lymphspezifische osteopathische Techniksequenz – eine randomisiert-kontrollierte Pilotstudie
(Premenstrual symptoms: Potential effects on PMS of a lymph-specific osteopathic technique sequence – a randomized controlled pilot study)
König, A.
Osteopathische Medizin, 2025/12
301

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12
302

Wie geht Beruf? – Teil 1: Gesetzgebungsverfahren, Heilberufe und Status quo der Osteopathie in Deutschland
(How does the profession work? – Part 1: Legislative process, healthcare professions, and the status quo of osteopathy in Germany)
Newiger, C.
Osteopathische Medizin, 2025/12
303

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12
304

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12
305

Osteopathic Manipulative Treatment (OMT) for Injury Prevention in Collegiate Baseball Pitchers: Findings and Revised Protocol from a Feasibility Study on Shoulder and Hip Interventions
Nandedkar, T.
Journal of Osteopathic Medicine, 2025/12
306

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12
307

The Escape Room Experience – A Novel Learning Modality to Reinforce Team-based Problem Solving, Communicating under Stress, and Tapping Group Knowledge Among “Trapped” Preclinical Osteopathic Medical Students
Renner, T., Imwalle, S., Cain, T. J.
Journal of Osteopathic Medicine, 2025/12
308

Common Childhood Sleep Disorders and the Role of Osteopathic Manipulative Treatment
Elford, H., Ball, S., Reuter, M., Powers, B., Sahhar, H. S.
Osteopathic Family Physician, 2025/12
309

Hands-On Relief: A Pilot Study on the Use of Osteopathic Manipulative Treatment for Tension-Type Headaches
Santos, S. G., Lee, W., Doan, E., Rabiei, Y., Redding, D.
Journal of Osteopathic Medicine, 2025/12
310

Comprehensive structural analysis of piriformis muscle and sciatic nerve in cadavers: potential implications for piriformis syndrome and OMT
Shi, C., Kalagana, H., Ma, Y. T., Mehrhoff, F.
Journal of Osteopathic Medicine, 2025/12
311

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12
312

Osteopathic Manipulative Treatment of Chronic Pain and Emotional Trauma. A Case Report
Wajid, A., Volokitin, M.
Osteopathic Family Physician, 2025/12
313

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12
314

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12
315

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12
316

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12
317

Safety and Feasibility of Osteopathic Manipulative Treatment (OMT) in Addressing Plagiocephaly
Wolf, K. J., Martone, J., Varrasso, E., Belsky, J. A.
Journal of Osteopathic Medicine, 2025/12
318

Fascial Counterstrain: A methodological advancement in indirect osteopathic manipulation
Tuckey, B.
International Journal of Osteopathic Medicine, 2025/12
319

Response to Letter to the Editor “Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities” about the article “Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., & Arnal-Gómez, A. (2025). Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial. International Journal of Osteopathic Medicine, 56, 100761.”
Espí-López, G. V.
International Journal of Osteopathic Medicine, 2025/12
320

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Kovanur Sampath, K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/12
321

Ultrasound shear wave elastography to assess neck somatic dysfunction and OMT effects
Gao, J., Lynch, E., Coleman, M., Moore, J., Park, D., Wilde, B.
Journal of Osteopathic Medicine, 2025/12
Free full text
322

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/12
Free full text
323

Using Generative Artificial Intelligence (AI) to Compare Commission on Osteopathic College Accreditation (COCA) and Liaison Committee on Medical Education (LCME) Standards
Hedrick, J. S., Cottrell, S. A., Nield, L. S., Ferrari, N.
Cureus, 2025/12
Free full text
324

Efficacy of Osteopathic Manipulative Treatment for Postoperative Recovery Following Total Knee Arthroplasty: A Meta-Analysis of Randomized Controlled Trials
Oar, D. P., DeFrancisis, J. S., Boesler, D.
Cureus, 2025/12
Free full text
325

NextGenDO: A Pre-medical Outreach Program to Promote Early Exposure to Osteopathic Medicine
Quezada, K. A., Gjunkshi, L., Persaud, N. A., Hasty, R.
Cureus, 2025/12
Free full text
326

Effect of positional asymmetry palpatory models on improvement and retention of accuracy during pelvic asymmetry assessments
Hajicek, J. M., Huhn, M. B., Thurgood, A., Isemann, E. N., Barnwell, C. B., Starks, Z., Ying-Fang Wang, M., Degenhardt, B. F.
Journal of Osteopathic Medicine, 2025/12
Free full text
327

Breathing retraining and manual therapy for long COVID – A literature review
Courtney, R., Steele, Z., Collyer, I.
International Journal of Osteopathic Medicine, 2025/12
Free full text
328

The outcome of a short course of osteopathy for older adults with chronic musculoskeletal (MSK) pain. A single-arm, prospective feasibility study
Orchard, D., Bolt, D., Pinna, T., Antoni-Pineda, G.
International Journal of Osteopathic Medicine, 2025/12
329

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text
330

Assessing the Efficacy of Osteopathic Manipulative Therapy (OMT) in Managing Chronic Back Pain: A Narrative Review
Tu Zahra, H., Farheen, A., Farooq Bacha, Z., Anas Patni, M.
Dubai Medical Journal, 2025/12
331

Prolotherapy in the Academy: A Mixed Methods Survey Study
Dubey, J., Jones, N. R., Evered, J. A., Grob, R., Andrie, J., Rabago, D.
Journal of Integrative and Complementary Medicine, 2025/12
Free full text
332

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12
333

Association of neurovascular events with cervical manual therapy: A cohort study
Fraser, J. J., Lonnemann, E.
International Journal of Osteopathic Medicine, 2025/12
334

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text
335

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text
336

Osteopathic Manipulative Treatment Protocol for Postoperative Care Following Abdominal Surgery: A Quality Improvement Project
Genewick, J., Amendolara, A., Robinson, S., McDonough, M., Loera, M., Stacey, S. K.
Cureus, 2025/12
Free full text
337

Specific osteopathic diagnosis of unilateral knee pain in an elite sprinter: a case report
Mattatia, J., Leplat, A., Saiz, S.
International Journal of Osteopathic Medicine, 2025/12
338

Integrating Cranio-Cervical Neuromyofascial Continuity With Body-Wide Function in Kimmerle Anomaly: An Osteopathic Case Report
Pizzolorusso, G., Borraccia, V., Quaranta, C., D'Alessandro, G., Lunghi, C.
Cureus, 2025/12
Free full text
339

Osteopathic Manipulative Treatment Plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Rajala, J. W., Miller, D. J.
The AAO Journal, 2025/12
Free full text
340

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
The AAO Journal, 2025/12
341

Treatment of Temporomandibular Joint Pain and Dysfunction After a Motor Vehicle Accident Using an Osteopathic Approach: A Case Study
Schneider, N., Schneider, D., Sinnott, M., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2025/12
342

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/12
343

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12
344

Corrigendum to “Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution”
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/12
345

Neuropsychological indicators in patients with cervical dorsopathy and the influence of non-pharmacological treatment on them
(Нейропсихологические показатели у пациентов с дорсопатией шейного отдела позвоночника и влияние на них немедикаментозных методов лечения)
Belash, V. O., Mokhov, D. E.
Russian Osteopathic Journal, 2025/12
346

Osteopathic correction in complex treatment of patients with chronic pelvic pain syndrome
(Остеопатическая коррекция в комплексном лечении пациенток с синдромом хронической тазовой боли)
Manto, E. V., Nenashkina, E. N., Safiullina, A. A.
Russian Osteopathic Journal, 2025/12
347

Rationale for the use of osteopathic correction in the complex rehabilitation of chronic nonspecific low back pain in patients with postoperative scars on the anterior abdominal wall
(Обоснование применения остеопатической коррекции в комплексной реабилитации пациенток с послеоперационными рубцами на передней брюшной стенке и хронической неспецифической болью в нижней части спины)
Polismak, O. V., Potekhina, Y. P., Khatkevich, A. V., Paykov, A. Y.
Russian Osteopathic Journal, 2025/12
348

Osteopathic Otolaryngology Residency Match Trends: Impact of the ACGME Single Accreditation System (2010-2024)
Reardon, L., Knight, B., Santiago-Rivera, O. J., Shermetaro, C.
Spartan Medical Research Journal, 2025/112
Free full text
349

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text
350

Die osteopathische Behandlung bei Krebspatient*innen im Palliativstadium
(Osteopathic Treatment for Cancer Patients in the Palliative Stage)
Ernst, A.
Unpublished MSc thesis, 2025/11
Free full text
351

Einfluss von Osteopathie auf Schmerzen und/oder das Bewegungsausmaß des Temporomandibulargelenks bei temporomandibulärer Dysfunktion – eine systematisierte Übersicht der Studien ab 2020
(Influence of Osteopathy on Pain and/or the Range of Motion of the Temporomandibular Joint in Temporomandibular Dysfunction – A Systematized Review of Studies from 2020 Onwards)
Frenz, I.
Unpublished MSc thesis, 2025/11
Free full text
352

Der Effekt von osteopathischen Techniken an den Querdiaphragmen zusätzlich zu einem konventionellen Gleichgewichts- und Sturzpräventionstraining auf die posturale Stabilität und Balance-Sicherheit bei geriatrischen Patient_innen
(Effects of Osteopathic Treatment of the Transverse Diaphragms Combined with Conventional Balance and Fall-Prevention Training on Postural Stability and Balance Confidence in Geriatric Patients)
Gmoser, T.
Unpublished MSc thesis, 2025/11
Free full text
353

Strukturelle und funktionelle Behandlung der obstruktiven Schlafapnoe in der osteopathischen Praxis: Ein systematisches Review
(Structural and functional treatment of obstructive sleep apnea in osteopathic practice: A systematic review)
Gött, D.
Unpublished MSc thesis, 2025/11
Free full text
354

Osteopathische Behandlung bei Parkinson: Eine systematische Literaturübersicht zur Wirkung auf motorische Symptome
(Osteopathic treatment for Parkinson's disease: A systematic literature review on its effects on motor symptoms)
Höfler, M.
Unpublished MSc thesis, 2025/11
Free full text
355

Interrater-Reliabilitätstestung des Musculus Sphincter Oddi
(Interrater-reliability testing of the Musculus Sphincter Oddi)
Rinner, N.
Unpublished MSc thesis, 2025/11
Free full text
356

Auf stille Narben hören
(Validity Of The Active Listening-Test For Detecting Abdominal And Pelvic Scars)
Schirmer, A.
Unpublished MSc thesis, 2025/11
357

Wirkung von Osteopathie auf messbare Sehfunktionen bei Refraktionsfehlern – Eine systematisierte Übersichtsarbeit
(Effect of osteopathy on measurable visual functions in refractive errors – A systematized review)
Timmerberg, E.
Unpublished MSc thesis, 2025/11
Free full text
358

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text
359

Cancer Prevention and Therapy With Nutritional Science: Addressing the Gap in Medical Education and Practice
Collignon, T. E., Bishayee, A.
MedComm, 2025/11
Free full text
360

Osteopathic manipulative treatment improves mobility restrictions and statics in a patient with a pectus excavatum after a sternochondroplasty. A case report
Jeandey, K., Le Nohaïc, A., Solovei, L., Gourjon, G.
Explore (NY), 2025/11
361

Cross-sectional Survey of the Evidence Implementation Environment of the Australian Chiropractic and Osteopathic Professions
Leach, M. J.
Journal of Manipulative and Physiological Therapeutics, 2025/11
362

Prise en charge ostéopathique des douleurs pelviennes chroniques de la femme. Série de cas traités
(Osteopathic Management of Chronic Pelvic Pain in Women: A Series of Treated Cases)
Malexieux, A., Saujot, J., Contreras, S., Crépin, A.
La Revue de l'Ostéopathie, 2025/11
363

A preliminary study on the effect of quantified cranial osteopathic manipulation on wild-type and transgenic rat models of Alzheimer's disease
Hines, D., Tobey, H., Dugan, P., Boehringer, S., Helm, R., Anandakrishnan, R., Werre, S., VandeVord, P., Costa, B. M.
Journal of Alzheimer's Disease Reports, 2025/11
Free full text
364

Osteopathie bei Transidentität - Eine Einzelfallstudie zum Einfluss auf Lebensqualität, Cortisolwerte und Wohlbefinden bei einem transgender Jugendlichen unter Hormontherapie
(Osteopathy in Transgender Identity - A Single-Case Study on the Impact on Quality of Life, Cortisol Levels, and Well-being in a Transgender Adolescent Undergoing Hormone Therapy)
Gugatschka, N.
Unpublished MSc thesis, 2025/11
365

Osteopathic manipulation to increase lactation quantity: a prospective case series
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2025/11
Free full text
366

Efficacy of Musculoskeletal Manipulation for Endoscopic Discomfort in Patients Undergoing Upper Gastrointestinal Endoscopy and Colonoscopy: A Systematic Review and Meta-Analysis
Kitamura, S., Komiya, S., Kaneko, T., Tsuge, T., Watanabe, J.
Cureus, 2025/11
Free full text
367

Use of osteopathic manipulation techniques for management of acute otitis media in pediatric patients: a scoping review
Kim, C. H.S., McCray, L. R., Nguyen, S. A., Shermetaro, C., Robbins, W. K.
European Archives of Oto-Rhino-Laryngology, 2025/11
Free full text
368

Osteopathische Behandlungsansätze bei gastrointestinalen Beschwerden
(Osteopathic treatment approaches for gastrointestinal complaints)
Leitner, S.
Unpublished MSc thesis, 2025/11
369

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text
370

Einfluss einer Behandlung der reziproken Spannungsmembran, insbesondere des Tentorium cerebelli, auf das vegetative Nervensystem
(Influence of treatment of the reciprocal tension membrane, in particular the tentorium cerebelli, on the autonomic nervous system)
Schweiß, E.
Unpublished MSc thesis, 2025/11
371

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11
372

Evaluating Community Awareness of Osteopathic Manipulative Medicine and New Educational Programs in Fresno County, United States: A Cross-Sectional Survey
Mazdeyasnan, L., Shabbir, Z., Ham-Ying, J.
Cureus, 2025/11
Free full text
373

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text
374

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text
375

Swelling and skin changes: an osteopathic approach to pediatric lymphedema management
Jackson, S., Hussaini, A., Galan, J., Chung, T. C., Javed, B.
Journal of Osteopathic Medicine, 2025/10
Free full text
376

New Zealand osteopaths and the management of sport-related injury: outcomes from a practice-based research network
Tripodi, N., Fleischmann, M., Muddle, L., McLeod, G., Treffel, L., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2025/10
Free full text
377

Evaluation of Craniosacral Therapy Effects on Brain Wave Patterns in Children with Mild Autism Spectrum Disorder Using the QEEG Method
Kopańska, M., Szczygielski, J., Batrman, P., Banaś-Ząbczyk, A.
Acta Neuropsychologica, 2025/10
Free full text
378

Effectiveness of osteopathic manual treatment in the elderly population: a scoping review of clinical evidence
Molinari, L., Mingrone, L., Novelli, E.
Journal of Osteopathic Medicine, 2025/10
Free full text
379

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text
380

Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Bethea, J., Sharma, H., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
Cureus, 2025/10
Free full text
381

Exploring the use of manual therapy in the management of traumatic brain injury: a scoping review
Delion, T., Noyer, A., Gonzalès-Bandrès, M., Treffel, L., Farrell, G., Cassoudesalle, H., Ménard, M.
Chiropractic & Manual Therapies, 2025/10
Free full text
382

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text
383

Objective measurement of Cranial Rhythmic Impulse (CRI): visual analysis of an observational case series
Strada, M., Galli, M., Cattaneo, R.
Journal of Bodywork and Movement Therapies, 2025/10
384

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text
385

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10
386

Impact of touch interventions on brain activity in moderately preterm infants: study protocol for a pilot randomised controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., Tansini, L., Pisanu, D., Di Leo, D., Vergani, E., Righini, A., Arrigoni, F., Fanos, V., Rescigno, M., Veggiotti, P., Lista, G., Gazzolo, D.
BMJ Open, 2025/10
Free full text
387

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10
388

Incorporating the Certified Professional in Patient Safety credential into undergraduate medical curriculum: assessment and lessons learned
Gelinas, L., Hassan, A. K., Lieto, J., Yurvati, A. H.
Journal of Osteopathic Medicine, 2025/10
Free full text
389

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2025/10
Free full text
390

Visceral Osteopathy in Treating Refractory Irritable Bowel Syndrome: Results of a French National Multicentre Randomised Controlled Trial
Wuestenberghs, F., Sabate, J. M., Jouet, P., Mion, F., Vidon, M., Piche, T., Napoléon, M., Roman, S., Soliman, H., Benallaoua, M., Bouchoucha, M., Benamouzig, R.
United European Gastroenterology Journal, 2025/10
391

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10
392

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10
393

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text
394

Assessing Osteopathic Medical Student Knowledge of Common Vitamin and Mineral Deficiencies
Stevens, A. A., Weir, S. B.
Cureus, 2025/10
Free full text
395

Dr. William Garner Sutherland (1873-1954): A Pioneer in Cranial Osteopathy
Griswold, S. R., Brask, A. S., Bhakta, K. D., Campbell, A. M., Smith-Gonzalez, A. R.
Cureus, 2025/10
Free full text
396

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text
397

The Predictors of COMLEX-USA (Comprehensive Osteopathic Medical Licensing Examination of the United States) Level 1 Success Among Osteopathic Medical Students: The Role of Study Habits and Post-baccalaureate Background
Shults, R., Belizaire, S., Kennedy, C., Chosie, K.
Cureus, 2025/10
Free full text
398

Jaw Functional Orthopedics and Osteopathic Approaches As Adjunctive Treatment for Idiopathic Scoliosis: A Case Report
Valério, P., Vasilyeva, M.
Cureus, 2025/10
Free full text
399

Osteopathic Approaches in the Diagnosis and Treatment of Temporomandibular Joint Dysfunction: An Interdisciplinary Review
Makichyan, T., Frolov, V., Habadze, Z., Starodubtseva, E., Dolzhikov, N., Avetisian, G., Rasulova, D.
Georgian Medical News, 2025/10
Free full text
400

Virtual Escape Rooms in Anatomy Education: Case Studies from Two Institutions
Beger, A. W., Hannan, S., Patel, R., Sweeney, E. M.
Advances in Physiology Education, 2025/09
Free full text
401

Osteopathische Behandlung bei akuter Tendovaginitis de Quervain
(Osteopathic treatment for acute De Quervain's tendovaginitis)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09
402

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
403

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text
404

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2025/09
Free full text
405

Osteopathic manipulative treatment in a patient with idiopathic scoliosis assessed by breathing pattern characterization using optoelectronic plethysmography and quality of life — a case report
Gaillard, L., Stubbe, L., Riquet, D., Houel, N.
Journal of Bodywork and Movement Therapies, 2025/09
Free full text
406

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text
407

Differences in practice among osteopaths in the UK with more than or less than 10 years of experience: a cross-sectional study
Bailey, D., Fawkes, C., Draper-Rodi, J.
BMJ Open, 2025/09
Free full text
408

Exploring Manual Interventions for Infantile Colic: A Scoping Review of the Evidence
Tedeschi, R., Giorgi, F.
Children, 2025/09
Free full text
409

