Advanced search



 
 82.7% of the records
 
 17.3 % of the records
 
 55.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabducens nerveabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic surgeryacademies and institutesacademy of osteopathyaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadmissionadmission criteriaadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective empathyaffective touchafferenceAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltingAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory test foilartifical intelligenceartificial jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawards and prizesawarenessawareness of spaceaxesaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberinebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumabladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood supplyblood systemblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac frequencycardiac implantable electronic devicecardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase reportcase reportscase seriescase studycase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicothoracic diaphragmcervicothoracic junctioncesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wall defectchewingChiari I malformationChicagoChicago College of Osteopathic Medicinechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communitychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclavicleclavicle fractureCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoituscold temperaturecoliccolitis ulcerosacollaborationcollagencollagen fiberscollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal endometriosisCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phasecongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontol interventionscontraceptive carecontract governing medical treatmentcontractilitycontractioncontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapycooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilitycostal cartilagescostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniquecybernetic systemcyberneticscynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. HerbertD. J. ClauwD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational resourceeducational standardseducational statuseducational technologyeducational toolsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselbowelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyempirical approachempirical evidenceempirical researchempiricismemployee disciplineemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequilibriumeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitionexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitationfactfactor analysisfactual databasesfacultyfaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyfast fourier transformfastingfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexion distraction techniqueflexion rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot lesionsfoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionfracture healingfracturesFraminghamFranceFrankfurt DeclarationFred Mitchellfree energy principlefree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principlefulcrumfull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingivitisgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteus maximusglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand painhand strengthhandballhandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity, low-amplitudeHigher educationhiphip arthroplastyhip dislocationhip dysplasiahip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axishrvHTA-Report 124humanhuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourhurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronic acidhydrationhydraulic mechanismhydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogonadismhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimpotenceimpotence medicineimpulsein vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationInfrared thermal camerainfrared thermographyinfraspinatusinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternationalityinternetinternet useinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejoyful discoursejudgmentjugular compressionjumpingjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabral tearlacerationslack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislarynxLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture seriesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevel of evidencelevels of anxiety and depressionLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylorazepamlordosislordotic angleloss of a childloss of childlovelow anorectal malformationlow backlow back injurylow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. Wyvekensmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical graduatesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmelancholic wholenessmelanomaMelicien TettambelmembranesmemorymenMeniere’s diseasemeningesmeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20mfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studymobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tendernessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropyNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsnephroptosisnerve activitynerve compressionnerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroinflammationneurokinesiologyneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular junctionneuromuscular rehabilitationneuromuscular systemneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstetic populationobstetric deliveryobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan of perceptionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic manipulationorthopedic proceduresorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. KimberlyP. MisslinP. Schwindpad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackspanic disorderspapillomavirus infectionspapillomavirus vaccinesparaesophageal herniaparafunctionparallel accreditationparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalguspharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromeposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencypovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepreserved ejection fraction exacerbationspressurepressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapyPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseasesrespiratory disordersrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumeresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroutine examinationroutine findingsroutine physical therapyrowingrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. Typaldossacral basesacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsscalesscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific proofscientific publicationscientific researchscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshared decision makingsharing informationsharp painshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-effectsidebendingSIDSsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin blood flow indexskin burning sensationskin cancerskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmokerssmokingsmoking cessationsmoking preventionsmooth musclesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessolar keratosissoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech developmentspeech development disordersspeech disorderspeech disordersspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stephen Tyremanstereoidssterilitysternal painsternal recoil techniquesternotomiesternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismstrabismusStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniqueStretchingstretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsStudents, Pharmacystudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhageSubject Headingssubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointSubtle energy measurementsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicidesumatriptanSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessuprarenal gland,supraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurveysSurveys and Questionnairessurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationSynergeticsynostosis sphenooccipitalis,synovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetastwelttattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBI careteachersteachingteaching assistantteaching clinicteaching effectivenessteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteamUP Short-FormteamUP-SFteamworktechnical requirementsTechniquetechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendonitistendonstenetstennistennis elbowtenotomytensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?TGF-?Thai foot reflex zone massagethai massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical basistheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelsTherapeutic presencetherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal, skin temperaturethermodiagnosisthermographythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree months colicthree-dimensional imagingthree-dimensional printingthroacic transverse processesthroatthrombolytic therapythrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticksticstideTietze syndromeTiffeneau indextilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?TNF-atnterpretation analysis comparative studiestobacco use disordertoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttranscranial Doppler ultrasonographytranscranial magnetic stimulationtransdisciplinarytransferencetransformation phasestransgendertransgender personstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretrauma-informes caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerstrimesters of pregnancytrinitytrisomy 21triunetriune mantriune osteopathytriunity Routine-diagnosistroponin itroubles musculo-squelettiquestruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttruthtruth disclosuretryptaminestuba auditiva techniqueTug navicular techniquetumortumor necrosis factortumor necrosis factor-alphatunnel syndrometurbttutoringtwin pregnancytwinstympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderservedunderserved areaunderserved areasunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionUnified Parkinson Disease Rating Scaleunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beingUniversitiesuniversityuniversity outpatient departmentsunna nevusunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresUSMLE Step 1usmle step 2uterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvaliditityvalidityvalidity of testsvalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverificationVermontvertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcarewestern worldWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwoman?s organismwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopworld health organisationWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