A review of osteopathic and related manipulative treatments for improving symptoms of gastrointestinal distress in neurological disorders
Peters, J., Runnels, G., Lauinger, A., Murphy, T., Griffith, A., Slicho, T.
International Journal of Osteopathic Medicine, 2025/09
410

Effect of the Spencer Technique on Glenohumeral Joint Range of Motion: A Comparative Analysis of Athletes Versus Non-athletes
Oar, D. P., Zarilla, A., DiSilvestro, D., Buchman, Z. J., Abouafech, A., Boesler, D.
Cureus, 2025/09
Free full text
411

Manual Therapy in Post-operative Knee Management: A Systematic Review of Effects on Pain in Total Knee Replacement (TKR) Patients
Sahni, S., Fares, J. E., Jordan, H.
Cureus, 2025/09
Free full text
412

Attitudes, Beliefs, and Values of Italian Osteopaths Toward the Management of Patients With Tension-Type Headache: A Categorical Content Analysis
Iacopini, A., Esteves, J. E., Consorti, G., Lunghi, C., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2025/09
413

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text
414

Retrospective Study of Osteopathic Manipulative Treatment on Length of Stay and Opioid Use After Vestibular Schwannoma Resection
Chen, A. I., Golshan, S., Schwartz, M. S., Friedman, R. A.
Otology & Neurotology Open, 2025/09
415

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/09
Free full text
416

Osteopathic intervention for inflammatory conditions of the lactating breast: a case series
Engel, R., Willy, K., Fuller, E.
International Journal of Osteopathic Medicine, 2025/09
417

Potential impact of an osteopathic intervention for internationally adopted children with fetal alcohol spectrum disorder (FASD); a prospective case series
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., Aldecoa-Bilbao, V., García-Algar, Ó.
International Journal of Osteopathic Medicine, 2025/09
Free full text
418

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09
419

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text
420

Academic Background Affects Students’ Confidence and Anxiety Levels about Undergraduate Osteopathic Medical Education
Jambunathan, V.
Spartan Medical Research Journal, 2025/09
421

The Rule of the Artery: Management of Peripheral Vascular Disease with Osteopathic Manipulative Treatment in a Low Resource Setting in Iquitos, Peru
Kamm, M.
Spartan Medical Research Journal, 2025/09
422

A Pediatrician’s Newest Tool: Osteopathic Manipulative Treatment in the Inpatient Setting
Khanafer, R., Holub-Ward, R., Wong, M., Hart, C., Pitman-Hunt, C.
Spartan Medical Research Journal, 2025/09
423

Assessing Osteopathic Medical Students’ Perceptions on Training to Identify Social Determinants of Health: A Pilot Study in a Detroit Street Medicine Program
Nallabelli, N.
Spartan Medical Research Journal, 2025/09
424

The Use of OMT in the Emergency Department: A Scoping Review
Nemes, P.
Spartan Medical Research Journal, 2025/09
425

The Emerging Role of Osteopathic Manipulative Medicine in Enhancing Quality of Life for Palliative and End-of-Life Patients: A Narrative Review
Ngo, A. L., Nguyen, L., Shahbandeh, C., Nichols, J.
Cureus, 2025/09
Free full text
426

Étude de faisabilité LEUCOSTEO : intervention par ostéopathie dans l’accompagnement d’enfants ayant une leucémie aiguë lymphoblastique
(LEUCOSTEO interventional pre-study: Evaluation of osteopathic support needs in the context of acute lymphoblastic leukemia)
De Mauljean, M., Chaillou, D., Mattatia, J., Baldo, C., Gouaux, L., Dalle, J.H., Stubbe, L., Brethon, B.
Douleurs, 2025/09
427

Évaluation de l’impact d’une intervention ostéopathique spécifique sur le trouble anxieux généralisé. Essai clinique
(Evaluation of the Impact of a Specific Osteopathic Intervention on Generalized Anxiety Disorder. Clinical Trial)
Vélu, P., Ohayon, C., Rodriguez, M., Valette, P., Villalon, L., Sanchez, E., Pégurier, P., Delaporte, E., Matheau, E.
La Revue de l'Ostéopathie, 2025/09
428

Osteopaths' attitudes, skills and use of evidence-based practice in Portugal
Nunes, A., Santo, J. E., Moita, J.
International Journal of Osteopathic Medicine, 2025/09
429

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09
430

Quand l’ostéopathe attire plus que l’hôpital : réflexions sur la centralisation informelle des soins musculosquelettiques autour d’un praticien rare au Cameroun
(When the osteopath attracts more than the hospital: Reflections on the informal centralization of musculoskeletal care around a rare practitioner in Cameroon)
Npochinto Moumeni, I.
Kinesitherapie, 2025/09
431

Osteopathic Manipulative Treatment in Cervical Dystonia Patients Treated with IncobotulinumtoxinA
Décarie, P., Chouinard, S., Venne, G.
International Journal of Osteopathic Medicine, 2025/09
432

Exploring scholarship in osteopathic education: A qualitative study of faculty perspectives at a United Kingdon institution
Draper-Rodi, J., Sood, P., Fawkes, C.
International Journal of Osteopathic Medicine, 2025/09
433

Repositioning Menstrual Pain Management: Multidisciplinary Collaboration and Cultural Sensitivity as Key Priorities
Nufi, E. P.
International Journal of Osteopathic Medicine, 2025/09
434

Development of a research mentorship program for Australian osteopaths
Eaves, S., Steel, A.
International Journal of Osteopathic Medicine, 2025/09
435

Understanding the Ranking and Matching Behaviors During the 2023 and 2024 General Surgery Match Cycles: A Program Signaling Approach
Pakdaman, S., LaFemina, J., Byrd, K. S., Dunleavy, D. M., Balestrieri, S. G., Jurich, D. P., Dowden, A. J., Lamb, D. L.
Journal of Surgical Education, 2025/09
436

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text
437

COVID-19 mRNA vaccine immune response to the addition of osteopathic manipulative treatment with lymphatic pumps: a randomized controlled trial
Martinez, E. S., Fuchs, S., Szurmant, H., Chen, X., Comer, A., Lee, E., Hruby, R., Giusti, R., Loveless, B., Sees, J. P., Crone, P., Peek, L. J., Pestano, G., Xie, B., Zammuto, J., Hostoffer Jr., R., Sanchez Jr., J.
Virus Research, 2025/09
Free full text
438

General Osteopathic Treatment: Status quo – Teil 1
(General Osteopathic Treatment: Status Quo – Part 1)
Engel, M.
Osteopathische Medizin, 2025/09
439

Efectividad clínica de la osteopatía. Juicio crítico de la evidencia
(Clinical Effectiveness of Osteopathy: A Critical Review of the Evidence)
Ceballos-Laita, L.
Unpublished PhD thesis, 2025/09
Free full text
440

Post-/Long-COVID-Syndrom und Post-Vac-Syndrom: Können uns in der Therapie alte Überlegungen helfen?
(Post-/Long-COVID syndrome and post-vaccination syndrome: Can old ideas help us in treatment?)
Heinz, J.
Osteopathische Medizin, 2025/09
441

Exploring the Relationship between Grit, Burnout, and Academic Success among First-Year Osteopathic Medical Students during Fundamentals of Anatomic Science I Course
Guzik, H.
Unpublished Dissertation, 2025/09
Free full text
442

Interdisziplinäre Perspektiven auf die Ankyloglossie: Diagnostik, Therapie und Evidenz
(Interdisciplinary perspectives on ankyloglossia: diagnosis, treatment, and evidence)
Moghtader, D., Vogt, R.
Osteopathische Medizin, 2025/09
443

Praktische Umsetzung der Studienergebnisse zur Osteopathie bei Dysmenorrhö
(Practical implementation of study results on osteopathy for dysmenorrhea)
Plathner, M.
Osteopathische Medizin, 2025/09
444

Post-COVID-19 Respiratory Dysfunction and Musculoskeletal Pain: Improvement with Osteopathic Manipulative Treatment (OMT)
Dehghani Ashkezari, A., Graber, Z., Yao, S. C.
The AAO Journal, 2025/09
445

The Use of Osteopathic Manipulative Treatment for a Case of Constipation in Childhood
Heineman, K.
The AAO Journal, 2025/09
446

Tipping the scale: Enhancing Neurological Recovery in TBI through Osteopathic Principles
Khanna, N., Ettlinger, H., Shugar, J. D.
The AAO Journal, 2025/09
447

Impact of Osteopathic Manipulative Treatment on Improving Function and Restoring Quality of Life After Sternoclavicular Joint Resection
Krueger, A., Schaefer, M.
The AAO Journal, 2025/09
448

Osteopathic Manipulative Treatment (OMT) as an Adjunctive Treatment in Major Depressive Disorder (MDD)
Moreno, P., Mather, M., Kinney, L., Pichot, R., Torres, R.
The AAO Journal, 2025/09
449

Osteopathic Manipulative Treatment (OMT) Protocol on Sleep Quality in Medical Students as Measured by the Fitbit Smart Watch: A Pilot Study
Radigan, R., Finkelstein, A., Lee, B., George, E., Bhushan, P., Sousa, A., Yao, S. C.
The AAO Journal, 2025/09
450

Emotional Release of a Male with Somatic Symptom Disorder (SSD) via Osteopathic Manipulative Treatment (OMT)
Tedjo, W., Shugar, J. D.
The AAO Journal, 2025/09
451

OMT as an Adjunct Therapy to Clubbed Feet: A Case Study
Tucker, A., Dorsa, I., Patel, J., Seemann, J., Hicks, K., Leggoe, S.
The AAO Journal, 2025/09
452

Osteopathic correction as part of complex treatment of delayed speech and mental development in preschool children
(Остеопатическая коррекция в составе комплексного лечения задержки речевого и психического развития у детей дошкольного возраста)
Abubakarova, E. N., Stenkova, O. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
453

DO (under) representation in US guideline development: an investigation of guideline authors from 2021-2023
Amendolara, A. B., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, A. M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2025/09
Free full text
454

Comparison of clinical effectiveness of osteopathic correction and massage in the treatment of cervicalgia in surgical specialists experiencing prolonged professional overloads
(Сравнение клинической эффективности остеопатической коррекции и массажа в терапии цервикалгии у специалистов хирургического профиля, испытывающих продолжительные профессиональные перегрузки)
Belash, V. O., Plotnikova, E. N.
Russian Osteopathic Journal, 2025/09
455

Analysis of structural and functional disorders in the body as a method for predicting panic attack
(Анализ структурно-функциональных нарушений в организме как метод прогнозирования панических атак)
Belyaev, A. F., Mikhailichenko, N. M.
Russian Osteopathic Journal, 2025/09
456

Physiological substantiation of the effect of mechanical impact on internal organs (literature review
(Физиологическое обоснование влияния механических воздействий на внутренние органы (обзор литературы)
Ikhlef, A., Potekhina, Y. P., Simenko, E. V.
Russian Osteopathic Journal, 2025/09
457

Combined rehabilitation of patients after acute cerebrovascular accident in the early recovery period: the role of osteopathic correction
(Комбинированная реабилитация пациентов после острого нарушения мозгового кровообращения в раннем восстановительном периоде: роль остеопатической коррекции)
Makichyan, T. G., Rylsky, A. V., Melkosyants, D. I.
Russian Osteopathic Journal, 2025/09
458

Is osteopathic treatment appropriate for a patient with multimorbidity?
(Уместно ли остеопатическое лечение пациенту с мультиморбидностью?)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/09
459

Effect of osteopathic correction on the outcome of pregnancy and childbirth in women with chronic pyelonephritis
(Влияние остеопатической коррекции на исход беременности и родов у женщин с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/09
460

Gastrointestinal motility disorder in celiac disease: influence of osteopathic correction
(Нарушение моторики органов желудочно-кишечного тракта при целиакии: влияние остеопатической коррекции)
Oreshko, A. Y., Mokhov, D. E., Tregubova, E. S., Oreshko, L. S.
Russian Osteopathic Journal, 2025/09
461

Prerequisites for the formation of a personal brand for an osteopathic physician
(Предпосылки к формированию личного бренда врача-остеопата)
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/09
462

Centering the Medical Student Perspective in a Mixed-Methods Evaluation of the Holistic Admissions Process at a Mission-Driven Institution
Liszka, B. L.
Unpublished PhD thesis, 2025/08
Free full text
463

Characteristics of Australian and New Zealand osteopaths who treat patients presenting with non-musculoskeletal complaints: outcomes from two practice-based research networks
Vaughan, B., Cerritelli, F., Draper-Rodi, J., Feehan, J., Ferreira, A. P. A., Fleischmann, M., McLeod, G., McIntyre, C., Morin, C., Muddle, L., Thomson, O. P., Treffel, L., Tripodi, N., Sampath, K. K., Sposato, N. S., Steel, A., Adams, J.
Chiropractic & Manual Therapies, 2025/08
Free full text
464

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text
465

Corrigendum to: Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
466

The effect of osteopathic manipulative treatment on length of stay and pain relief in pediatric appendectomy: a pilot non-randomized time-controlled clinical trial
Lo Piccolo, R., Cantagalli, M. M., Ferroni, T., Fracchiolla, F., Morabito, A.
Frontiers in Pediatrics, 2025/08
Free full text
467

Clinical Reasoning and Practices in the Osteopathic Management of Visceral Disorders: A Grounded Theory Study in the Italian Context
Camonico, T., Lippi, F., Rizzo, N., Barusso, A., Rossettini, G., Villafañe, J. H., Cerritelli, F., Papa, L., Esteves, J. E.
Healthcare, 2025/08
Free full text
468

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text
469

Feasibility of Osteopathic Manipulative Treatment for Low Back Pain in Rural Chimaltenango, Guatemala: A Pilot Study
Aspra Rubi, M., Ngo, A. L. T., Cooper, G., Nichols, J.
Cureus, 2025/08
Free full text
470

Integrating a Microbiology Laboratory Improves the Attitudes and Performance of First-Year Osteopathic Medical Students
Hrach, V. L.
Cureus, 2025/08
Free full text
471

Osteopathic diagnosis and treatment of the spine in patients with chronic back pain through the lens of medical infrared thermography: A randomized controlled pilot study
Bohlen, L., Biester, A., Rapp, O., Wentzel, J., Liem, T., Cerritelli, F., Schmidt, T.
Complementary Therapies in Clinical Practice, 2025/08
472

Concussion Best Practice Guidelines for Return to Activity and the Role of Occupational Therapy: Effects of an Education Module for Medical Students
Finn, C.
Brain Injury, 2025/08
473

Results of manual therapy in degenerative spine diseases with and without radiculopathy (Literature review)
(Rezul'taty primeneniya manual'noi terapii pri degenerativnykh zabolevaniyakh pozvonochnika s radikulopatiei i bez nee (Obzor literatury))
Gameeva, E. V., Miryutova, N. F., Badalov, N. G., Novikov, Y. O., Stepanova, A. M., Tonkoshkurova, A. V.
Problems of Balneology, Physiotherapy and Exercise Therapy, 2025/08
474

Die Auswirkungen der osteopathischen Behandlung bei Patientinnen und Patienten mit der gastroösophagealen Refluxkrankheit
(The Impact of Osteopathic Treatment on Patients with Gastroesophageal Reflux Disease)
Hauck, R.
Unpublished MSc thesis, 2025/08
475

Therapeutische Kompetenz, Erfolge und Grenzen osteopathischer Intervention bei Patient:innen mit Demenz
(Therapeutic Competence, Outcomes, and Limitations of Osteopathic Interventions in Patients with Dementia)
Iwobi, A.
Unpublished MSc thesis, 2025/08
476

Carpal tunnel dimensions following osteopathic manipulation utilizing dorsal carpal arch muscle energy: a pilot study
Zhan, L., Brown, J., Gustowski, S., Davis, P., Loomis, M.
Journal of Osteopathic Medicine, 2025/08
Free full text
477

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/08
Free full text
478

Effect of osteopathic manipulation on neck kinematics using X-Sens motion capture in non-specific neck pain: a protocol for randomised controlled trial
Hullumani, S., Qureshi, I., Raghumahanti, R.
BMJ Open Sport and Exercise Medicine, 2025/08
Free full text
479

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/07
480

Investigating the trustworthiness of randomized controlled trials in osteopathic research: a systematic review with meta-analysis
Sénéquier, A., Draper-Rodi, J., Alvarez Bustins, G., Braithwaite, F. A., Brown, J., Corcoran, D., Forrest, L., Godsi, E., MacMillan, A., Menard, M., Roura Carvajal, S., Scocca, C., Treffel, L., Vaucher, P., Wagner, A., Soliman, N., Abbey, H., Hohenschurz-Schmidt, D.
Journal of Clinical Epidemiology, 2025/07
Free full text
481

Évaluation de l’influence d’une prise en charge ostéopathique sur la puissance de pédalage du cycliste. Essai comparatif
(Evaluation of the influence of osteopathic treatment on cyclists' pedaling power. Comparative trial)
Rapp, L., Derieux, M., Ratio, E.
La Revue de l'Ostéopathie, 2025/07
482

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome during pregnancy from an osteopathic perspective)
Schneider-Milo, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
483

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
484

Find it, find it, find it …
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07
485

A multimodal intervention of manual therapy, exercise, and psychological management for painful diabetic neuropathy: intervention development and feasibility trial protocol
Hohenschurz-Schmidt, D., Smith, S., Schmid, A. B., Bright, P., Draper-Rodi, J., Evans, M. C., Kemp, H., Esteves, N. K., Pigott, E., Scott, W., Vollert, J., Williamson, E., Pogatzki-Zahn, E. M., Vogel, S.
Pain Management, 2025/07
Free full text
486

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text
487

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text
488

Changes in Electromagnetic Activity Following Osteopathic Manipulative Treatment: A Novel Assessment Using Induction Sensors
Savla, P., Brazdzionis, J., Marino, M., Siddiqi, I., Sweiss, R., King, C., Miulli, D. E.
Cureus, 2025/07
Free full text
489

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text
490

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07
Free full text
491

Effects of a single osteopathic manipulative treatment on intraocular pressure reduction: a pilot study
King, H. H., Weinreb, R. N., Walker, E., Zangwill, L. M.
Journal of Osteopathic Medicine, 2025/07
Free full text
492

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text
493

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text
494

Effect of osteopathic manipulative treatment on comorbid depressive symptoms in patients with chronic low back pain: study protocol for a randomised controlled trial
Bohlen, L., Eggart, M., Müller-Oerlinghausen, B., Lorenz, J., Schleip, R., Liem, T., Cerritelli, F., Esteves, J. E., Shedden-Mora, M., Schmidt, T.
BMJ Open, 2025/07
Free full text
495

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text
496

Development of a national osteopathic Practice-Based Research Network (PBRN): the NCOR Research Network
Draper-Rodi, J., Fawkes, C., Bailey, D.
Scientific Reports, 2025/07
Free full text
497

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text
498

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text
499

A Holistic Approach to Treatment of Rosacea During Pregnancy: A Systematic Review
Garelick, E., Hurley, M., Bell, L. N., Cubelli, S.
SKIN: Journal of Cutaneous Medicine, 2025/07
Free full text
500

Pilot study on the influence of osteopathic manual therapy on cortisol and testosterone concentrations in horses
Vokietytė-Vilėniškė, G., Babarskaitė, G., Poškienė, I., Anskienė, L., Žilaitis, V.
Acta Veterinaria Brno, 2025/07
501

Potential effects of combining osteopathic manual therapy and menstrual awareness on pain and associated symptoms in women with primary dysmenorrhea: A randomized clinical trial
Conesa-Albaladejo, M., Espí-López, G. V., Martínez-Graullera, E., Arnal-Gómez, A.
International Journal of Osteopathic Medicine, 2025/06
Free full text
502

Effects of osteopathic treatments in a patient who underwent two cardiac surgeries - A case report
Aubin, A., Bekhazi, J., Fortin, A., Paradis, A., Morin, C.
International Journal of Osteopathic Medicine, 2025/06
503

The combined effect of biofeedback training and osteopathic procedures for the treatment of functional daytime urinary incontinence: A prospective, randomized clinical trial
Elgohary, H. M. I., Elfahl, A. M., Elkholy, M. N.
Journal of Bodywork and Movement Therapies, 2025/06
504

An overview of systematic reviews on the efficacy and safety of osteopathic techniques
Zipp, C. R., Semlitsch, T., Tögel, G., Krenn, C., Loder, C., Jeitler, K., Siebenhofer, A.
Journal of Bodywork and Movement Therapies, 2025/06
Free full text
505

Osteopathische Behandlung bei Säuglingskolik/exzessivem Schreien: Eine prospektive, multizentrische, randomisierte, kontrollierte Studie
(Osteopathic treatment for infant colic/excessive crying: A prospective, multicenter, randomized, controlled trial)
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P., Langenmair, S., Rütz, M., Resch, K.L.
Osteopathische Medizin, 2025/06
506

Osteopathische Behandlung eines Reizdarmsyndroms
(Osteopathic treatment of irritable bowel syndrome)
Scheuchl, F., Spohr, G.
Osteopathische Medizin, 2025/06
507

Technik zur Behandlung des Sonnengeflechts (Ganglia coeliaca)
(Technique for treating the solar plexus (celiac ganglia))
Liem, T.
Osteopathische Medizin, 2025/06
508

Die doppelte Facette der Identität der Osteopathie
(The dual facet of osteopathy's identity)
L'Hermite, P.L.
Osteopathische Medizin, 2025/06
509

INIOST-Studienreport 2024: Eine bibliometrische Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2024
(INIOST Study Report 2024: A bibliometric overview of osteopathic studies published worldwide in 2024)
Franke, H.
Osteopathische Medizin, 2025/06
510

Development of Standardized Osteopathic Manipulative Treatment Tracking Forms Recording Pain and Functional Outcomes to Facilitate Osteopathic Research
Joseph, C., Mintle, L. S., Hoegerl, C., Asher, D., Adams, K., Fugler, P., McKinney, J.
International Journal of Osteopathic Medicine, 2025/06
511

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text
512

Shaft femoral fracture secondary to osteopathic manipulation: case report and medico-legal implication
Prevot, L. B., Bolcato, V., Fozzato, S., Tronconi, L. P., Basile, G.
International Journal of Osteopathic Medicine, 2025/06
513

Acute changes in functional connectivity associated with first osteopathic manual treatment in chronic low back pain spatially overlap with opioid receptor expression
Tomaiuolo, F., Cerritelli, F., Sestieri, C., Keys, J., Paolucci, T., Sensi, S. L., Ferretti, A., Delli Pizzi, S.
Brain Research Bulletin, 2025/06
Free full text
514

Article Review: Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Daugereaux, S.
The AAO Journal, 2025/06
515

An Osteopathic Strategy for the Recognition and Management of Cervicogenic Vertigo: A Case Study
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2025/06
516

Correlation of Ankyloglossia and Breastfeeding Difficulties in Infants Referred for Osteopathic Manipulation at a Family Medicine Residency Clinic: A Retrospective Chart Review
Bendrick, T., White, M., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
517

Osteopathic Treatment Decreases Pain and Opioid Use in Children with Acute Sickle Cell Disease Pain
Brown, A., Goubeaux, D., Belsky, J.
The AAO Journal, 2025/06
518

Use of Osteopathic Manipulative Medicine in Treatment of Neurologic Sequelae of Sjögren’s Syndrome
Campbell, K., Ettlinger, H. M.
The AAO Journal, 2025/06
519

Functional Improvement without the Surgery Referral, A Case Presentation
Candelori, W. J., Gailius, G. C.
The AAO Journal, 2025/06
520

When the Framework Fails: The Cost of Overlooking the Basics in Chest Pain
Collingsworth, M., Schaefer, M., Emmons, A.
The AAO Journal, 2025/06
521

The Use of Osteopathic Manipulative Medicine During the Inpatient Evaluation for Acute Coronary Syndrome
Coppinger, C., Rit, N., Coppinger, J.
The AAO Journal, 2025/06
522

Optimization of Abdominal Surgery and Controlling Intractable Neuropathic Pain with Peri-operative OMT
Cruz, C., Ural, E., Gailius, G. C., Neuer, K.
The AAO Journal, 2025/06
523

Resolving Deep Gluteal Syndrome with OMT
Dirusso, E., Shugar, J.
The AAO Journal, 2025/06
524

Rhabdo Resuscitation and Recovery Using Osteopathic Manipulative Treatment
Fadenrecht, H., Thorsvik, N.
The AAO Journal, 2025/06
525

Novel COL4A1-related phenotype: generalized hypermobility in a patient with heterozygous missense mutation at NM_001845.6(COL4A1): c.4006G>A (p. Val1336Ile)
Mingo, E. N., Unger, M. J. Jr.
The AAO Journal, 2025/06
526

OMT for TBI: A Case Report Showing Improvements in Vision, Mastication, and Post-Traumatic Headaches
Schneider, G., Garrison, S.
The AAO Journal, 2025/06
527

Patterns of OMT Use Across Diverse Practice Settings: Insights from a Multicenter Healthcare System
Toor, J., Stacey, S.
The AAO Journal, 2025/06
528

Osteopathic manipulative treatment and breastfeeding, correlation between age at presentation, mode of delivery, and LATCH scores: a retrospective chart review
White, M., Bendrick, T., Drissi, W., Van Huigenbos, P., Hills, K., Furlano, A.
The AAO Journal, 2025/06
529

OMT for acute on chronic pain in systemic scleroderma
White, M., Furlano, A.
The AAO Journal, 2025/06
530

Tic Douloureaux: Applied Osteopathy for a Case of Refractory Trigeminal Neuralgia
Wright, J., Thorsvik, N.
The AAO Journal, 2025/06
531

The Impact of Simulated Osteopathic Manipulative Medicine Hospital Rounds on Student Confidence and the Likelihood of OMT Use During Clinical Clerkships
Abdulnour, T., Pryor, J., Chun, L.
The AAO Journal, 2025/06
532

Utilizing Osteopathic Manipulative Medicine to Support Lifestyle Behavior Change: A Case Report
Arnold, C., Bercaw, K., Branda, A.
The AAO Journal, 2025/06
533

Look What The Stork Brought; Osteopathic Manipulative Treatment for Postpartum Foot Drop: A Case Study
Bethea, J., Waters, H.
The AAO Journal, 2025/06
534

The use of OMT in Myalgic Encephalomyelitis/Chronic Fatigue Syndrome
Brancale, D., Cooley, D.
The AAO Journal, 2025/06
535

Visceral Manipulation as a Non-Surgical Approach to Resolving Small Bowel Obstruction: A Case Report of a 77-Year-Old Male
Chung, E. S., Kania, A.
The AAO Journal, 2025/06
536

Hand & Helmet: A Crown-to-Coccyx Approach for Positional Plagiocephaly
Enniss, A., Neuer, K., Whitaker, Z., Ural, E.
The AAO Journal, 2025/06
537

From Fatigue to Function: A Case Report of The Use of OMT in Chronic Fatigue Syndrome
Finkelstein, A., Petrillo, G., Keys, J.
The AAO Journal, 2025/06
538

“I Feel Stuck:“ A Case Presentation on the Application of OMM to a Patient with Chronic Atypical Chest Pain After Pulmonary Coccidioidomycosis
Mayberry, M., Ural, E.
The AAO Journal, 2025/06
539

Osteopathic Manipulative Treatment (OMT) in the Management of a Young Male with Lewy Body Dementia (LBD): A Case Study
Finkelstein, A., Radigan, R., Yao, S. C.
The AAO Journal, 2025/06
540

Management of Chemotherapy Induced Strains in a Breast Cancer Survivor with OMT
Johnson, R., White, E., Yu, X., Aldridge, A. F., Bardowell, A.
The AAO Journal, 2025/06
541

Turning the Tie: The Impact of OMT on infant torticollis and tongue tie
Lee, D. W., Katyal, J., Faillace, R.
The AAO Journal, 2025/06
542

Osteopathic Manipulative Treatment in a Case of a Runner with Long-COVID and Autonomic Dysregulation
Lupori, E., Bowen, S., Le, B.
The AAO Journal, 2025/06
543

Clavicular Dysfunctions: An Osteopathic Approach to Neck, Shoulder, and Chest Pain
Machado Douaihi, S. J., Waters, H.
The AAO Journal, 2025/06
544

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06
545

A Viscerosomatic Discovery: Unveiling a Case of Gastroparesis Disguised as Shoulder Pain
McKenna, T., Pfeifer, K., Wallace-Ross, J.
The AAO Journal, 2025/06
546

Exploring the Impact of Teaching Assistants on Student Learning in Osteopathic Manipulative Medicine (OMM) Laboratory Session: A Survey Study
Mehra, M., Ashkezari, A. D., Caron, E., Noto, P., Yao, S. C.
The AAO Journal, 2025/06
547

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06
548

Assessing the Impact of Osteopathic Principles and Practice Teaching Assistants (OPP-TAs) at California Health Sciences University College of Osteopathic Medicine (CHSU-COM)
Miller, G., Pryor, J., Chun, L.
The AAO Journal, 2025/06
549

Osteopaths’ perspective and experiences of elite track and field athletes osteopathic treatments: A descriptive phenomenological study
Consorti, G., Fard, R., Odorisio, L., Cella, M.
Journal of Bodywork and Movement Therapies, 2025/06
550

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06
551

Evaluation of Osteopathic Manipulative Treatment Strategies in Adults with Chronic Neck Pain
Moljo, M., Sreenivasa, S., Neupane, R., Harris, Z., Potter, A.
The AAO Journal, 2025/06
552

Die Wirksamkeit einer osteopathischen Behandlung auf das Schmerzempfinden von Frauen mit endometrioseassoziierten Schmerzen
(The effectiveness of osteopathic treatment on the pain perception of women with endometriosis-associated pain)
Boltz, A.
Unpublished MSc thesis, 2025/06
553

Comparing Measurements of the Carpal Tunnel and the Median Nerve Before and After Applying Osteopathic Manipulative Treatment: An Ultrasound-Guided Case Study
Nandedkar, T., Brown, S., Schneider, R., Rosten, C.
The AAO Journal, 2025/06
554

Osteopathic Manipulative Treatment (OMT) Techniques Utilized for Specific Post-COVID Symptoms Based on Physician Survey Results
Nawrocka, N., Baronos, A., Yao, S. C.
The AAO Journal, 2025/06
555

When it’s not about Ankyloglossia: A case of Osteopathic Manipulative Treatment for Newborn Breastfeeding Difficulties in the Absence of Restricted Labial or Lingual Frenula
Nixon, B., Waters, H.
The AAO Journal, 2025/06
556

Finding his Voice: A Case Report of the Utility of OMT in a Child with Global Delay
Petrillo, G., Keys, J.
The AAO Journal, 2025/06
557

Evaluating the Acute Effects of Osteopathic Manipulative Treatment on Sprint Times
Quackenbush, G., Navarro, A., Quackenbush, D., Arnold, C., Sorenson, K., Jo, K., Roush, J., Cosgrave, C.
The AAO Journal, 2025/06
558

The Application of Osteopathic Manipulative Treatment (OMT) in Neurodegenerative Disorders: A Scoping Review
Sharma, H., Bethea, J., Doberstein, N., Shenker, T., Gregory, B., Hoffman, R., Aizenman, D., Guirguis, G., Hoffmann, J., Harris, Z.
The AAO Journal, 2025/06
559

Short-Lever Assessment of Spinal Side-Bending
Sudweeks, K., McClendon, M., Khalil, F., Kania, A.
The AAO Journal, 2025/06
560

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06
561

Impact of Osteopathic Manipulative Treatment in Delivering Comprehensive Care in Populations with Disabilities
Villarosa, M., Bae, P., Yeam, J., Hoang, V., White, G., Blumer, J.
The AAO Journal, 2025/06
562

Ultrasound verification of the effect of osteopathic correction on the structural and functional state of the median nerve in carpal tunnel syndrome (pilot study)
(Ультразвуковая объективизация влияния остеопатической коррекции на состояние срединного нерва при синдроме запястного канала (пилотное исследование))
Belyaev, A. F., Belomestnov, P. V., Volkonskaya, E. A.
Russian Osteopathic Journal, 2025/06
563

Management of Chronic Migraine in a 34-year-Old Obese Female
White, E., Johnson, R., Yu, X., Bardowell, A.
The AAO Journal, 2025/06
564

Significant Improvement of Fibromyalgia Symptoms With Osteopathic Manipulative Treatment: A Case Report
Ansari, A. Z., Mokodanski, N. A., Ahmed, F., Fairooz, A., Hafeez, S.
Cureus, 2025/06
Free full text
565

Therapeutic efficacy of individual head orthoses in infants with positional plagiocephaly
Chhatwani, S., Degener, C., Rako, L., Kirschneck, C., Möhlhenrich, S. C., Danesh, G., Kelker, M.
Journal of Orofacial Orthopedics, 2025/06
Free full text
566

Impact of Academic Support Interventions on Failing First-Semester Medical Students
Chosie, K., Shults, R.
Cureus, 2025/06
Free full text
567

The Impact of Biological Sex, Medical School Background, and Geographic Location on Diversity in U.S. Neurosurgery Residency Programs
Fioletova, M., Perkinson, K. A., Nemani, M., Sees, J. P.
Cureus, 2025/06
Free full text
568

Long-/Post-Covid - Eine Scoping-Review zu Chancen und Nutzen osteopathischer Behandlungen
(Long-/Post-Covid - A scoping review of the opportunities and benefits of osteopathic treatments)
Klemm, J.
Unpublished MSc thesis, 2025/06
569

The effect of osteopathic manipulative treatment on chronic rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kalkat, A., Hammes, C., Kohli, E., Callahan, M., Hostoffer, R.
Journal of Osteopathic Medicine, 2025/06
Free full text
570

Einfluss einer osteopathischen Behandlung auf das subjektive Wohlbefinden, die Mobilität und die Leistungsfähigkeit der Rückenmuskulatur bei Sportlerinnen und Sportlern
(Influence of osteopathic treatment on the subjective well-being, mobility and performance of the back muscles of athletes)
Kott, V.
Unpublished MSc thesis, 2025/06
571

Osteoevidence: A User-Centric Database for Advancing Osteopathic Manipulative Medicine
Pollesel, A., Pollesel, G., Petrulaityte, A.
Medical Reference Services Quarterly, 2025/06
572

Effekte der Osteopathie auf die HRV, die NRS und die Lebensqualität bei Patientinnen mit primärer Dysmenorrhoe: Eine integrative Fallserie
(Effects of Osteopathy on HRV, NRS, and Quality of Life in Patients with Primary Dysmenorrhea: An Integrative Case Series)
Markovics, M.
Unpublished MSc thesis, 2025/06
573

Osteopathic practitioner´s considerations on infertility treatment
Triay Salamanca, S.
Unpublished MSc thesis, 2025/06
Free full text
574

The possibility of using osteopathic correction in the complex therapy of patients with chronic telogen hair loss
(Возможность применения остеопатической коррекции в комплексной терапии пациенток с хроническим телогеновым выпадением волос)
Belash, V. O., Garaz, E. G.
Russian Osteopathic Journal, 2025/06
575

Auswirkung osteopathischer Behandlungen schwangerer Frauen während der Schwangerschaft in Bezug auf die Kaiserschnittrate
(Effects of Osteopathic Treatments on Pregnant Women During Pregnancy in Relation to the Cesarean Section Rate)
Neuhold, H.
Unpublished MSc thesis, 2025/06
576

Ultrasound verification of the effect of osteopathic correction on the structural and functional state of the median nerve in carpal tunnel syndrome (pilot study
(Ультразвуковая объективизация влияния остеопатической коррекции на состояние срединного нерва при синдроме запястного канала (пилотное исследование)
Belyaev, A. F., Belomestnov, P. V., Volkonskaya, E. A.
Russian Osteopathic Journal, 2025/06
577

Оsteopathic treatment of supraorbital neuralgia in a child
(Остеопатическое лечение супраорбитальной невралгии у ребенка)
Musina, G. M., Novikov, Y. O., Musina, S. M.
Russian Osteopathic Journal, 2025/06
578

Effect of osteopathic correction on urodynamic parameters in pregnant women with chronic pyelonephritis
(Влияние остеопатической коррекции на показатели уродинамики у беременных с хроническим пиелонефритом)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
579

Possibilities of including osteopathic methods of correction in the complex treatment of urolithiasis
(Возможность включения остеопатической коррекции в комплексное лечение мочекаменной болезни)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/06
580

Osteopathische Nachbehandlung alter offener Appendektomien und ihre Auswirkung auf chronische Rückenschmerzen – eine pragmatische, quasirandomisierte, kontrollierte Pilotstudie
(Effect of Osteopathic Treatment After Historical Open Appendectomy on Chronic Low Back Pain: A Pragmatic Quasi-Randomized Controlled Pilot Study)
Rottensteiner, M.
Unpublished MSc thesis, 2025/06
Free full text
581

Personal brand of an osteopathic doctor as a promotion strategy in the market of medical services
(Личный бренд врача-остеопата как стратегия продвижения на рынке медицинских услуг)
Tregubova, E. S., Kuchina, O. V.
Russian Osteopathic Journal, 2025/06
582

Effekte einer osteopathischen Behandlung auf die Herzratenvariabilität bei Patientinnen mit Colitis Ulcerosa: Eine integrative Fallserie
(Effects of Osteopathic Treatment on Heart Rate Variability in Patients with Ulcerative Colitis: An Integrative Case Series)
Schabauer, O.
Unpublished MSc thesis, 2025/06
583

Einfluss manueller osteopathischer Behandlung auf den Zeitpunkt des eigenständigen Trinkens der ausreichenden Trinkmenge im Vergleich zu Static Touch Interventionen
(Influence of Manual Osteopathic Treatment on the Time of Full Oral Feeding in Comparison with Static Touch Interventions)
Topf, C.
Unpublished MSc thesis, 2025/06
584

Einfluss einer einmaligen osteopathischen Behandlung auf Stabilität, Symmetrie und Sensomotorik von Kindern mit Angststörung oder ADHS
(Effect of a single osteopathic treatment on stability, symmetry and sensorimotor function in children with symptoms of an anxiety disorder or ADHD)
Wittig-Chronopoulos, M.
Unpublished MSc thesis, 2025/06
585

Die Auswirkung einer kranialen venösen Drainage auf die Konzentrationsleistung bei Personen im Alter von vierzig bis sechzig Jahren: eine randomisierte kontrollierte Studie
(The Effect of Cranial Venous Drainage on Concentration Performance in Individuals Aged Forty to Sixty: A Randomized Controlled Trial)
Wöckinger, M.
Unpublished MSc thesis, 2025/06
586