5184 results (please see below)  Sort:    
1

Strategies to prevent and manage running-related knee injuries: A systematic review of randomised controlled trials
Alexander, J., Johnston, R., Ezzat, A., Culvenor, A., Barton, C.
Journal of Science and Medicine in Sport, Nov 2022 2022-11-02
2

Syndrome des releveurs de l’anus, troubles fonctionnels intestinaux et anomalies articulaires du petit bassin, place du traitement ostéopathiqueLevator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment
(Levator ani syndrome, functional intestinal disorders and articular abnormalities of the pelvis, the place of osteopathic treatment)
Riot, F. M., Goudet, P., Mouraux, J. P., Cougard, P.
La Presse Medicale, Jul 31
3

ОСТЕОПАТИЯ КАК ИННОВАЦИОННЫЙ ВЕКТОР В ВОССТАНОВИТЕЛЬНОЙ И СПОРТИВНОЙ МЕДИЦИНЕ
Osteopathy as an innovative Approach to Rehabilitation and Sports Medicine
Vovkogon, A., Sankova, M., Nikolenko, V., Oganesyan, M., Gridin, L.
Human Sport Medicine, 23/08
Free full text
4

Osteopathic Manipulative Treatment During Post-operative Recovery: A Scoping Review
Randall, C. G., Paul, H. A., Lumley, H., Ortega, A., Rowley, J., Brown, B., Mohan, S., Smith, K., Messer, T., Swan, E., Mehra, R. S.
Cureus, 2024/2
Free full text
5

Post-operative osteopathic manipulative treatment of Morel-Lavallee syndrome assessed using infrared thermal imaging: A case report
Maillot, C., Riquet, D., Stubbe, L., Bodnar, J.L., Houel, N.
Journal of Bodywork and Movement Therapies, 2024/07
Free full text
6

A 25-year-old woman with 7 years of intractable hiccups treated with OMT – A case report
Bowman, D. E., Pohlod, C.
International Journal of Osteopathic Medicine, 2024/06
7

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06
8

Responsiveness to osteopathic manipulative treatments in people with non-specific low back pain: A secondary analysis of the LC-OSTEO trial
Rören, A., Yagappa, D. M., Zegarra-Parodi, R., Fabre, L., Krief, G., Daste, C., Lefèvre-Colau, M. M., Rannou, F., Nguyen, C.
Annals of Physical and Rehabilitation Medicine, 2024/06
9

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04
10

Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study
Sankova, Maria V., Nikolenko, Vladimir N., Vovkogon, Andjela D., Oganesyan, Marine V., Trishina, Aleksandra, Babarzai, Lema, Antonyan, Sevak Zh, Babarzai, Faraidun, Pontes-Silva, André, Zharikov, Yury O.
Manuelle Medizin, 2024/04
11