Effectiveness of osteopathic treatment in women with primary dysmenorrhea: A randomised controlled trial
Plathner, M., Wolf, L.
Journal of Bodywork and Movement Therapies, 2025/06
587

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06
588

Osteopathic Manipulative Treatment of the Ankle-Foot Complex in Individuals with Limited Dorsiflexion: Study Protocol for a Randomized Crossover Clinical Trial
Loures de Paula, A., Castro, R. Q., Souza, H. C., de Castro Moreira, B., Moreira Baião, I. C., Schmitz Correa, C. P., Felício, D. C., Fonseca, D. S.
International Journal of Osteopathic Medicine, 2025/06
589

Optimizing Airway Function Through Craniofacial and Cervical Manipulations and Emergency-Anesthesia Maneuvers: Applications in Airway Function Enhancement, Pneumonia, and Asthma-Narrative Review
Park, J., Benitez, L., Hamanaka, A., Abbas, G. H., Faluade, E., Pouwels, S., Eller, J.
Journal of Clinical Medicine, 2025/06
Free full text
590

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/06
Free full text
591

Efficiency of physical therapy and osteopathic techniques in the treatment of operated and recurrent lumbar disc herniation - a case report
Antohe, B.A., Rață, M., Rață, B., Rață, G.
Journal of Bodywork and Movement Therapies, 2025/06
592

Técnicas de terapia manual no manejo da constipação funcional: uma revisão sistemática com metanálise
(Manual therapy techniques in the management of functional constipation: a systematic review with meta-analysis)
Nascimento, M. S.
Unpublished MSc thesis, 2025/05
593

Providing Palliative Care for Two: Managing Cancer-Related Pain During Pregnancy
Okonta, V., Kirkire, L., Schoen, M., Mesarwi, P., Skavinski, K.
Journal of Pain and Symptom Management, 2025/05
594

Pilot study MOVENDOP protocol - impact on quality of life following postoperative osteopathic abdominal mobilizations in patients operated for endometriosis
Comptour, A., Dechambenoit, C., Kwiatkowski, F., Vidal, A., Duval, M., De Antonio, M., Jacobs, A., Bourdel, N.
PLoS One, 2025/05
Free full text
595

Osteopathic Manipulative Treatment for Chronic Low Back Pain and Musculoskeletal Pain in Remote Underserved Populations: A Systematic Literature Review
Friedman, A., Sheth, R., Wallace-Ross, J.
Cureus, 2025/05
Free full text
596

Osteopathische manuelle Therapie und Ganzkörper-Kryotherapie bei atopischer Dermatitis: Eine randomisierte kontrollierte klinische Studie
(Osteopathic Manipulative Treatment and Whole-Body Cryotherapy for Atopic Dermatitis: A Randomised Controlled Clinical Trial)
Lammeraner, M.
Unpublished MSc thesis, 2025/05
Free full text
597

Assessing Osteopathic Medical Students' Knowledge, Attitude, and Perspective on the Use of Assisted Reproductive Technologies (ART)
Patel, A., Capote, M. M., Manguvo, A., Mafuvadze, B.
Cureus, 2025/05
Free full text
598

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text
599

Breath of Relief: Osteopathic Manipulative Treatment of Chronic Postoperative Pain in a Bilateral Lung Transplant Patient
Duggal, V., Finkelstein, A., Radigan, R., Bhushan, P.
Cureus, 2025/05
Free full text
600

The Impact of a Simulated Intrauterine Device Insertion Clinic on Osteopathic Medical Students’ Knowledge, Attitude, and Self-Efficacy Regarding Intrauterine Devices
Betit, A. L., Kelly, L. P., Garg, R., Patel, P. G.
Cureus, 2025/05
601

Author Correction: Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., Perpetuini, D., Keys, J., Merla, A., Cardone, D.
Scientific Reports, 2025/05
Free full text
602

Towards a more equitable future: development, implementation, and evaluation of a novel e-course on racial disparities in pain management for medical students
Stensland, M., Maples, N., Sanford, E., Martinez, M.
BMC Medical Education, 2025/05
Free full text
603

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text
604

Exploring manual therapy in the management of irritable bowel syndrome in adults: A scoping review
Płóciennik-Korycka, N., Pani, S. M., Bruc, B., Contu, P., Wrzesińska, M.
Complementary Therapies in Medicine, 2025/05
Free full text
605

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text
606

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text
607

Osteopathic, logopedic and psychological assessment to improve outcome in patients undergoing cardiac surgery: A randomized clinical trial (TITANIC trial)
Volpato, E., Stilo, L., Tavanelli, M., Bordoni, B., Oreni, L., Toccafondi, A., Moraschi, A., Morici, N.
European Journal of Preventive Cardiology, 2025/05
608

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05
609

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text
610

Efficacy of Osteopathic Manipulative Treatment in Creating a Difference in Pain Levels for Patients With Localized Joint Pain: A Meta-Analysis of Randomized Controlled Trials
DeFrancisis, J. S., Vinarski, B. M., Abreu, M., Ibrahim, J., Hostoffer, R.
Cureus, 2025/04
Free full text
611

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text
612

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text
613

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text
614

Patient-Practitioner-Environment Synchronization: Four-Step Process for Integrating Interprofessional and Distinctive Competencies in Osteopathic Practice-A Scoping Review with Integrative Hypothesis
Lunghi, C., Baroni, F., D'Alessandro, G., Consorti, G., Tramontano, M., Stubbe, L., Conte, J., Liem, T., Zegarra-Parodi, R.
Healthcare, 2025/04
Free full text
615

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04
616

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text
617

The Effect of Osteopathic Manipulative Treatment Adjunct on Stabilization Splint Treatment in Temporomandibular Joint Anterior Disc Displacement with Reduction Disorder: A Quantitative Analysis, Pilot Study
Aklar, A., Bal, B., Taşdelen, N., İnal, H. S., Ertaş, G.
Journal of Clinical Medicine, 2025/04
Free full text
618

Evaluation of the effectiveness of osteopathic treatment on the mother-newborn dyad in the event of painful breastfeeding in a maternity hospital despite the application of all usual aids: randomized interventional trial in two parallel arms without blinding
Elleau, C., Missmahl, C., Belcadi, W., Aurillac-Lavignolle, V., Sentilhes, L.
Frontiers in Nutrition, 2025/04
Free full text
619

Effect of osteopathic manipulation on pain, disability, range of motion and reposition sense in subjects with postural neck pain: a systematic review protocol
Hullumani, S., Raghumahanti, R., Qureshi, I., Ladkhedkar, P.
BMJ Open, 2025/04
Free full text
620

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text
621

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text
622

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text
623

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text
624

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text
625

Efectividad del tratamiento osteopático en la dismenorrea primaria. Revisión sistemática
(Effectiveness of osteopathic treatment for primary dysmenorrhea. A Systematic review)
Muñoz Rodríguez, A.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
626

The role of osteopathic manipulative treatment for dystonia: a literature review
Phrathep, D. D., Abdo, Z., Tadros, M., Lewandowski, E., Evans, J.
Journal of Osteopathic Medicine, 2025/04
Free full text
627

Fostering Professionalism in Medical Education: the Common Ground Professionalism Initiative at Michigan State University College of Osteopathic Medicine
Jalaba, S., Ruger, K., Kerver, H.
Medical Science Educator, 2025/04
Free full text
628

The Effectiveness of Osteopathic Correction in the Complex Rehabilitation of Patients with Temporomandibular Joint Dysfunction
Makichyan, T., Gusakova, E., Khabadze, Z., Sarkisian, A.
Georgian Medical News, 2025/04
Free full text
629

Eficacia de las técnicas osteopáticas en sujetos con cefalea tensional
(Effectiveness of osteopathic techniques in subjects with tension headaches)
Cortes Vega, E. A.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
630

Clinical effectiveness of the osteopathic management of non-specific neck pain
Fleischmann, M.
Unpublished PhD thesis, 2025/04
Free full text
631

Eficacia de la osteopatía en la enfermedad del asma bronquial
(Effectiveness of osteopathy in bronchial asthma)
Peramo Ruíz, J. M.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
632

Eficacia del tratamiento osteopático visceral para el dolor lumbar
(Effectiveness of visceral osteopathic treatment for low back pain)
Rodríguez Mesa, N.
European Journal Osteopathy & Related Clinical Research, 2025/04
Free full text
633

Tradition-Dismissive vs. Tradition Reconceptualization Approaches in Musculoskeletal Care: The Example of Osteopathic Care
D&rsquo, Alessandro, G., Lunghi, C., Consorti, G., Zanon, S., Berti, F., Turinetto, M., Di Pietrantonio, L., Longobardi, M., Zegarra-Parodi, R., Baroni, F.
Applied Sciences, 2025/03
Free full text
634

A call for improving the internal validity and the reporting of manual therapy trials self-labelled as pragmatic: A methodological review
Roura, S., Alvarez, G., Hohenschurz-Schmidt, D., Solà, I., Núñez-Cortés, R., Bracchiglione, J., Fernández-Jané, C., Phalip, J., Gich, I., Sitjà-Rabert, M., Urrútia, G.
International Journal of Osteopathic Medicine, 2025/03
Free full text
635

Diagnosing and treating upper back pain: insights from New Zealand’s manipulative physiotherapists and osteopaths
Kovanur Sampath, K., Smith, T., Belcher, S., Farrell, G., Fryer, G., Vaughan, B., Moran, R.
Journal of Manual & Manipulative Therapy, 2025/03
636

The development of the National Council for Osteopathic Research - Research Network (NCOR-RN): A qualitative focus group study of osteopaths’ views
Bailey, D., Fawkes, C., Carnes, D., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2025/03
637

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text
638

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text
639

A national survey of osteopaths' conceptions of practice in France: structural validity of the Osteo-TAQfr and the tendency toward technical rationality
Thomson, O. P., Treffel, L., Wagner, A., Jacquot, E., Draper-Rodi, J., Morin, C., Vaughan, B.
BMC Health Services Research, 2025/03
Free full text
640

Effekt von osteopathischen Behandlungen während interdisziplinärem Gewichtsreduktionskonzept von Patienten mit Adipositas Grad 1 -3
(Effect of Osteopathic Treatments During an Interdisciplinary Weight Reduction Program in Patients with Grade 1–3 Obesity)
Brenner, M.
Unpublished MSc thesis, 2025/03
641

Osteopathic Consideration of Pelvic Girdle Pain in the Postpartum Patient: A Case Study
Lu, J., Jiao Jiang, Y., Li Williams, G. E., Volokitin, M.
Osteopathic Family Physician, 2025/03
642

Indigenous Epistemological Frameworks and Evidence-Informed Approaches to Consciousness and Body Representations in Osteopathic Care: A Call for Academic Engagement
Zegarra-Parodi, R., Loum, T., D&rsquo, Alessandro, G., Baroni, F., Zweedijk, R., Schillinger, S., Conte, J., Mehl-Madrona, L., Lunghi, C.
Healthcare, 2025/03
Free full text
643

Track and field coaches' perspective and experiences of including osteopaths in shared management of elite athletes: A descriptive phenomenological study
Fard, R., Cella, M., Odorisio, L., Consorti, G.
Journal of Bodywork and Movement Therapies, 2025/03
644

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text
645

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/03
646

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of Osteopathic Medicine, 2025/03
Free full text
647

Assessing the effects of manual therapy on pain in patients living with Persistent Non-Specific Low Back Pain (PNSLBP): Which evaluation criteria and measurement tools used in randomised controlled clinical trials? A systematic review
Bilhaut, A., Olivier, A.H., Draper-Rodi, J., Cretual, A., Ménard, M.
International Journal of Osteopathic Medicine, 2025/03
648

Exploring Trismus Management in Australia: A Mixed Methods Evaluation of Surveys and Interviews With Health Professionals
Charters, E., Venchiarutti, R., Dunn, M., Clark, J.
Head & Neck, 2025/03
649

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03
650

Autonomic correlates of osteopathic manipulative treatment on facial functional mapping: an innovative approach based on thermal imaging
Cerritelli, F., David, P., Jordan, K., Arcangelo, M., Daniela, C.
Scientific Reports, 2025/03
Free full text
651

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text
652

„Du lebst und stirbst durch mich“: Das Zwerchfell im osteopathischen Kontext
(“You live and die through me“: the diaphragm in an osteopathic context)
Engel, M.
Osteopathische Medizin, 2025/03
653

Exploring the Cost and Access Gap Between Osteopathic and Allopathic Medical Students When Applying for General Surgery Fourth-Year Away Rotations
Moza, M. M., Guarneri, B. D., Morrison, L., Allgood, L.
Cureus, 2025/03
Free full text
654

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text
655

Osteopathische Behandlung therapieresistenter Schmerzen: Chronisch abdominaler Schmerz, eingeschränkte Atmung und Unverträglichkeit von Schmerzmitteln bei Zustand nach Colon-ascendens-Karzinom
(Osteopathic treatment of therapy-resistant pain: Chronic abdominal pain, restricted breathing and intolerance to painkillers in the condition after ascending colon cancer)
Geilgens, A., Repik, I.
Osteopathische Medizin, 2025/03
656

The use of superficial heat in the management of low back pain by chiropractors and osteopaths in Australia
McCann, P. J.
Unpublished MSc thesis, 2025/03
Free full text
657

An Innovative Osteopathic Curriculum for Allopathic and Osteopathic Family Medicine Residents
Price, J. W.
The AAO Journal, 2025/03
658

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text
659

Effect of osteopathic correction on the manifestations of postcholecystectomy syndrome
(Влияние остеопатической коррекции на проявления постхолецистэктомического синдрома)
Bibikov, A. A., Nenashkina, E. N., Oreshko, A. Y.
Russian Osteopathic Journal, 2025/03
660

Possibility of using manual therapy and osteopathic correction for delayed speech and motor development in children
(Возможности применения мануальной терапии и остеопатической коррекции при задержке речевого и моторного развития у детей)
Bobko, A. Y., Bobko, Y. N., Adulas, E. I., Mizonova, I. B., Bulina, O. V., Suslova, G. A.
Russian Osteopathic Journal, 2025/03
661

Dynamics of osteopathic status in patients with chronic tonsillitis during complex treatment with inclusion of osteopathic correction
(Динамика остеопатического статуса у пациентов с хроническим тонзиллитом при комплексном лечении с включением остеопатической коррекции)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushk, S. A.
Russian Osteopathic Journal, 2025/03
662

Non-medicamentous methods in conservative treatment and preoperative preparation of patients with gonarthritis (literature review
(Немедикаментозные методы в консервативном лечении и предоперационной подготовке пациентов с гонартритом (обзор литературы))
Rozhdestvenskiy, D. A., Tregubova, E. S., Rozhdestvenskiy, A. S.
Russian Osteopathic Journal, 2025/03
663

Osteopathic correction as part of complex treatment of patients with uterine form of infertility
(Остеопатическая коррекция в составе комплексного лечения пациенток с маточной формой бесплодия)
Nenashkina, E. N.
Russian Osteopathic Journal, 2025/03
664

Application of osteopathic correction in complex therapy of patients with varicose veins of the lower limbs
(Применение остеопатической коррекции в комплексной терапии пациенток с варикозной болезнью нижних конечностей)
Belash, V. O., Usenko, K. P.
Russian Osteopathic Journal, 2025/03
665

Diaphragm functions and their disorder during artificial ventilation of the lungs (literature review)
Функции диафрагмы и их нарушение при искусственной вентиляции легких (обзор литературы)
Tolmachev, K. M., Potekhina, Y. P.
Russian Osteopathic Journal, 2025/03
666

Appraisal of Sexual Education Curriculum in Secondary Schools With Inclusion of Practical Implications and Evaluation, Based on Rural-Urban Residence
Betit, A. L., Kennedy, C.
Cureus, 2025/03
Free full text
667

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03
668

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03
669

Osteopathic Manual Therapy Versus Conventional Conservative Therapy in the Management of Temporomandibular Disorders
Rahman, S.
Journal of Modern Health and Rehabilitation Sciences, 2025/03
Free full text
670

Gender Health Gap und die Rolle der Osteopathie in der Frauenheilkunde
(Gender Health Gap and the role of osteopathy in gynecology)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
671

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
672

Kommunikation und professionelle Gesprächsführung in der osteopathischen Praxis
(Communication and professional conversation techniques in the osteopathic practice)
Stachowski, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
673

Formen der funktionellen Harninkontinenz bei Kindern
(Forms of functional urinary incontinence in children)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03
674

Investigating trends in orthopedic surgery match for osteopathic and allopathic graduates post-single accreditation transition
Megafu, M., Guerrero, O. D.
Journal of Osteopathic Medicine, 2025/02
Free full text
675

Practitioner characteristics of osteopaths who treat pregnant women and children: An Australasian perspective from two practice-based research networks
Steel, A., Draper-Rodi, J., Fleischmann, M., Morin, C., Ferreira, A. P., Vaughan, B., Orrock, P.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
676

Formation of myofаscial pain syndrome and its correction in patients with tension headache
Vesnin, A. V., Tovazhnianska, O. L.
Journal of V. N. Karazin Kharkiv National University. Series 'Medicine', 2025/02
Free full text
677

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2025/02
Free full text
678

Comparing cranial suture interdigitation in humans and non-human primates: unearthing links to osteopathic cranial concept
Blumer, J., Arney, I., Hardin, A., Nichols, M., Arsenault, L., Petrucci, J.
Journal of Osteopathic Medicine, 2025/02
Free full text
679

Analysis of self-reported confidence in independent prescribing among osteopathic medical graduating seniors
Eldeeb, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
680

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text
681

“There is a way to work together“: A qualitative study on complementary medicine therapists' perceptions of their role in the Swiss healthcare system
Dubois, J., Rodondi, P.Y., Akre, C.
Complementary Therapies in Clinical Practice, 2025/02
Free full text
682

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text
683

Dr. William Garner Sutherland (1873-1954): The Founder of Cranial Osteopathy
Childs, B., Hammes, C.
Cureus, 2025/02
Free full text
684

Neuroimaging Model of Visceral Manipulation in Awake Rat
Cramer, S. R., Han, X., Chan, D. C. Y., Neuberger, T., Zhang, N.
Journal of Neuroscience, 2025/02
685

Effect of osteopathic manipulative treatment on pain in palliative care patients: a randomized placebo-controlled clinical trial
Galeazzi, Y., Houel, N., Gouaux, L., Rohan, A., Le Heiget, H., Jung, C., Housset, B., Stubbe, L.
Pain Reports, 2025/02
Free full text
686

Effects of manual osteopathic interventions on psychometric and psychophysiological indicators of anxiety, depression and stress in adults: a systematic review and meta-analysis of randomised controlled trials
Gordon, T. C., Hope-Bell, J., Draper-Rodi, J., MacMillan, A., Miller, D., Edwards, D. J.
BMJ Open, 2025/02
Free full text
687

Exploring the Impact of Osteopathic Manipulative Treatment on Chronic Migraine Relief: A Case Study
Lahlou, Y., Aamir, M., Shadiack, V.
Cureus, 2025/02
Free full text
688

“The Dark Side of Musculoskeletal Care”: Why Do Ineffective Techniques Seem to Work? A Comprehensive Review of Complementary and Alternative Therapies
Mamud-Meroni, L., Tarcaya, G. E., Carrasco-Uribarren, A., Rossettini, G., Flores-Cortes, M., Ceballos-Laita, L.
Biomedicines, 2025/02
Free full text
689

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text
690

Perspectives of osteopathic medical students on preclinical urology exposure: a single institution cross-sectional survey
Wong, R., Mayrovitz, H. N.
Journal of Osteopathic Medicine, 2025/02
691

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text
692

Diagnosis and Treatment of Thoracic Outlet Syndrome in an Elderly Male Patient: A Case Report and Protocol Evaluation
Dale, J. L., Sood, H.
Cureus, 2025/02
Free full text
693

Efficacy of non-surgical, non-pharmacological treatments for congenital muscular torticollis: a systematic review and meta-analysis
Antares, J. B., Jones, M. A., Chak, N. T. N., Chi, Y., Li, H., Li, M., Chan, E. Y. W., Chen, T. M. K., Lee, C. M. Y., Urquhart, D. M.
BMC Musculoskeletal Disorders, 2025/02
Free full text
694

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text
695

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text
696

Specificity of cranial cutaneous manipulations in modulating autonomic nervous system responses and physiological oscillations: A controlled study
Keller, M., Perlitz, V., Pelz, H., Borik, S., Repik, I., Geilgens, A., Cotuk, B., Müller, G., Mathiak, K., Mayer, J.
PLoS One, 2025/02
Free full text
697

Visceral manipulation intervention in functional dyspepsia with or without gastroesophageal reflux disease: a systematic review.
Achmad, A., Manaf, H.
International Journal of Public Health Science, 2025/02
Free full text
698

Approche neuroprotectrice de l’ostéopathie chez les grands prématurés : tolérance, sécurité et bénéfices potentiels
(Neuroprotective approach of osteopathy in very preterm infants: tolerance, safety, and potential benefits)
O'Connor, S.
Unpublished PhD thesis, 2025/01
Free full text
699

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text
700

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
701

Gedanken zur Behandlung von Cochlea-Implantat-Trägern
(Thoughts on the treatment of cochlear implant users)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
702

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01
703

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text
704

An Unusual Presentation of Respiratory Dysfunction in Parkinson’s Disease: A Case Study
Rundquist, L. D., Lyons, S. E., Moljo, R. J., Blavo, C.
Cureus, 2025/01
Free full text
705

Dr. William Garner Sutherland: The Man Who Changed Osteopathy Forever
Sharath, H. V., Phansopkar, P., Qureshi, M. I., Raghuveer, R., Kaur, G.
Cureus, 2025/01
Free full text
706

Osteopathic treatment of infants with infantile colic/excessive crying: a prospective, multicentric, randomized controlled trial and nested observational trial
Schwerla, F., Zimmer, M., Göpfert, J., Laux, P-, Langenmair, S., Rütz, M., Resch, K. L.
BMC Pediatrics, 2025/01
Free full text
707

Early osteopathic manipulative treatment to prevent cranial positional deformities: A randomized controlled trial
Genelot, C., Macioce, V., Huguet, H., Harrewijn, I., Cambonie, G., Dessauge, D., Mura, T., Moulis, L., Captier, G.
Archives de Pédiatrie, 2025/01
Free full text
708

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text
709

Three-Dimensional Posture Analysis-Based Modifications After Manual Therapy: A Preliminary Study
Scoppa, F., Graffitti, A., Pirino, A., Piermaria, J., Tamburella, F., Tramontano, M.
Journal of Clinical Medicine, 2025/01
Free full text
710

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
711

Osteopathic Manipulative Treatment: A Safe and Feasible Adjunct in Sickle Cell Disease Pain Management
Brown, A., Goubeaux, D., Jacob, S. A., Belsky, J. A.
Pediatric Blood & Cancer, 2025/01
712

The Effect of Osteopathic Visceral Manipulation on Quality of Life and Postural Stability in Women with Endometriosis and Women with Pelvic Organ Prolapse: A Non-Controlled Before-After Clinical Study
Wójcik, M., Kampioni, M., Hudáková, Z., Siatkowski, I., Kędzia, W., Jarząbek-Bielecka, G.
Journal of Clinical Medicine, 2025/01
Free full text
713

Electronic health care record for objective structured clinical examination stations at Philadelphia College of Osteopathic Medicine School of Pharmacy Georgia Campus during 2022-2023 academic year
Alhaddad, G., Saade, R., Najafabadi, I. K.
American Journal of Health-System Pharmacy, 2025/01
714

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text
715

Evaluation of an Osteopathic Manipulative Medicine Curriculum for Pediatric Residents
LeMay, M., Newhall, L.
Academic Pediatrics, 2025/01
716

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01
717

Shifting Perspectives: Assessing Knowledge and Beliefs in Harm Reduction Strategies Among Future Healthcare Professionals - H.E.R.O. Harm Reduction and Opioid Education
Hamilton, M. E., Brian, M., Hill, S., Hurst, T.
American Journal of Health-System Pharmacy, 2025/01
718

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01
719

O efeito do tratamento manipulativo osteopático na função pulmonar em pós-operatório imediato de lobectomia ou segmentectomia, um estudo clínico randomizado
(The Effect of Osteopathic Manipulative Treatment on Pulmonary Function in the Immediate Postoperative Period Following Lobectomy or Segmentectomy: A Randomized Clinical Trial)
Ferreira, L. B.
Unpublished MSc thesis, 2025/01
Free full text
720

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text
721

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text
722

Biografische Notizen zu den Begründern von Osteopathie und Chiropraktik. Andrew Taylor Still und Daniel David Palmer
Endruscheit, U.
Skeptiker, 2025/01
723

The value of the osteopathic approach in supporting women suffering from endometriosis
Metzmacker, P., Bengoetxea, A., Mellier, J.
European Journal of Pain, 2025 Nov 01 2025–11–21
Free full text
724

Resolution of Chronic Coccydynia after Osteopathic Manipulative Treatment: A Case Report.
Valdés, D., Sherrington, M., Waters, L. M.
Osteopathic Family Physician, 2024/9
725

Use of Osteopathic Manipulative Treatment for the Management of Pectus Excavatum: A Single Case Study
Lin, Z. X., Perez, A., Volokitin, M.
Cureus, 2024/5
Free full text
726

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
727

Osteopathic medical students' use of a customized mobile app to supplement ECG lectures for examinations
Zumwalt, J.
Unpublished PhD thesis, 2024/12
728

Osteopathic Treatment of a person with Arnold-Chiari Malformation and Syringomyelia: a case report
Cases-Solé, R., Varillas-Delgado, D., Trinidad-Cascudo, F., Pino-Tamayo, M. C., García-Algar, O.
International Journal of Osteopathic Medicine, 2024/12
729

Is visceral osteopathy therapy effective? A systematic review and meta-analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Esteban-Tarcaya, G., Mamud-Meroni, L., Jiménez-del-Barrio, S.
International Journal of Osteopathic Medicine, 2024/12
730

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text
731

“Disproportionate Olympic Rings” – the usage of a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain by osteopaths in Aotearoa/New Zealand– A qualitative study
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Fairs, E., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/12
732

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text
733

Neuropsychiatric considerations in treating anorexia nervosa patients with osteopathic manipulative medicine: a narrative review
Talebi-Talghian, T., Schulz, P., Huzij, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
734

Characteristics of the practice of New Zealand osteopaths who manage patients with chronic pain
McIntyre, C., Draper-Rodi, J., Antunes Ferreira, A. P., Muddle, L., McLeod, G. A., Sampath, K. K., Sinderholm Sposato, N., Vaughan, B.
Pain Management, 2024/12
735

Physiological Mechanisms Underlying the Primary Respiratory Mechanism (PRM) and Cranial Rhythmic Impulse (CRI) in Osteopathy: A Systematic Review
Mériaux, F., Stubbe, L., Guyon, A.
Healthcare, 2024/12
Free full text
736

Osteopathic health care in aged care facilities: The experience of practitioners in an emerging practice setting
Amorim, M., Bennett, J., McGarry, D., Moore, B., Orrock, P., Whitton, L., Dullard, S.
Australasian Journal on Ageing, 2024/12
Free full text
737

Treatment of migraine with aura with osteopathic manipulative treatment: a case report with renewed perspectives
Babek, N., Fiechter, C., Caretti, R., Phinney, T.
Journal of Osteopathic Medicine, 2024/12
Free full text
738

Autonomic Nervous System and Viscera-Related Responses to Manual Therapy: A Narrative Overview
Alanazi, M. S., Degenhardt, B., Franklin, G., Jacobson, E., Fritz, S., Kettner, N., Kremen, V., Lipke, L., Reed, W. R.
International Journal of Osteopathic Medicine, 2024/12
Free full text
739

Osteopathic Manual Treatment in Women with Endometriosis: A Scoping Review on Clinical Symptoms, Fertility and Quality of Life
De Strooper, M., De Nys, L., Theys, L., Vermeersch, A., Quaghebeur, J.
International Journal of Osteopathic Medicine, 2024/12
Free full text
740

An appraisal of neuroimmune changes and potential benefits of Osteopathic Manipulative Treatment integration with therapeutic management of Post COVID-19 Condition: a literature review
Senigagliesi, F., Scialla, S., Marasco, M. L.
International Journal of Osteopathic Medicine, 2024/12
741

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text
742

Effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in individuals with chronic low back pain: A double-blind, randomised placebo-controlled trial
Armbrust, D., Arêas, G. P. T., Fonseca, C. L., Arêas, F. Z. S., Duarte, N. A. C., Santana, S. A. A., Dumont, A. J. L., Neto, H. P., Oliveira, C. S.
Clinical Rehabilitation, 2024/12
743

The Effects of Osteopathic Manipulative Treatment on Arrhythmias: A Double-blind Randomized Controlled Trial in Patients with Cardiac Implantable Electronic Devices
Nikakis, J., Malkov, D., Tale, E., Mangla, M., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
The Journal of Innovations in Cardiac Rhythm Management, 2024/12
Free full text
744

Osteopathische Behandlung radikulärer Schmerzen
(Osteopathic treatment of radicular pain)
Beckmann, U.
Osteopathische Medizin, 2024/12
745

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12
746

Applying an osteopathic intervention to improve mild to moderate mental health symptoms: a mixed-methods feasibility randomised trial
Hope-Bell, J., Draper-Rodi, J., Edwards, D. J.
Chiropractic & Manual Therapies, 2024/12
Free full text
747

Evaluating the Information Quality of YouTube Videos on Manual Medicine/Therapy
Is, E. E., Tarihci Cakmak, E., Damla Korkmaz, M.
International Journal of Osteopathic Medicine, 2024/12
748

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität – Teil 2: Ergebnisse der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability - Part 2: Results of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/12
749

Underrepresentation of Osteopathic Physicians in the Development of Medical Guidelines
Amendolara, A., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2024/12
750

The Effects of Osteopathic Manipulative Treatment on Climbing Performance
Beyer, B. R., Sheppard, C., Bolig, J., Muvvala, M.
Journal of Osteopathic Medicine, 2024/12
751

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12
752

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12
753

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12
754

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12
755

Assessing the Role of Osteopathic Medical Education on Community Health Literacy Interventions Pilot Study
Good, C., McClain, E.
Journal of Osteopathic Medicine, 2024/12
756

“Limitations of Life:” A Mixed Methods Survey Exploring Osteopathic Medical Students’ Perspectives on Reasons Preventing them from Practicing In Rural Communities
Haque, N., Richardson, C.
Journal of Osteopathic Medicine, 2024/12
757

Perception of Osteopathic Medicine in a Rural Clinic in Peru
Hovetter, K., Henke, C., Lopes, K., Berger, M., Boswell, K., Kandil, F., Ridpath, L., Waddell, M., Schmidt, D.
Journal of Osteopathic Medicine, 2024/12
758

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12
759

Promoting the Understanding Of Prerequisites, Training, Career Opportunities, and Practice Philosophy of Osteopathic Physicians Amongst Students in the Southeastern U.S.
Iyer, H., Saravanan, S., Oquendo, G., Zarandy, J., Roberts, M.
Journal of Osteopathic Medicine, 2024/12
760

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12
761

Improving Sleep with OMT: A Randomized Controlled Trial using Cervical Techniques to Improve Sleep for OMSI
Le, D., Fagen, D., Christensen, S., Jensen, C., Alacron, A., Slife, R., Thakur, C., Teo, R., Spradley, G., Jackson, S, Zamanian, P., Finley, D., Tran, N., Tran, A., Redeman, K., Marble, A., Keane, J., Mangiaracina, M.
Journal of Osteopathic Medicine, 2024/12
762

Exploring the Impact of Musculoskeletal Conducting Injuries in Choral Music Educators: An Osteopathic Survey Analysis
Li, S., Wehner, B., Sullivan, R., McNickle, C.
Journal of Osteopathic Medicine, 2024/12
763

Multifaceted Therapeutic Approaches for the Management of Dyspareunia: A Narrative Review
Rastogi, M., Deka, K., Krishnan, S., Narayan, A., Nayak, M. M., Kumar, K. V.
The Open Public Health Journal, 2024/12
Free full text
764

Assessing the Role of Pronoun Competency Training in the Expansion of Transgender and Gender Diverse Curriculum in Undergraduate Medical Education
Morgan, R., Buckley, S., Scotten, M.
Journal of Osteopathic Medicine, 2024/12
765

Exploring Attitudes Towards Osteopathic Medicine in First and Second Year Osteopathic Medical Students Following Osteopathic Manipulative Medicine
Neiman, N., de Jesus, A., Zeller, A. M.
Journal of Osteopathic Medicine, 2024/12
766

Assessing the Potential Role for Using Artificial Intelligence (AI) in Osteopathic Medical Students Teaching and Learning
Patel, N., Martin, P., Benmerzouga, I.
Journal of Osteopathic Medicine, 2024/12
767

The Effect of Osteopathic Manipulative Treatment in Chronic Rhinosinusitis
Rowane, M., Shankar, A., Nagireddi, S., Kallat, A., Callahan, M., Kohli, E., Hammes, C., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/12
768

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12
769

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12
770

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12
771

Using Osteopathic Manipulative Therapy to Treat Irritable Bowel Syndrome and Severe Refractory Gastroesophageal Reflux Disease: A Case Report
Johnson, T., Jahnke, A. R., Reindel, K.
Cureus, 2024/12
Free full text
772

Osteopathic correction in the complex treatment of patients with panic disorder
(Остеопатическая коррекция в комплексном лечении пациенток с паническим расстройством)
Adamasova, Y. V., Belash, V. O.
Russian Osteopathic Journal, 2024/12
773

The influence of osteopathic correction on the functional state of volleyball athletes
(Влияние остеопатической коррекции на функциональное состояние спортсменов-волейболистов)
Alukaev, M. I., Ahmetzianov, T. Z., Potekhina, Y. P., Nenashkina, E. N., Yanushanets, O. I.
Russian Osteopathic Journal, 2024/12
774

Development of the skill of dosed pressure in doctors in the process of professional retraining in the speciality «Osteopathy»
(Развитие навыка дозированного давления у врачей в процессе профессиональной переподготовки по специальности «Остеопатия»)
Boyarinov, V. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/12
775

Manual medical technologies in complex treatment and rehabilitation of patients with primary osteoarthritis (literature review
(Мануальные медицинские технологии в комплексном лечении и реабилитации пациентов с первичным остеоартритом (обзор литературы)
Mokhov, A. D., Belyaeva, I. B., Mokhov, D. E., Gavrilova, T. A.
Russian Osteopathic Journal, 2024/12
776

The possibility of using osteopathic correction in the complex treatment of patient with tinnitus
(Возможность применения остеопатической коррекции в комплексном лечении пациента с тиннитусом)
Revina, M. B.
Russian Osteopathic Journal, 2024/12
777

Osteopathic correction as part of complex treatment of patients with irritable bowel syndrome
(Остеопатическая коррекция в составе комплексного лечения пациентов с синдромом раздраженного кишечника)
Yarysheva, Y. V., Dmitriev, A. A., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/12
778

The Effect of Osteopathic Manipulative Treatment on Acute Post COVID-19 Anosmia and Ageusia Symptoms: A Case Report
Mehra, M., Companion, N., Yao, S. C., Ventimiglia, M.
The AAO Journal, 2024/12
779

Uso do tratamento manipulativo osteopático em lactentes submetidos a ventilação mecânica e falha de extubação
(Use of osteopathic manipulative treatment in infants undergoing mechanical ventilation and extubation failure)
da Cunha, A. A.
Unpublished MSc thesis, 2024/12
Free full text
780

Characteristics, opportunities, and challenges of osteopathy (COCO) in the perceptions of osteopaths in Germany, Austria, and Switzerland: a metasynthesis
Manschel, J., Porthun, J., Beuckels, J. M., Martin, D.
European Journal of Medical Research, 2024/12
Free full text
781

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text
782

A Quantitative Program Evaluation of Restorative Justice Practices at United States Medical Schools
Harrison Schulman, J.
Unpublished MSc thesis, 2024/12
783

Impact d’un traitement ostéopathique dans la prise en charge des patients atteints de dysfonctions temporo-mandibulaires : étude en ouvert à un seul bras
(Impact of Osteopathic Treatment in the Management of Patients with Temporomandibular Disorders: A Single-Arm Open-Label Study)
Sufcevski, L., Boucherat, J.B., Traboulsie, A.
La Revue de l'Ostéopathie, 2024/11
784

Osteopathie bei Personen mit einem Ehlers-Danlos-Syndrom - exemplarisch cEDS. Eine Einzelfallstudie
(Osteopathy for people with Ehlers-Danlos syndrome - exemplary cEDS. A single case study)
Eggert, M.H.
Unpublished MSc thesis, 2024/11
785

The use of respiratory patient reported outcome measures (PROMs) in the management of COPD: Perceptions of Australian osteopaths
Engel, R., Baxter, D., Muddle, L., Vaughan, B., Grace, S.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
786

Das Menschenbild in der Osteopathie Wie Osteopath*innen den Menschen sehen. Eine qualitative Studie
(The Human Image in Osteopathy: Osteopaths' Perspectives on the Human Being. A Qualitative Study)
Fuchsluger, M.
Unpublished MSc thesis, 2024/11
Free full text
787

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
788

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11
789

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text
790

Osteopathie in der Rehabilitation von Patienten mit rezidivierenden muskuloskeletalen Verletzungen: eine experimentelle Studie
(Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study)
Sankova, M. V., Nikolenko, V. N., Vovkogon, A. D., Oganesyan, M. V., Trishina, A., Babarzai, L., Antonyan, S. Z., Babarzai, F., Pontes-Silva, A., Zharikov, Y. O.
Manuelle Medizin, 2024/11
791

Enhancing Clinical Skills Through Virtual Reality: A Study on 12-Lead Electrocardiogram Placement in Medical Education
Olayeye, K., Oviawe, E.
Cureus, 2024/11
Free full text
792

Einfluss osteopathischer Interventionen auf den Krankheitsverlauf und deren Auswirkung auf die gesundheitsbezogene Lebensqualität von pädiatrischem Morbus Crohn: Eine Einzelfallstudie
(Influence of osteopathic interventions on disease progression and its impact on health-related quality of life in pediatric Crohn's disease: a single-case study)
Vollmer, A.
Unpublished MSc thesis, 2024/11
793