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text
12

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03
13

A framework for the interpretation of heart rate variability applied to transcutaneous auricular vagus nerve stimulation and osteopathic manipulation
Kania, A., Roufail, J., Prokop, J., Stauss, H. M.
Physiological Reports, 2024/03
Free full text
14

Osteopathic management of non-specific neck pain: Preliminary findings from a cross sectional study of Australian osteopaths
Fleischmann, M., McLaughlin, P., Vaughan, B., Hayes, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
15

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/03
Free full text
16

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/03
Free full text
17

Perceptions of Australian osteopaths on the use of telehealth for patient care: Barriers and enablers for implementation
Grace, S., Engel, R., Mastronardo, C., Muddle, L., Fleischmann, M., Vaughan, B., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2024/03
Free full text
18

The short- and long-term effect of osteopathic manipulative treatment on pain, and psychosocial factors in adults with chronic low back pain
Nicodemus, C. L., Epstein, J., Huebner, M., DeCicco, B., Shaik, M.
Journal of Osteopathic Medicine, 2024/03
Free full text
19

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03
20

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03
21

What is wrong with osteopathy? A response to Thomson and MacMillan
Nicholls, D. A.
International Journal of Osteopathic Medicine, 2024/03
22

Fluid professional boundaries: ethnographic observations of co-located chiropractors, osteopaths and physiotherapists
Toloui-Wallace, J., Forbes, R., Thomson, O. P., Costa, N.
BMC Health Services Research, 2024/03
Free full text
23

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03
24

Examining differences in trends in the orthopedic surgery match for osteopathic and allopathic medical graduates after the transition to single accreditation
Wood, R. S., Krumrey, J.
Journal of Osteopathic Medicine, 2024/03
25

Saying it doesn't make it so - a reply to Espírito Santo et al
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2024/03
26

Остеопатическая коррекция в комплексной реабилитации детей, перенесших кохлеарную имплантацию
(Osteopathic correction in complex rehabilitation of children who have undergone cochlear implantation)
Belash, V. O., Revina, M. B.
Russian Osteopathic Journal, 2024/03
27

The effectiveness of manipulation in combination with exercise for patients with coccydynia: Six months follow-up of a randomized controlled trial
Tufekci, O., Yilmaz, K., Gercek, H., Unuvar, B. S.
International Journal of Osteopathic Medicine, 2024/03
28

Остеопатическая коррекция в комплексной терапии детей с астигматизмом
(Osteopathic correction in the complex therapy of children with astigmatism)
Kiryanova, E. V., Gurichev, A. A.
Russian Osteopathic Journal, 2024/03
29

Реабилитация после тяжелого течения гаффской болезни
(Rehabilitation after severe gaff disease)
Lebedeva, D. I., Turovinina, E. F., Marchenko, A. N., Aptekar, I. A., Raspopova, Y. I., Suvorov, A. Y., Bychenko, S. M.
Russian Osteopathic Journal, 2024/03
30

Osteopathic Approach to a Patient with Recurring Low Back Pain following OMT results in Diagnosis of Underlying Gynecological Etiology: A Case Report
Berkowitz, M. R.
The AAO Journal, 2024/03
31

The Use of Osteopathic Manipulative Treatment for a Case of Cervical Radiculopathy
Heineman, K.
The AAO Journal, 2024/03
32

Влияние комплексного лечения с включением остеопатической коррекции на интенсивность боли и качество жизни пациентов с хроническим тонзиллитом
Vedyashkina, A. S., Mokhov, D. E., Bezrukova, E. V., Artyushkin, S. A.
Russian Osteopathic Journal, 2024/03
33

An osteopathic approach for a patient with sequela after treatment for a cheek squamous cell carcinoma
Wehner, B. L., Calla, R.
The AAO Journal, 2024/03
34

The Effects of Patient-specific Sequenced Osteopathic Manipulative Treatment by AGR on Quality of Life
Yang, Y., Stiles, E., Kingery, J.
The AAO Journal, 2024/03
35

Osteopathic techniques and manual rotation of the fetal head successfully resolve mechanical dystocia
Miletić, A. I., Habek, D., Medić, F.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/03
36

Effects of a novel osteopathic visceral technique for the pancreas on pain and range of motion in a patient with neck pain: Case report
Faria, M. A. F.
Journal of Bodywork and Movement Therapies, 2024/03
37