Effizienz einer osteopathischen Intervention des Diaphragma bei Betroffenen mit Amyotropher Lateralsklerose (ALS)
(Efficacy of osteopathic intervention through the Diaphragm technique in ALS patients)
Wendel, J.
Unpublished MSc thesis, 2024/11
794

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text
795

Therapeutic approaches and conceptions of practice of osteopaths in Australia - a national cross-sectional study and exploratory factor analysis of the Osteo-TAQ
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
BMC Health Services Research, 2024/11
Free full text
796

Pelvic joint stiffness and fear of falling in patients over 75 years of age: a prospective cohort study of 100 patients
Laizeau, C., Jochmans, S., Aufaure, S.
Journal of Osteopathic Medicine, 2024/11
Free full text
797

A Retrospective Comparison of Outcomes after Osteopathic Manipulative Treatments Compared to Trigger Point Injections for Patients with Low Back Pain
Santhosh, R., Smith, A., McCarrell, J., Goff, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/11
798

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/11
799

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text
800

A systematic review of manual therapy modalities and anxiety
West, K. L., Huzij, T.
Journal of Osteopathic Medicine, 2024/11
Free full text
801

Building an evidence base for osteopathy: Trials and tensions. A qualitative study of the experience of clinicians engaging in research
Grace, S., Engel, R., Vogel, S., Ahrens, G., Barclay, K., Guy, C., Lowe, C., McCormack, T., Paranthoiene, J., Carnes, D.
Complementary Therapies in Clinical Practice, 2024/11
Free full text
802

Is Osteopathic Manipulative Treatment Clinically Superior to Sham or Placebo for Patients with Neck or Low-Back Pain? A Systematic Review with Meta-Analysis
Ceballos-Laita, L., Jiménez-Del-Barrio, S., Carrasco-Uribarren, A., Medrano-de-la-Fuente, R., Robles-Pérez, R., Ernst, E.
Diseases, 2024/11
803

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E.
PM&R: The Journal of Injury, Function and Rehabilitation, 2024/11
Free full text
804

Management of Medial Tibial Stress Syndrome with osteopathic manipulative treatment in a basketball player: Case Report
Colli, D., Tarantino, A. G., Bergna, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2024/10
805

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10
806

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10
807

Associations of clinical personnel characteristics and telemedicine practices
Phillips, G., Millhollon, R., Elenwo, C., Ford, A. I., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/10
Free full text
808

Kann osteopathische Behandlung der Patella Knieschmerzen, Beweglichkeit und Lebensqualität verbessern? Eine randomisierte kontrollierte Studie
(Can Osteopathic Treatment of the Patella Improve Knee Pain, Mobility, and Quality of Life? A Randomized Controlled Study)
Dierenbach, R.
Unpublished MSc thesis, 2024/10
809

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text
810

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text
811

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text
812

Effect of manual manipulation on mechanical gait parameters
Yanuck, S. B., Fox, S. K., Harting, B. R., Motyka, T. M.
Journal of Osteopathic Medicine, 2024/10
Free full text
813

Effectiveness of osteopathic craniosacral techniques: a meta-analysis
Amendolara, A., Sheppert, A., Powers, R., Payne, A., Stacey, S., Sant, D.
Frontiers in Medicine, 2024/10
Free full text
814

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text
815

Using Osteopathic Medical School Institutional Data to Establish the Correlation Between Academic Performance and First-Time Board Pass Rates to Develop Academic Interventions for Students at Risk of First Board Failure
Chosie, K.
Cureus, 2024/10
Free full text
816

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text
817

Efficacy of osteopathic manipulative treatment (93.6, ICD-9) - systematic review
Dwornik, M., Puszczałowska-Lizis, E., Wójcik, M., Szajkowski, S., Graczykowski, M., Szymański, D., Marszałek, S.
Medical Studies/Studia Medyczne, 2024/10
Free full text
818

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text
819

Effects of Osteopathic Manipulative Treatment on Rare Diseases: A Case Report on Gordon Syndrome
Johnson, T., Waters, H. B.
Cureus, 2024/10
Free full text
820

Effectiveness of Osteopathic Treatment in Adults with Short Hamstring Syndrome: A Systematic Review
Ogando-Berea, H., Leirós-Rodríguez, R., Hernandez-Lucas, P., Rodríguez-González, Ó
Journal of Clinical Medicine, 2024/10
Free full text
821

Novel Diagnosis and Treatment for Neurogenic Thoracic Outlet Syndrome
Tafler, L., Borkowski, S., Javaid, G., Gandolfo, D., Kleyn, D.
Cureus, 2024/10
Free full text
822

Elite Track and Field Athletes’ Perspective and Experiences of Osteopathic Treatments: A Descriptive Phenomenological Study
Cella, M., Consorti, G., Odorisio, L., Fard, R.
Journal of Bodywork and Movement Therapies, 2024/10
823

Effect of Standard Physical Exercises for Non-specific Low Back Pain Combined with Multimodal Osteopathy Treatment on Pain Intensity and Functional Capacity: A Study Protocol for a Randomized Controlled Trial
Ferreira, C. R., Hort, J. P., Bezerra, L. A., Neto, H. P., Biasotto-Gonzalez, D. A., Politti, F.
Journal of Advances in Medicine and Medical Research, 2024/10
Free full text
824

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10
825

A Retrospective Study of Virtual Hospital Experiential Learning Across Clerkship and Pre-clerkship Doctor of Osteopathic Medicine Students at a Medical School Based in the United States
Kersh, L., Sciuva, A., Shaw, J.
Cureus, 2024/10
Free full text
826

Verbesserung der Schlafqualität während der Wechseljahre - Ein osteopathischer Ansatz
(Sleep quality improvement during Perimenopause – an osteopathic approach)
Schellhorn, S.
Unpublished MSc thesis, 2024/10
827

Effect of electromagnetic stimulation combined with visceral manipulation on stress urinary incontinence in postmenopausal women: A randomized controlled trial
Mohamed, D. M. A., Kamel, D. M., El-Moatasem, A. M., Ali, E. A., Radwan, M. A., Ahmed, S. M.
Journal of Bodywork and Movement Therapies, 2024/10
828

Conservative, physical and surgical interventions for managing faecal incontinence and constipation in adults with central neurological diseases
Todd, C. L., Johnson, E. E., Stewart, F., Wallace, S. A., Bryant, A., Woodward, S., Norton, C.
Cochrane Database of Systematic Reviews, 2024/10
829

An Osteopathic Approach to Foot Drop: A Case Report of Posterior Fibular Head
Volokitin, M., Libman, A. E., Milani, S., Banihashem, M., Ayon, S.
Cureus, 2024/10
Free full text
830

Impacto do tratamento manipulativo osteopático nos músculos faciais de crianças com sequência de Moebius
(Impact of osteopathic manipulative treatment in children with congenital facial paralysis)
Amoroso Borges, B. L.
Unpublished Dissertation, 2024/10
Free full text
831

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10
832

Primary and secondary prevention of musculoskeletal pain and disability in chiropractic, osteopathy, and physiotherapy: A scoping review
Draper-Rodi, J., Delion, T., MacMillan, A., Storey, A. I., Spadaccini, J., Jebi, W., Thomson, O. P., Hohenschurz-Schmidt, D.
International Journal of Osteopathic Medicine, 2024/09
Free full text
833

Paradigmata der (ursprünglichen) Osteopathie
(Paradigms of (original) osteopathy)
Engel, M.
Osteopathische Medizin, 2024/09
834

Die Bedeutung des osteopathischen Behandelns für Kinder nach einer Frühgeburt: Eine Befragung von Kinderosteopath*innen
(The importance of osteopathic treatment for children after premature birth: a survey of pediatric osteopaths)
Hackner, L., Belz, S., Esch, S.
Osteopathische Medizin, 2024/09
835

Heilungshindernis bei klaffender Tube – ein Fallbericht
(Obstacle to healing a patulous Eustachian tube - a case report)
Kaltenbrunner, U.
Osteopathische Medizin, 2024/09
836

Osteopathische herzfokussierte Palpation und Herzfrequenzvariabilität: Teil 1 – Ziele, Material und Methoden der randomisierten, kontrollierten Pilotstudie
(Osteopathic heart-focused palpation and heart rate variability: Part 1 - Objectives, material and methods of the randomized controlled pilot study)
Liem, T., Bohlen, L., Jung, A.M., Hitsch, S., Schmidt, T.
Osteopathische Medizin, 2024/09
837

Perceived benefits and limitations of game-based simulation education by osteopathy students in early clinical training: A preliminary mixed methods study
Mhadhbi, H., Horta, L. M., Ims, J., Draper-Rodi, J., Mansfield, H., Shaw, R., Rinne, S., Cleland Silva, T., Metsälä, E., Ménard, M.
International Journal of Osteopathic Medicine, 2024/09
838

ADHS bei Erwachsenen in der osteopathischen Praxis
(ADHD in adults in the osteopathic practice)
Plathner, M.
Osteopathische Medizin, 2024/09
839

Development and adaptation of the Osteopaths' Therapeutic Approaches Questionnaire (Osteo-TAQ) for the Australian osteopathic profession - A cognitive interview study
Thomson, O. P., McLeod, G. A., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2024/09
840

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09
841

Young Doctors Program-Colorado: An Elective Elementary School Program to Improve Health Literacy, Utilization of the Healthcare System, and Osteopathic Awareness
Sposet, S., Fabich, R., McEchron, M.
Medical Science Educator, 2024/09
Free full text
842

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
843

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
844

Behandlung des männlichen chronischen Beckenschmerzsyndroms (CBSS)
(Treatment of male chronic pelvic pain syndrome (CPPS))
Switters, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09
845

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text
846

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text
847

Positional plagiocephaly: results of the osteopathic treatment of 424 infants. An observational retrospective cohort study
Panza, R., Piarulli, F., Rizzo, V., Schettini, F., Baldassarre, M. E., Di Lorenzo, A., Tafuri, S., Laforgia, N.
Italian Journal of Pediatrics, 2024/09
Free full text
848

Osteopathic Approach to Proximal Hamstring Tendinopathy-related Sciatic Nerve Entrapment (PHTrSNE): Case Report
Hermoso, J., Bailey, G., Bhatti, K., Sneed, J.
The AAO Journal, 2024/09
849

Osteopathic Considerations in the Medical Treatment of a Patient with COVID-Related Respiratory Distress
Yang, Y., Carnes, M., Kingery, J., Stiles, E.
The AAO Journal, 2024/09
850

Evaluation of the clinical effectiveness of osteopathic gallbladder drainage techniques
(Оценка клинической результативности остеопатических техник дренирования желчного пузыря)
Belash, V. O., Zavadsky, E. Y., Zueva, A. I.
Russian Osteopathic Journal, 2024/09
851

Medical and pharmacy students' perceptions of their IPE and cultural competencies following an innovative course
Addo-Atuah, J., Gardere, J.
Pharmacy Education, 2024/09
852

Influence of a single osteopathic procedure on the regulatory processes of the body of premature infants (pilot study
(Влияние однократной процедуры остеопатической коррекции на регуляторные процессы организма недоношенных детей (пилотное исследование)
Belyaev, A. F., Yurchenko, M. S., Kharkovskaya, T. S., Kurleeva, T. Y., Akhtanina, E. A.
Russian Osteopathic Journal, 2024/09
853

Morphofunctional indicators of the body students of the medical university
(Морфофункциональные показатели организма студентов медицинского университета)
Kalyuzhny, E. A., Bogomolova, E. S., Mukhina, I. V., Galova, E. A., Basurov, V. A., Nazarova, N. A.
Russian Osteopathic Journal, 2024/09
854

Characteristics of perception channels of doctors and their changes in the process of professional retraining in the discipline of «Osteopathy»
(Характеристики каналов восприятия у врачей и их изменения в процессе профессиональной переподготовки по дисциплине «Остеопатия»)
Sokolova, I. V., Potekhina, Y. P.
Russian Osteopathic Journal, 2024/09
855

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text
856

Chronic Rhinosinusitis Management: A Narrative Review Comparing Interventional Treatment With Osteopathic Manipulation
Klover, C. R., Gorantla, V. R.
Cureus, 2024/09
Free full text
857

„Wie der Ast gebogen wird, so wächst der Baum“
Teichmann, P.
Skeptiker, 2024/09
858

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text
859

Available Treatments and Adjunctive Therapies for Polycystic Ovarian Syndrome (PCOS) Patients of Reproductive Age: A Scoping Review
Cochran, L., Nadolny, R., Garcia, K., Kluglein, K. A., Yagoda, A., Gandhi, P., Dressel, J., Prol, B., Peralta, R., Shipp, A., Costin, J. M.
Cureus, 2024/09
Free full text
860

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text
861

Investigating the safety and feasibility of osteopathic manipulative medicine in hospitalized children and adolescent young adults with cancer
Belsky, J. A., Brown, A. M.
Journal of Osteopathic Medicine, 2024/09
Free full text
862

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text
863

Effects of Osteopathic Manipulative Treatment (OMT) on Lower Extremity Muscle Characteristics in Parkinson's disease (PD) Patients
Radigan, R., Finkelstein, A., Mehra, M., Bhushan, P., Lombardo, T., Yao, S.
Movement Disorders, 2024/09
864

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text
865

Tratamiento osteopático integral de la lumbociática L4-L5 post-discectomía
(Comprehensive osteopathic treatment of post-discectomy L4-L5 lumbar sciatica)
Barra Burotto, E.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
866

Efectividad de las manipulaciones vertebrales en pacientes con cefalea de tensión
(Effectiveness of spinal manipulations in patients with tension headaches)
Bohoyo Aramburu, C., Urien Abaunza, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
867

Terapia manual y tratamiento osteopático en el Síndrome del Túnel Capiano
(Manual therapy and osteopathic treatment for Carpal Tunnel Syndrome)
Carleos Mayán, F., Otero Torres, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
868

Efectividad del tratamiento osteopático en el síndrome de dolor pélvico crónico
(Effectiveness of osteopathic treatment in chronic pelvic pain syndrome)
del Pilar Jopia Escobar, M., Leal Blu, C. G., Negrete Fuentes, K. V.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
869

Efectos de la terapia osteopática en pacientes intervenidos quirúrgicamente de esternotomía media por problemas cardíacos
(Effects of osteopathic therapy in patients who have undergone median sternotomy surgery for heart problems)
Garro Sais, C.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
870

Efectividad del tratamiento osteopático en el síndrome subacromial
(Effectiveness of osteopathic treatment in subacromial syndrome)
Izquierdo Aicart, L., Ruiz Rojo, N., Santiago Ramirez, J.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
871

Professional skill priorities: Comparison views of osteopathy industry professionals and osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2024/09
Free full text
872

Efectos de las técnicas osteopáticas craneales sobre el sistema nervioso autónomo
(Effects of cranial osteopathic techniques on the autonomic nervous system)
Potts, J., Bentley, J.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
873

Efectividad del tratamiento osteopático en pacientes con trastorno temporomandibular
(Effectiveness of osteopathic treatment in patients with temporomandibular disorder)
Raisman, M., Muro Ruíz, L.
European Journal Osteopathy & Related Clinical Research, 2024/09
Free full text
874

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09
875

Data-driven analysis of whole-brain intrinsic connectivity in patients with chronic low back pain undergoing osteopathic manipulative treatment
Tomaiuolo, F., Cerritelli, F., Delli Pizzi, S., Sestieri, C., Paolucci, T., Chiacchiaretta, P., Sensi, S. L., Ferretti, A.
NeuroImage: Clinical, 2024/08
Free full text
876

A Test of Reliability: Cranial Rhythmic Impulse for Distant Diagnoses
Alvarez, L. A., Cook, A. C., Sweeney, C. P., Walter, M. R., South, S. C., Myers, N., Boesler, D., Ma, S., Thomas, K., Quinn, T. A.
Cureus, 2024/08
Free full text
877

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08
878

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text
879

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text
880

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08
881

Evaluation of the Effect of Nutrition Education on Osteopathic Medical Students’ Personal Nutrition Choices and Incorporation Into Future Medical Practice
Parker, A. T., Bateman, R., Fastring, D.
Cureus, 2024/08
Free full text
882

A Natural Approach to Bell's Palsy: An Osteopathic Treatment Option
Schneider, N., Shih, S., Rundquist, L., Llanio, L., Kurian, A., Ring, A., Barry, P.
Cureus, 2024/08
Free full text
883

A Review on Osteopathic Manipulation in Patients With Headache
Sharath, H. V., Nadipena, P. T., Qureshi, M. I., Phansopkar, P.
Cureus, 2024/08
Free full text
884

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text
885

A Critical Appraisal of Reporting in Randomized Controlled Trials Investigating Osteopathic Manipulative Treatment: A Meta-Research Study
Zambonin Mazzoleni, G., Bergna, A., Buffone, F., Sacchi, A., Misseroni, S., Tramontano, M., Dal Farra, F.
Journal of Clinical Medicine, 2024/08
886

Musculoskeletal Healthcare Professionals' perspectives on objective postural assessment (Expectation and Experience): A UK (Multiprofessional) nationwide survey, 21 August 2024, PREPRINT (Version 1) available at [Journal: Research Square
Martin, D.C., McGuigan, P., Matei, R., Kandasamy, G.
, 2024/08
887

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text
888

The effect of osteopathic manipulative treatment on quality of life in patients with cardiac implantable electronic devices
Nikakis, J., Tale, E., Malkov, D., Arora, U. S., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2024/08
Free full text
889

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08
890

Identifying the basis of manual therapy for the physiotherapy, chiropractic, medical, and osteopathic professions: is there a common genesis from 19th century Northern Europe?
MacDonald, C. W.
Unpublished PhD thesis, 2024/07
Free full text
891

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
892

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/07
Free full text
893

Examining differences in trends in the orthopedic surgery match for osteopathic and allopathic medical graduates after the transition to single accreditation
Wood, R. S., Krumrey, J.
Journal of Osteopathic Medicine, 2024/07
Free full text
894

Effects of a novel osteopathic visceral technique for the pancreas on pain and range of motion in a patient with neck pain: Case report
Ferreira Faria, M. Â.
Journal of Bodywork and Movement Therapies, 2024/07
895

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text
896

Effectiveness of craniosacral therapy, Bowen therapy, static touch and standard exercise program on sleep quality in fibromyalgia syndrome: A randomized controlled trial
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P., Lakshmi, R. V.
Journal of Integrative Medicine, 2024/07
897

Effect of Visceral Manipulation on Children with Refractory Chronic Functional Constipation: A Randomized Controlled Trial
Zakaryaei, S. A., Ravanbakhsh, M., Javaherizadeh, H., Hakimzadeh, M., Shaterzadeh-Yazdi, M. J.
Arquivos de Gastroenterologia, 2024/07
898

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text
899

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07
900

How completely are randomized controlled trials of non-pharmacological interventions following concussion reported? A systematic review
van Ierssel, J. J., Galea, O., Holte, K., Luszawski, C., Jenkins, E., O', Neil, J., Emery, C. A., Mannix, R., Schneider, K., Yeates, K. O., Zemek, R.
Journal of Sport and Health Science, 2024/07
Free full text
901

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text
902

Interoceptive bodily awareness in patients seeking pain relief with osteopathic manipulative treatment: an observational cohort pilot study
Emmet, D. K., Davis, G., Pierce-Talsma, S., Shubrook, J. H., Mehling, W.
Journal of Osteopathic Medicine, 2024/07
Free full text
903

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07
904

Osteopathic single manipulation of the sacroiliac joint and lower cervical spine improves selected gait parameters in sport horses
Boixaderas, A. R.
Unpublished PhD thesis, 2024/07
Free full text
905

Kraft- und Spannungsübertragung in der unteren Extremität
(Transmission of force and tension in the lower extremity)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
906

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
907

The Effects of Osteopathic Manipulative Treatment on Brain Activity: A Scoping Review of MRI and EEG Studies
Bonanno, M., Papa, G. A., Ruffoni, P., Catalioto, E., De Luca, R., Maggio, M. G., Calabrò, R. S.
Healthcare, 2024/07
Free full text
908

Osteopathie und evidenzbasierte Medizin, Teil 3: Bedeutung der EBM für die Osteopathie
(Osteopathy and evidence-based medicine, part 3: Relevance of EBM for osteopathy)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
909

Alternative Therapies for Ankyloglossia-Associated Breastfeeding Challenges: A Systematic Review
Chowdhury, R., Khoury, S., Leroux, J., Alsayegh, R., Lawlor, C. M., Graham, M. E.
Breastfeeding Medicine, 2024/07
910

Lehre bereichert und verbindet – das Praxissemester
(Teaching enriches and connects – the practical semester)
Sander, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
911

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07
912

Osteopathie bei Gliedergürtelmuskeldystrophie Miyoshi 3
(Osteopathy for Limb-girdle muscular dystrophy Miyoshi 3)
Ritter, C. I.
Unpublished MSc thesis, 2024/07
Free full text
913

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06
914

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text
915

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/06
Free full text
916

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
917

Evidence of anchoring bias in novice (first year) osteopathic French students in the context of the primary respiratory mechanism: A randomized-experimental study
Driaï-Allègre, C., Coste, F., Olmière, C., Grinand, M., Le Nohaïc, A., Romanet, F., Gourjon, G.
International Journal of Osteopathic Medicine, 2024/06
918

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Canadian osteopaths
Pelletier, R., Morin, C., Noy, M., Thomson, O. P., Sundberg, T., Leach, M. J.
International Journal of Osteopathic Medicine, 2024/06
919

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E., Aminian, S., Heath, S.
International Journal of Osteopathic Medicine, 2024/06
920

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2024/06
921

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06
922

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06
923

Osteopathie und inneres Wohlbefinden bei Menschen mit chronischer Erkrankung
(Osteopathy and inner well-being by people with chronic illness)
Fachinger, B. C.
Unpublished MSc thesis, 2024/06
Free full text
924

Risiken und Komplikationen der zervikalen Manipulation
(Risks and adverse events of cervical manipulation)
Feil-Santos, M.
Unpublished MSc thesis, 2024/06
925

Osteopathie in Deutschland
(Osteopathy in Germany)
, 2024/06
Free full text
926

Der Einfluss von Osteopathie auf Schluckstörung und Erbrechen bei CMS
(The influence of osteopathy on dysphagia and vomiting in CMS)
Hinterreither, R.
Unpublished MSc thesis, 2024/06
927

Osteopathie bei Trinkschwierigkeiten Neugeborener
(Osteopathy for feeding dysfunctions in newborns)
Hofko, P.
Unpublished MSc thesis, 2024/06
928

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
929

Osteopathie bei Frühgeborenen-Effekte auf klinische Parameter. Ein systematischer Review
(Osteopathy in premature babies-effects on clinical parameters. A systematic review)
Kaineder, G.
Unpublished MSc thesis, 2024/06
930

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text
931

Der Einfluss von Osteopathie auf Spastik bei einer Multiple Sklerose (MS) Patientin
(The influence of osteopathy on spasticity in a multiple sclerosis (MS) patient)
Pleister, M.I.
Unpublished MSc thesis, 2024/06
932

Reported biological effects following Osteopathic Manipulative Treatment: A comprehensive mapping review
Dal Farra, F., Bergna, A., Lunghi, C., Bruini, I., Galli, M., Vismara, L., Tramontano, M.
Complementary Therapies in Medicine, 2024/06
933

Der Effekt von biodynamischer/energetischer Osteopathie auf Babys 0-6 Monate mit nicht synostotischer Plagiocephalie im Vergleich zur standardisierten Lagerungstherapie (counterpositioning)
(The effectiveness of Biodynamics (bioenergetic Osteopathy) of children 0-6 months with non-synostotic plagiocephaly in relation to counterpositioning therapy)
Tauwel, S.
Unpublished MSc thesis, 2024/06
934

Stabilometric and Baropodometric Evaluation after Osteopathic Scaphoid Tug Manipulation
Molina Payá, F. J., Montero Navarro, S., Del Rio Medina, S., Orts Ruiz, C., Mor-Era Balaguer, J., Salar An-Dreu, C., Sánchez Mas, J. M., Botella Rico, J. M.
International Journal of Sports Physical Therapy, 2024/06
935

Effects of Osteopathic Manipulative Treatment (OMT) on the Thoracic Duct via Ultrasound Imaging
Atkinson, E., Kawachi, S., Kozar, A. J.
The AAO Journal, 2024/06
936

From finger to breast: OMT helps latch
Barr, J., O'Donnell, A.
The AAO Journal, 2024/06
937

Osteopathic Manipulative Treatment, a Novel Adjunct in Sickle Cell Disease Care: Interim Safety and Feasibility Analysis
Brown, A., Eyassu, E., Hoffmann, L., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
The AAO Journal, 2024/06
938

The Role of Osteopathic Structural Findings in Meningitis
Cecil, E., Burke, D.
The AAO Journal, 2024/06
939

Efficacy of Osteopathic Manipulative Treatment in Post-Stroke Recovery Patients
Dalton, D., Walker, A., Vu, P., Medina, C.
The AAO Journal, 2024/06
940

OMT Improves Diaphragm Range of Motion on Ultrasound Imaging
DiSabato, X., Atkinson, E., Kozar, A. J., Robinson, L., Dixon, E.
The AAO Journal, 2024/06
941

OMT in Headache Management: Systematic Review and Meta-Analysis Protocol
Gibson, E., Will, M., Garcia, C. J., Johnson, R., Kirsch, J. R., Spencer, D. V., Wang, M. Y.F., Rehman, Y., Snider, K. T.
The AAO Journal, 2024/06
942

Osteopathic correction in the complex treatment of women of reproductive age with pelvic organ prolapse
(Остеопатическая коррекция в комплексном лечении женщин репродуктивного возраста с пролапсом тазовых органов)
Bakanova, A. R., Lebedev, D. S., Nenashkina, E. N.
Russian Osteopathic Journal, 2024/06
943

The role of diaphragmatic motion in peritoneal lymphatic absorption examined in case of splenic rupture
King, C., Ettlinger, H.
The AAO Journal, 2024/06
944

The Role of Osteopathic Manipulative Treatment in a Case of Pediatric Craniosynostosis
Kurup, D., Ettlinger, H.
The AAO Journal, 2024/06
945

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06
946

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06
947

More Than a Pain in the Butt: Response to OMT as a diagnostic aid to identify arterial gluteal claudication
Mather, M., Schaefer, M.
The AAO Journal, 2024/06
948

Evaluating the effects of Osteopathic Manipulative Treatments in Pregnancy: Comparing the difference between outpatient versus inpatient treatments on incidence rates of C sections
Politi Gonzalez, C., Torres, J.
The AAO Journal, 2024/06
949

The case for Frequency Specific Microcurent in combination therapy of an acute forearm injury
Shah, A., Johnson, A.
The AAO Journal, 2024/06
950

Dynamic styles of osteopaths based on assessment of the bioelectrical activity of the brain using the method of mathematical analysis of a first-order multivariate structural function
(Динамические стили остеопатов на основе оценки биоэлектрической активности мозга с применением метода математического анализа мультивариативной структурной функции первого порядка)
Piskunova, G. E., Trifonov, M. I., Panasevich, E. A., Belyaev, A. F.
Russian Osteopathic Journal, 2024/06
951

Keeping the MonSter Under Control: The Role of Osteopathic Manipulative Therapy (OMT) in Characterization and Management of Chronic Pain in Multiple Sclerosis
Song, Y. J., Faruque, R., Hall, T., Waddington, M.
The AAO Journal, 2024/06
952

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06
953

Hat die osteopathische Behandlung einen Einfluss auf persistierende Symptome unter Hormonersatztherapie bei Frauen mit einer Hashimoto-Thyreoiditis? Prä-Post-Studie.
(Does individual osteopathic treatment influence persistent symptoms under hormone replacement therapy in women with Hashimoto´s thyreoiditis? A pre-post study )
Kriehmig, S., Vetter, A., Rüdrich, K.
Unpublished D.O. thesis, 2024/06
954

An Osteopathic Approach to Prolonged Surgical Scar and Epidural Site Pain after Cesarean Section: A Case Study
Whitaker, Z., Gailius, G.
The AAO Journal, 2024/06
955

Die osteopathische Behandlung von Patienten mit idiopathischem Parkinson-Syndrom. Prä-Post-Studie.
(Does individual osteopathic treatment influence Parkinson´s disease-specific health related quality of life in patients suffering from idiopathic Parkinson´s disease?
Schellhase, M., Schröter, C.
Unpublished D.O. thesis, 2024/06
956

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06
957

Workin’ 9 to 5, but Now Can Thrive: Chronic Headache Diagnosed and Treated with OMT
Bernett, A. M., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
958

Piriformis or Not Piriformis? The Impact of OMT on Buttock and Hip Pain: A Case Report
Blankenbaker, J., Ural, E.
The AAO Journal, 2024/06
959

Osteopathic Management of Bertolotti Syndrome
Bowen, A., Henderson, K. K., Heinking, K. P., McKinnon, K.
The AAO Journal, 2024/06
960

Resolution of Notalgia Paresthetica Symptoms following Osteopathic Manipulative Treatment (OMT): A Case Report
Bressler, K., Macmillan, G., Mancini, J., Yao, S. C., Papadopoulos, D., Abu-Sbaih, R.
The AAO Journal, 2024/06
961

Invasive Beatmung und prolongiertes Weaning: Auswirkungen osteopathischer Techniksequenzen
(Invasive ventilation and prolonged weaning. Effects of osteopathic sequences of techniques)
Boehme, A., Thönnessen, P., Ibel, R.
Osteopathische Medizin, 2024/06
962

Oh Snap! Osteopathic Treatment of Tendon Rupture with Link to Long Term Statin Use
Carpinelli, S., Richie, C.
The AAO Journal, 2024/06
963

Response to Osteopathic Manipulative Treatment in a Newborn with Breastfeeding Difficulties: A Case Report
Coxon, J., Gannon, T. M.
The AAO Journal, 2024/06
964

Comparison of the effects of abdominal massage and osteopathic manipulative treatment home program on constipation in children with cerebral palsy
Chatip, A. T., Acar, G., Akçay, A. A.
JGH Open, 2024/06
Free full text
965

Osteopathic Management of Chronic Pain Following Bilateral Periacetabular Osteotomy in Developmental Hip Dysplasia
Edgar, T., Heller, G. R., Hutson, M., Melin, D., Bardowell, A.
The AAO Journal, 2024/06
966

Manual Therapy Interventions in Patients With Chronic Obstructive Pulmonary Disease: A Comprehensive Narrative Review
Chilhate, P. K., Lalwani, L.
Cureus, 2024/06
Free full text
967

“I walk funny and I don’t know why,” Osteopathic manipulative treatment for an adult female with congenital bilateral Femoral Neck Anteversion (FNA)
Fredrickson, T., Broussard, D., Waters, H.
The AAO Journal, 2024/06
968

Osteopathie, was bist du?: Homo- und Heterogenität zwischen osteopathischen und manualmedizinischen Techniken
(Osteopathy, what are you?: Homogeneity and heterogeneity between osteopathic and manual medicine techniques)
Engel, M.
Osteopathische Medizin, 2024/06
969

Stagnating the Symptomatic Progression of Primary Lateral Sclerosis
Geyer-Roberts, E., Desai, B., Perez, J., Grote, J., Helderlein, P., Posey, A.
The AAO Journal, 2024/06
970

The Use of Exercise Prescription in Australian Osteopathy Practice: Secondary Analysis of a Nationally Representative Sample of the Profession
Fleischmann, M., Vaughan, B., Fitzgerald, K.
The Scientific World Journal, 2024/06
Free full text
971

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06
972

Bibliometrische Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2023: Der INIOST-Studienreport 2023
(Bibliometric overview of osteopathic studies published worldwide in 2023: The INIOST Study Report 2023)
Franke, H.
Osteopathische Medizin, 2024/06
973

Development of an Osteopathic Manipulative Treatment Clinician-Parent Home Care Education Intervention for Children with Otitis Media
Krzykwa, E., Pietrantoni, D., Waters, H.
The AAO Journal, 2024/06
974

Le statut juridique de la médecine non conventionnelle en France: une intégration possible dans le droit de la santé?
(The legal status of non-conventional medicine in France: possible integration into health law?)
Perrone, C.
Unpublished PhD thesis, 2024/06
975

Transforming Fibromyalgia Care: An Osteopathic Route to Improving Quality of Life
Kurian, A., Schneider, N., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
976

Wie es dazu kam, dass Osteopathie unterrichtet wurde
(How osteopathy came to be taught)
Haxton, J.
Osteopathische Medizin, 2024/06
977

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06
978

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06
979

A case report of improvement of isolated abducens nerve palsy following osteopathic manipulative treatment
Maddie, N., Keys, J.
The AAO Journal, 2024/06
980

Effects of OMT on Blood Glucose and Insulin Sensitivity in Adult Male Rats
Petrillo, G., Staudt, M., Lobo, S., Cai, W., Keys, J.
The AAO Journal, 2024/06
981

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06
982

Osteopathische Behandlung neuropathischer Nacken- und Beckenbodenschmerzen
(Osteopathic treatment of neuropathic neck and pelvic floor pain)
Peuker, E.
Osteopathische Medizin, 2024/06
983

Osteopathic Manipulative Treatment in Occipital Neuralgia
Ring, A., Llanio, L., Barry, P., Qureshi, Y.
The AAO Journal, 2024/06
984

An Osteopathic Approach to Cervicogenic Vertigo
Rundquist, L., Shih, S., Sandhouse, M.
The AAO Journal, 2024/06
985

Severe Eczema and Hair Growth Improvements with Osteopathic Manipulative Treatment (OMT) in Pediatric Patient: A Case Study
Sanchez, E., Papadopoulos, D., Yao, S. C., Abu-Sbaih, R.
The AAO Journal, 2024/06
986

An Osteopathic Approach to Temporomandibular Dysfunction Secondary to A Motor Vehicle Accident
Schneider, N., Kurian, A., Widboom, N., Qureshi, Y.
The AAO Journal, 2024/06
987

An Osteopathic Approach to Eyelid Myokymia
Shih, S., Rundquist, L., Qureshi, Y.
The AAO Journal, 2024/06
988

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text
989

Effect of Osteopathic Manipulative Treatment (OMT) for Symptomatic Headache Relief in Long-COVID Patient: A Case Report
Unser, K., Thomas, A., Cornwell, S., Yao, S. C., Keys, J.
The AAO Journal, 2024/06
990

Osteopathic Manipulative Medicine and Disorders: An Overview of Peer-Reviewed Publications 2018-2022
White, C., Xie, Y., Bigham, J., Stanczak, A., Ninan, D., Hu, C. A.
Cureus, 2024/06
Free full text
991

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06
992

Reducing Blood Pressure: Use of Osteopathic Manipulative Treatment (OMT) as Adjunct Therapy in Treating Uncontrolled Hypertension
Voas, A., Wirth, K., Delaney, C., Li, V., Figueroa, J. S.
The AAO Journal, 2024/06
993

Case Study: The Effect of Osteopathic Manipulation on Diabetic Gastroparesis
Yazdi, S. A., Tucker, D., Hwang, G., Majeed, A., Hsubrook, J. H., Penq, N.
The AAO Journal, 2024/06
994

Berücksichtigung sozialer Faktoren in der Patient*innen-Osteopath*innen-Beziehung Eine qualitative Interviewstudie vor der Theorie des Enaktivismus
Mayrl, E.
Unpublished MSc thesis, 2024/06
995

Increased Alertness in Comatose Patient After Osteopathic Manipulative Treatment: A Case Report
Garcia, A. E., Kay, K., Perera, M. X., Martinez, E. S., Onyi, S., Nourani, B., Loveless, B.
The AAO Journal, 2024/06
996

A Comparative American Board of Surgery In-Training Examination (ABSITE) Performance Analysis Between International vs. Domestic Graduates and Doctor of Medicine (MD) vs. Doctor of Osteopathic Medicine (DO) Medical Degrees
Rahimpour, A., Morrison, M., Denning, D. A., Bown, P., Ray, P., Barry, R.
Cureus, 2024/06
Free full text
997

An Alternative Approach to Median Arcuate Ligament Syndrome
Geyer-Roberts, E., Wallace-Ross, J.
The AAO Journal, 2024/06
998

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text
999

Successful Treatment using OMT for Chronic GERD in a Pediatric Patient
Shams, S., Chohan, M. M., King, A.
The AAO Journal, 2024/06
1000

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06
1001

Post-surgical Median Arcuate Ligament Syndrome (MALS) Symptom Exacerbation Treated With Osteopathic Manipulative Treatment (OMT): A Case Report
Volokitin, M., Bergman, A.
Cureus, 2024/06
Free full text
1002

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
1003

La gouttière occlusale: lien indispensable entre le chirurgien-dentiste et l’ostéopathe
(The occlusal splint: an essential link between the dentist and the osteopath)
Dupas, P. H., Dupas, G.
La Revue de l'Ostéopathie, 2024/05
1004

Does regular attendance in supplemental virtual near-peer tutoring in anatomy laboratory content improve anatomy performance for medical students?
Doty, J. E., Thompson, N. E.
Anatomical Sciences Education, 2024/05
1005

Der unmittelbare Effekt der Allgemeinen Osteopathischen Behandlung (AOB) auf die posturale Kontrolle bei Patienten/Patientinnen nach Schlaganfall. Eine randomisierte kontrollierte Studie
(The immediate effect of general osteopathic treatment (AOB) on postural control in patients after stroke. A randomized controlled trial)
Brunner, M.
Unpublished MSc thesis, 2024/05
1006

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/05
Free full text
1007

Der Begriff Selbstheilung – und seine Bedeutung aus Perspektive österreichischer Osteopath:innen
(The concept of self-healing - and its meaning from the perspective of Austrian osteopaths)
Kaiser, K.
Unpublished MSc thesis, 2024/05
1008

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text
1009

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text
1010

Interventions to promote medical student well-being: an overview of systematic reviews
Bennett-Weston, A., Keshtkar, L., Jones, M., Sanders, C., Lewis, C., Nockels, K., Solomon, J., Howick, J.
BMJ Open, 2024/05
Free full text
1011

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text
1012

Immediate Effects of Integrative Health and Medicine Modalities Among Outpatients With Moderate-To-Severe Symptoms
Rodgers-Melnick, S. N., Srinivasan, R., Rivard, R. L., Adan, F., Dusek, J. A.
Global Advances in Integrative Medicine and Health, 2024/05
Free full text
1013