Fallbericht einer psychosomatischen Osteopathie
(Case report of psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2024/03
Free full text
38

Osteopathische Behandlungsmöglichkeiten chronisch entzündlicher Darmerkrankungen: Eine qualitative Analyse von Interviews
(Osteopathic treatment options for chronic inflammatory bowel disease: A qualitative analysis of interviews)
Pestonit, J. F., Hesse, T.
Osteopathische Medizin, 2024/03
Free full text
39

Osteopathisch-manipulative Behandlung bei herzchirurgischen Patient*innen: Eine systematische Übersicht
(Osteopathic-manipulative treatment in cardiac surgery patients: A systematic review)
Rorris, F.P., Skouteli, E.A. T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
Osteopathische Medizin, 2024/03
Free full text
40

Osteopathie und evidenzbasierte Medizin, Teil 2: Kritik an der EBM
(Osteopathy and evidence-based medicine, part 2: Criticism of EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
41

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
42

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
43

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03
44

A Survey Assessment of Neurosurgeons’ Interest in Osteopathic Medicine and Its Integration Into Their Practice.
Kolmetzky, D W, Gooder, D B, Polly, E S, Glisan, S. N., Al-Atrache, Z., Badger, C. A., Yocom, S. S., Turtz, A. R., Allison, D. L.
Cureus, 2024/03
45

Osteopathic manipulative treatment for pediatric Long-COVID headache: A case report
Danto, S. E., Danto, J. B.
International Journal of Osteopathic Medicine, 2024/03
46

Meta-epidemiologic review: Blinding and sham treatment in clinical trial design for osteopathic manipulative treatment research
Irving, R., Schmidt, E., Stone, M., Fleming, R. K., Xie, J. Y.
International Journal of Osteopathic Medicine, 2024/03
47

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03
48

Osteopathic manipulative treatment for autism spectrum disorder: Three case reports
Wolf, K., Widjaja, F., O'Keefe, W., Chen, Y., Breard, M., Parenteau, C., Keys, J., Riemer, R., Hendren, R. L.
International Journal of Osteopathic Medicine, 2024/03
49

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03
50

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03
51

How do Australian osteopaths manage migraines? Outcomes from a national practice-based research network
Fleischmann, M., Vaughan, B., Campbell, C., Ekberg, J., Evans, M., Green, M., Ong, A., Pitrone, G., Lane, R., Adams, J.
Journal of Bodywork and Movement Therapies, 2024/03
52

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text
53

Potential mechanisms for osteopathic manipulative treatment to alleviate migraine-like pain in female rats
Byrd, K., Lund, M., Pan, Y., Chung, B. H., Child, K., Fowler, D., Burns-Martin, J., Sanikommu, M., Henderson, H., Gregory, C., Fleming, R. K., Xie, J. Y.
Frontiers in Pain Research, 2024/02
Free full text
54

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text
55

Osteopathic approach as an additional therapy of infertility in women with PCOS
Jędrzejczyk, S., Szafarowska, M., Rosiński, M., Segiet-Święcicka, A., Jerzak, M., Jerzak, M.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2024/02
56

Osteopathic Manipulative Treatment for Chronic Neck Stiffness After a Motor Vehicle Collision: A Case Report
Jost, J. M., Stoll, V. K., Waters, H. B.
Cureus, 2024/02
Free full text
57

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/02
58

Effectiveness of osteopathic manipulative applications on hypothalamic-pituitary-adrenal (HPA) axis in youth with major depressive disorder: a randomized double-blind, placebo-controlled trial
Pala, Ö. O., Çıtaker, S., Güney, E., Sepici, A., Güveli, G. M., Arslan, B., Gürü, M.
Journal of Osteopathic Medicine, 2024/02
Free full text
59

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text
60

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text
61

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/02
62

New Zealand osteopaths’ use of patient-reported outcome measures with patients who have chronic low back pain: A cross-sectional survey
Vallyon, E., Aminian, S., Heath, S.
International Journal of Osteopathic Medicine, 2024/02
63