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05
1014

Efficacy of Osteopathic Manipulative Treatment for Pain Reduction in Patients With Patellofemoral Pain Syndrome: A Meta-Analysis of Randomized Controlled Trials
Delgadillo, B. E., Bui, A., Debski, A. M., Miller, B., Wu, S. S.
Cureus, 2024/05
Free full text
1015

Celebrating Success: Osteopathic Physicians’ Journey From Match Day to Healthcare Leadership
Gregory, P.
Osteopathic Family Physician, 2024/05
1016

The Effects of Osteopathic Manipulative Treatment (OMT) on Postoperative Length of Stay: A Meta-Analysis
Henwood, L., Le Donne, M. E., Vaughn, A., Kamil, S., Harrington, A., Scott, R.
Cureus, 2024/05
Free full text
1017

Effects of Osteopathic Manipulative Treatment Alone or in Combination With Respiratory Training on Chest Wall Expansion, Functional Mobility, and Dyspnea Level in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
American Journal of Respiratory and Critical Care Medicine, 2024/05
1018

The Efficacy of Early Osteopathic Therapy in Restoring Proper Sucking in Breastfed Infants: Preliminary Findings from a Pilot Study
Parodi, A., Ruffa, R., De Felice, V., Sartini, M., Cristina, M. L., Martino, B., Bianco, F., Di Stefano, R., Mazzella, M.
Healthcare, 2024/05
Free full text
1019

Implementing PathElective as an organized means of supplementing pathology education in an osteopathic medical school-the New York Institute of Technology College of Osteopathic Medicine experience
Plummer, M. M., Mirza, K. M., Lilley, C. M., Eng, N.
Academic Pathology, 2024/05
Free full text
1020

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05
1021

Implementing paper-based patient-reported outcome collection within outpatient integrative health and medicine
Srinivasan, R., Rodgers-Melnick, S. N., Rivard, R. L., Kaiser, C., Vincent, D., Adan, F., Dusek, J. A.
PLoS One, 2024/05
Free full text
1022

A modern way to teach and practice manual therapy
Kerry, R., Young, K. J., Evans, D. W., Lee, E., Georgopoulos, V., Meakins, A., McCarthy, C., Cook, C., Ridehalgh, C., Vogel, S., Banton, A., Bergström, C., Mazzieri, A. M., Mourad, F., Hutting, N.
Chiropractic & Manual Therapies, 2024/05
Free full text
1023

Multi-modal Assessment of Myofascial Trigger Point Response to Osteopathic Manipulation in the Anterior Forearm
Pedapati, C.
Unpublished PhD thesis, 2024/05
1024

Manual Therapy of Dysphagia in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
De Marchi, I., Buffone, F., Mauro, A., Bruini, I., Vismara, L.
Medicina, 2024/05
Free full text
1025

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text
1026

Promoting the Integration of Direct-to-Consumer Genetic Testing Results Into Clinical Practice
Glenn, K.
Unpublished PhD thesis, 2024/05
Free full text
1027

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04
1028

Effects of osteopathic manipulative treatment on children with plagiocephaly in the context of current pediatric practice: a retrospective chart review study
King, H. H., Mai, J., Morelli Haskell, M. A., Wolf, K., Sweeney, M.
Journal of Osteopathic Medicine, 2024/04
Free full text
1029

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2024/04
Free full text
1030

Effekte der Osteopathie auf posturale Säuglingsasymmetrien und den Stillprozess
(Effects of osteopathy on infant postural symmetry disorders and the breastfeeding process)
Elsässer, S.
Unpublished MSc thesis, 2024/04
1031

Effect of manual osteopathic techniques on the autonomic nervous system, respiratory system function and head-cervical-shoulder complex—a systematic review
Stępnik, J., Czaprowski, D., Kędra, A.
Frontiers in Medicine, 2024/04
Free full text
1032

Der unmittelbare Effekt einer osteopathischen Behandlung des Caecums - bei PatientInnen nach offener Appendektomie - auf die lumbopelvine Mobilität: eine randomisierte kontrollierte Studie
(The immediate effect of osteopathic treatment of the caecum - in patients after open appendectomy - on lumbopelvic mobility: a randomized controlled trial)
Prodinger, R.
Unpublished MSc thesis, 2024/04
1033

Overcoming barriers to equality, diversity, inclusivity, and sense of belonging in healthcare education: the Underrepresented Groups' Experiences in Osteopathic Training (UrGEnT) mixed methods study
Draper-Rodi, J., Abbey, H., Hammond, J., Thomson, O. T., Brownhill, K., MacMillan, A., Fabusuyi, Y., Vogel, S.
BMC Medical Education, 2024/04
Free full text
1034

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text
1035

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text
1036

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text
1037

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text
1038

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text
1039

Overview of Treatment Options for Mild Traumatic Brain Injury: A Literature Review
Patel, H., Polam, S., Joseph, R.
Cureus, 2024/04
Free full text
1040

Das Verständnis von deutschsprechenden Osteopath:innen der Schweiz bezüglich des Nervus vagus und dessen Integration in den Praxisalltag : eine qualitative Studie
(The understanding of German-speaking osteopaths in Switzerland regarding the vagus nerve and its integration into everyday practice : a qualitative study)
Eggenberg, E., Gottschalk, Y., Koller, M.
Unpublished MSc thesis, 2024/04
Free full text
1041

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text
1042

L'intégration de la thématique du surpoids et de l'obésité en consultation ostéopathique : une étude qualitative phénoménologique
(The integration of the theme of overweight and obesity in osteopathic consultation: a phenomenological qualitative study)
Golay, S., Jordan, S.
Unpublished MSc thesis, 2024/04
Free full text
1043

Quelle est la place de la respiration du·de la patient·e lors d’une consultation ostéopathique chez les ostéopathes pratiquant en Suisse : une étude qualitative phénoménologique
(What is the place of the patient's breathing during an osteopathic consultation among osteopaths practicing in Switzerland: a phenomenological qualitative study?)
Gremaud, L., Guggisberg, F., Marti, J., Morisetti, L.
Unpublished MSc thesis, 2024/04
Free full text
1044

Quel raisonnement clinique adoptent les ostéopathes travaillant en Suisse romande pour le traitement des patient·e·s consultant pour un motif de céphalées ? : une étude qualitative
(What clinical reasoning do osteopaths working in French-speaking Switzerland adopt for the treatment of patients consulting for a reason of headache? A qualitative study)
Rey, S., Caviglioli, M.
Unpublished MSc thesis, 2024/04
Free full text
1045

Que signifie l’infertilité pour les ostéopathes suisses et quelle est l’importance de la fertilité dans leur pratique ostéopathique?
(What does infertility mean to Swiss osteopaths, and how important is fertility to their osteopathic practice?)
Schär, S., Sarlandie, M.
Unpublished MSc thesis, 2024/04
Free full text
1046

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text
1047

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text
1048

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03
1049

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
1050

Osteopathic management of non-specific neck pain: Preliminary findings from a cross sectional study of Australian osteopaths
Fleischmann, M., McLaughlin, P., Vaughan, B., Hayes, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
1051

Perceptions of Australian osteopaths on the use of telehealth for patient care: Barriers and enablers for implementation
Grace, S., Engel, R., Mastronardo, C., Muddle, L., Fleischmann, M., Vaughan, B., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
1052

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03
1053

Fluid professional boundaries: ethnographic observations of co-located chiropractors, osteopaths and physiotherapists
Toloui-Wallace, J., Forbes, R., Thomson, O. P., Costa, N.
BMC Health Services Research, 2024/03
Free full text
1054

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
1055

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
1056

Osteopathic correction in complex rehabilitation of children who have undergone cochlear implantation
(Остеопатическая коррекция в комплексной реабилитации детей, перенесших кохлеарную имплантацию)
Belash, V. O., Revina, M. B.
Russian Osteopathic Journal, 2024/03
Free full text
1057

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
1058

Osteopathic correction in the complex therapy of children with astigmatism
(Остеопатическая коррекция в комплексной терапии детей с астигматизмом)
Kiryanova, E. V., Gurichev, A. A.
Russian Osteopathic Journal, 2024/03
1059

Rehabilitation after severe gaff disease
(Реабилитация после тяжелого течения гаффской болезни)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03
1060

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
Free full text
1061

The Use of Osteopathic Manipulative Treatment for a Case of Cervical Radiculopathy
Heineman, K.
The AAO Journal, 2024/03
Free full text
1062

The effect of complex treatment including osteopathic correction on pain intensity and quality of life in patients with chronic tonsillitis
(Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом)
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
1063

Arctic Medicine
Katrine, B.
The AAO Journal, 2024/03
Free full text
1064

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
Free full text
1065

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
1066

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03
1067

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
1068

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
1069

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
1070

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
1071

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
1072

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
1073

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
1074

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03
1075

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text
1076

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
1077

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03
1078

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text
1079

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
1080

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text
1081

Neurofisiologia, interazioni neuro-immunitarie e meccanobiologia nell’osteopatia craniale. Una prospettiva basata sull’evidenza per un razionale scientifico
Casini, A., Barsotti, N., Chiera, M., Lunghi, C., Fornari, M., Lanaro, D.
PNEI REVIEW, 2024/03
1082

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text
1083

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03
1084

Utility of Osteopathic Manipulation Treatment in MTBI Patients With PPCS and Cervicogenic & Vestibuloocular Profiles
Chen, A., Gross, A., Marshall, J., Anilkumar, A., Patel, N., Maes, L., Mulumba, D., Dusenberry, B.
Clinical Journal of Sport Medicine, 2024/03
1085

Investigation of Immediate Effects of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S., Matthias, A., Roush, A., Wilson, H., Nicholas, J., Edwards, C., Mangum, K., Pickett, B.
Clinical Journal of Sport Medicine, 2024/03
1086

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03
1087

Effect of Osteopathic Manipulation in an Autism Spectrum Child With Speech Impairment and Attention Deficit: A Case Report
Sharath, H. V., Raghuveer, R., Qureshi, M. I., Warghat, P. A., Desai, S., Brahmane, N. A.
Cureus, 2024/03
Free full text
1088

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03
1089

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03
1090

Efectividad del abordaje osteopático en pacientes con fibromialgia
(Effectiveness of osteopathic treatment in patients with fibromyalgia)
García Ruiz, P.
European Journal Osteopathy & Related Clinical Research, 2024/03
Free full text
1091

Eficacia del tratamiento visceral osteopático en riñón y colon sobre el dolor y la sensibilización lumbar
(Effectiveness of visceral osteopathic treatment on the kidney and colon on lumbar pain and sensitivity)
Rodríguez de Cote, J.
European Journal Osteopathy & Related Clinical Research, 2024/03
Free full text
1092

Eficacia de las técnicas de osteopatía en la dismenorrea
(Effectiveness of osteopathic techniques in dysmenorrhea)
Romero Rodríguez, T., Ruiz Martínez, A., Fernández Villamarín, E.
European Journal Osteopathy & Related Clinical Research, 2024/03
1093

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
1094

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
Free full text
1095

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text
1096

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text
1097

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text
1098

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
1099

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
1100

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
1101

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text
1102

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02
1103

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
1104

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
1105

Osteopathic Approach in the Stimulation of the Endocannabinoid System: A Case Report
Buonomini, C., Bonetti, O., Novelli, E.
Cureus, 2024/02
1106

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text
1107

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2024/02
Free full text
1108

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
1109

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
1110

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02
1111

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
1112

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
1113

Clinical Effectiveness of Craniosacral Therapy in Patients with Headache Disorders: A Systematic Review and Meta-analysis
Carrasco-Uribarren, A., Mamud-Meroni, L., Tarcaya, G. E., Jiménez-Del-Barrio, S., Cabanillas-Barea, S., Ceballos-Laita, L.
Pain Management Nursing, 2024/02
1114

Interdisciplinary Approach to Orthodontic Treatment Involving an Osteopath and a Dentist (Protocol)
Aptekar, I. A., Abramova, E. V., Postnikov, M. A., Kopetsky, I. S., Eremin, D. A., Postnikova, E. M., Poluianova, E. B., Aptekar, V. I., Muravyov, I. O.
Bulletin of Russian State Medical University, 2024/02
Free full text
1115

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
1116

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text
1117

Neurosurgery Clerkships in United States Medical Schools: A Survey of Doctor of Medicine–Granting and Doctor of Osteopathic Medicine–Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2024/01
1118

Zwischen Evidenz und individueller klinischer Expertise – ein Vergleich der Konzeption der Evidenzbasierten Medizin und den Anliegen der Osteopathie
(Between evidence and individual clinical expertise – a comparison of the concept of evidence-based medicine and the concerns of osteopathy)
Stierl, J. A.
unpublished MSc thesis, 2024/01
1119

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text
1120

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
1121

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
1122

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
1123

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
1124

Das Kniegelenk
(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
1125

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
1126

Characteristics, Opportunities, and Challenges of Osteopathy Based on the Perceptions of Osteopaths in Austria: Qualitative Interview Study
Manschel, J., Porthun, J., Winkler, U., Beuckels, J. M., Martin, D.
JMIR Human Factors, 2024/01
Free full text
1127

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
1128

Peut-on protocoliser l’ostéopathie? Doit-on toujours manipuler L5 en cas de sciatalgie type L5?
(Could Osteopathy Be Protocolized? Should We always Manipulate L5 in Case of L5 Sciatica?)
Bœuf, M., Brun, L.
Douleur et Analgesie, 2024/01
1129

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2024/01
1130

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12
1131

Impact of the COVID-19 Pandemic on First Year Medical Students at the West Virginia School of Osteopathic Medicine
Towne, D., Easler, J., Eleazar, C.
Journal of Osteopathic Medicine, 2023/12
1132

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
1133

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
1134

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
1135

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
1136

Long-/Post-Covid-Syndrom: Studienergebnisse zur therapeutischen Erfahrung von Osteopath*innen in Deutschland
(Long-/Post-Covid syndrome: Study results on the therapeutic experience of osteopaths in Germany)
Plathner, M.
Osteopathische Medizin, 2023/12
1137

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text
1138

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12
1139

Views from Australian osteopaths and industry stakeholders about the profession: A qualitative study
Mastronardo, C., Muddle, L., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2023/12
1140

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
1141

Letter to the Editor regarding: Thomson OP, and MacMillan A. What’s wrong with osteopathy?
Noy, M.
International Journal of Osteopathic Medicine, 2023/12
1142

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
1143

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
1144

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12
1145

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
1146

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12
1147

Application of craniosacral therapy in practice
Wójcik, M., Placek, K., Bordoni, B.
Polish Journal of Physiotherapy, 2023/12
1148

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12
1149

Evaluation of effectiveness of osteopathic visceral manipulation in patients with chronic mechanical low back pain: A multi-center, single-blind, randomized-controlled study
Altınbilek, T., Murat, S., Yıldırım, E., Filiz, B., Ünlü, S., Terzi, R.
Turkish Journal of Physical Medicine and Rehabilitation, 2023/12
Free full text
1150

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
1151

The use of osteopathic correction in the treatment of patients with sciatic neuropathy
(Применение остеопатической коррекции в терапии пациентов с седалищной нейропатией)
Belash, V. O., Frolov, V. A.
Russian Osteopathic Journal, 2023/12
Free full text
1152

The effect of general osteopathic treatment on muscle tone according to electromyography data
(Влияние общего остеопатического лечения на тонус мышц по данным электромиографии)
Cherednikova, N. V., Zhang, V. F., Potekhina, Y. P., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/12
Free full text
1153

Satisfaction and readiness for professional activity of students of the Institute of Osteopathy (Saint-Petersburg): a study using the DREEM questionnaire
(Удовлетворенность и готовность к профессиональной деятельности слушателей Института остеопатии (Санкт-Петербург): изучение с использованием опросника DREEM)
Filenko, A. B., Tregubova, E. S.
Russian Osteopathic Journal, 2023/12
Free full text
1154

The possibility of reversibility of liver fibrosis under the influence of complex treatment
(Возможность обратимости фиброза печени под влиянием комплексного лечения)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
Free full text
1155

Osteopathic Manipulative Treatment to Treat Patients with Long-Haul COVID Loss of Smell and Taste: A Report of Four Cases
Berkowitz, M. R.
The AAO Journal, 2023/12
Free full text
1156

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
Free full text
1157

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text
1158

‘More harm than good’ – A qualitative study exploring the attitudes and beliefs of a group of Italian osteopaths about spinal imaging in the management of patients with chronic low back pain
Ogliari, L., Formica, A., Bettelli, L.
International Journal of Osteopathic Medicine, 2023/12
1159

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text
1160

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text
1161

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
1162

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text
1163

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12
1164

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text
1165

Osteopathy Referrals to and from General Practitioners: Secondary Analysis of Practitioner Characteristics from an Australian Practice-Based Research Network
Vaughan, B., Fleischmann, M., Grace, S., Engel, R., Fitzgerald, K., Steel, A., Peng, W., Adams, J.
Healthcare, 2023/12
Free full text
1166

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
1167

Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
1168

The effectiveness of disinfection protocols in osteopathic family medicine offices
Phyu, R., Patrizio, H. A., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
Free full text
1169

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/12
Free full text
1170

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text
1171

The Influence of Osteopathic Manipulative Treatment (OMT) on Cognitive Performance and Recovery Following a Sport-Related Concussion
Bennett, R., Peart, Z., Brett, J., Posey, A.
Journal of Osteopathic Medicine, 2023/12
1172

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
1173

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12
1174

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12
1175

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12
1176

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
1177

National Prevalence and Quality of Medical Spanish Education in US Osteopathic Medical Schools: An Approach to Improve Health Equity
Dey, K. A., Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2023/12
1178

Social congruence between Osteopathic medical students and figures of support at NYIT College of Osteopathic Medicine
Doty, J. E., Thompson, N. E.
Journal of Osteopathic Medicine, 2023/12
1179

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12
1180

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12
1181

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12
1182

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12
1183

Effectiveness of Osteopathic Tenet Integration into Basic Science Learning Objectives Using Generative Artificial Intelligence
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2023/12
1184

Cranial Osteopathic Manipulation Alters Alzheimer’s Disease Phenotype in Wild Type and Transgenic Rats
Hines, D. Y., Tobey, H., Kwaspisz, L., Ingram, A., Duggan, P., Boehringer, S., Piwowarski, J., Ramanathan, A., Anandakrishnan, R.
Journal of Osteopathic Medicine, 2023/12
1185

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
1186

Osteopathic Cranial Manipulation and its Possible Application in Managing Hypertension for the Optimization of Care
Jackson, S., Chung, T. C., Arellano, A., Keane, J. F., Goldstein, L. B.
Journal of Osteopathic Medicine, 2023/12
1187

Making sense of cranial osteopathy: An interpretative phenomenological analysis
Banton, A., Vogel, S., Lee-Treweek, G.
International Journal of Osteopathic Medicine, 2023/12
Free full text
1188

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12
1189

Differences in Learning Approach and Resource Utilization Between First- and Second-Year Osteopathic Medical Students
Jose, R. M., Goldstein, L.
Journal of Osteopathic Medicine, 2023/12
1190

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/12
1191

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12
1192

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
1193

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
1194

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
1195

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
1196

Factors contributing to or impeding the development of OPP knowledge and skills among COM students – A Cross-Sectional Survey
Roberts, T., Wardle, M., Pryor, J.
Journal of Osteopathic Medicine, 2023/12
1197

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
1198

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12
1199

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12
1200

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12