The endogenous oxytocin after manipulative osteopathic treatment in full-term pregnant women
Ragusa, A., Svelato, A., Fogolari, M., Ficarola, F., Plotti, F., De Luca, C., D'Avino, S., Davini, F., De Cesaris, M., Messina, G., Bertolini, A., Marci, R., Angeletti, S., Angioli, R., Terranova, C.
European Review for Medical and Pharmacological Sciences, 2024/02
64

Application Of Osteopathic Treatment for Non-Pain–Related Discomforts of Pregnancy: A Literature Review
Gomperts, J., Carroll, L., Powers, B., Rodriguez, A.
Osteopathic Family Physician, 2024/02
65

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02
66

Osteopathic Approach in the Stimulation of the Endocannabinoid System: A Case Report
Buonomini, C., Bonetti, O., Novelli, E.
Cureus, 2024/02
67

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text
68

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text
69

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text
70

Efficacy of manual therapy for sacroiliac joint pain syndrome: a systematic review and meta-analysis of randomized controlled trials
Trager, R. J., Baumann, A. N., Rogers, H., Tidd, J., Orellana, K., Preston, G., Baldwin, K.
Journal of Manual & Manipulative Therapy, 2024/02
71

A Narrative Review on the Viability of Osteopathic Manipulative Medicine in Treating Irritable Bowel Syndrome With Constipation (IBS-C)
Basra, M., Patel, H., Stern-Harbutte, A., Lee, D., Gregg, R. K., Waters, H. B., Potter, A. K.
Cureus, 2024/02
Free full text
72

Osteopathic Manipulative Treatment in Dysmenorrhea: A Systematic Review
Bonner, P. E., Paul, H. A., Mehra, R. S.
Cureus, 2024/01
Free full text
73

Neurosurgery Clerkships in United States Medical Schools: A Survey of Doctor of Medicine–Granting and Doctor of Osteopathic Medicine–Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2024/01
74

Wie wirksam ist die osteopathische Behandlung von Kindern?
(How effective is osteopathic treatment for children?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
75

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
76

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
77

Osteopathie und evidenzbasierte Medizin, Teil 1: die EBM
(Osteopathy and evidence-based medicine, part 1: EBM)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
78

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01
79

Does regular attendance in supplemental virtual near-peer tutoring in anatomy laboratory content improve anatomy performance for medical students?
Doty, J. E., Thompson, N. E.
Anatomical Sciences Education, 2024/01
80

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text
81

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/01
Free full text
82

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic low back pain: a single-blinded randomized controlled trial
Popovich, J. M., Cholewicki, J., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan, A.
Journal of Osteopathic Medicine, 2024/01
Free full text
83

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/01
84

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/01
Free full text
85

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/01
Free full text
86

Characteristics, Opportunities, and Challenges of Osteopathy Based on the Perceptions of Osteopaths in Austria: Qualitative Interview Study
Manschel, J., Porthun, J., Winkler, U., Beuckels, J. M., Martin, D.
JMIR Human Factors, 2024/01
Free full text
87

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/01
Free full text
88

Integrating Osteopathic Principles for Enhanced Dermatological Outcomes: A Literature Review
Ventura, N., Soti, V.
Cureus, 2024/01
Free full text
89

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12
90

Impact of the COVID-19 Pandemic on First Year Medical Students at the West Virginia School of Osteopathic Medicine
Towne, D., Easler, J., Eleazar, C.
Journal of Osteopathic Medicine, 2023/12
91

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12
92

Assessment of Long-term Effects of Adding Osteopathic Manipulative Treatment to Neck Exercises for Individuals With Non-specific Chronic Neck Pain: A Randomized Trial
Groisman, S., da Silva, L., Sanches, T., Rocha, C., Malysz, T., Jotz, G.
Journal of Chiropractic Medicine, 2023/12
93

„Alles im Griff” – Osteopathischer Universalgriff für das Kniegelenk
(“Everything under control“ - Osteopathic universal grip for the knee joint)
Engel, M.
Osteopathische Medizin, 2023/12
94

Osteopathie als Beruf: Zur Praxeologie des osteopathischen Handelns
(Osteopathy as a profession: The praxeology of osteopathic practice)
Kaiser, A. K.
Osteopathische Medizin, 2023/12
95

Long-/Post-Covid-Syndrom: Studienergebnisse zur therapeutischen Erfahrung von Osteopath*innen in Deutschland
(Long-/Post-Covid syndrome: Study results on the therapeutic experience of osteopaths in Germany)
Plathner, M.
Osteopathische Medizin, 2023/12
96

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text
97

Letter to the Editor: Underlining there is nothing wrong with osteopathy
Espírito Santo, J., Moita, J., Campos, B., Nunes, A.
International Journal of Osteopathic Medicine, 2023/12
98

Views from Australian osteopaths and industry stakeholders about the profession: A qualitative study
Mastronardo, C., Muddle, L., Fazalbhoy, A.
International Journal of Osteopathic Medicine, 2023/12
99

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
100

Letter to the Editor regarding: Thomson OP, and MacMillan A. What’s wrong with osteopathy?
Noy, M.
International Journal of Osteopathic Medicine, 2023/12
101

‘More harm than good’ – A qualitative study exploring the attitudes and beliefs of a group of Italian osteopaths about spinal imaging in the management of patients with chronic low back pain
Ogliari, L., Formica, A., Bettelli, L.
International Journal of Osteopathic Medicine, 2023/12
102

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
103

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12
104

Investigating the current published literature where osteopathic manual therapy is used as an intervention: A scoping review
Ryan, H., Friedlander, T., Anderson, H., Mason, J.
International Journal of Osteopathic Medicine, 2023/12
105

Letter o the Editor: Is there really nothing wrong with osteopathy? A reply to van Dun
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12
106

Letter to the Editor: There is nothing wrong with osteopathy
van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/12
107

Application of craniosacral therapy in practice
Wójcik, M., Placek, K., Bordoni, B.
Polish Journal of Physiotherapy, 2023/12
108

Osteopathic Manipulative Treatment for Chronic Bronchiectasis: A Case Report
Abend, D., Powell, L., Sivanandam, A., Nayar, R.
Osteopathic Family Physician, 2023/12
109

Evaluation of effectiveness of osteopathic visceral manipulation in patients with chronic mechanical low back pain: A multi-center, single-blind, randomized-controlled study
Altınbilek, T., Murat, S., Yıldırım, E., Filiz, B., Ünlü, S., Terzi, R.
Turkish Journal of Physical Medicine and Rehabilitation, 2023/12
110

Effect of osteopathic manipulative treatment and Bio-Electro-Magnetic Energy Regulation (BEMER) therapy on generalized musculoskeletal neck pain in adults
Palmer, G. M., Dominick, N., Kane, M., Bawek, S., Burch, B., Sanders, T., Phrathep, D., Myers, N., Lorenzo, S.
Journal of Osteopathic Medicine, 2023/12
Free full text
111

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2023/12
Free full text
112

An Osteopathic Approach to Urinary Incontinence Including Biopsychosocial Aspects and Multiple Modalities for a Holistic Approach to Optimize Ongoing Care
Trivelas, N., Slaughter, K., Zaremski, K., Kirila, C.
Osteopathic Family Physician, 2023/12
113

Применение остеопатической коррекции в терапии пациентов с седалищной нейропатией
(The use of osteopathic correction in the treatment of patients with sciatic neuropathy)
Belash, V. O., Frolov, V. A.
Russian Osteopathic Journal, 2023/12
114

Влияние общего остеопатического лечения на тонус мышц по данным электромиографии
(The effect of general osteopathic treatment on muscle tone according to electromyography data)
Cherednikova, N. V., Zhang, V. F., Potekhina, Y. P., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/12
115

Удовлетворенность и готовность к профессиональной деятельности слушателей Института остеопатии (Санкт-Петербург): изучение с использованием опросника DREEM
(Satisfaction and readiness for professional activity of students of the Institute of Osteopathy (Saint-Petersburg): a study using the DREEM questionnaire)
Filenko, A. B., Tregubova, E. S.
Russian Osteopathic Journal, 2023/12
116

Возможность обратимости фиброза печени под влиянием комплексного лечения
(The possibility of reversibility of liver fibrosis under the influence of complex treatment)
Kozhokina, S. G.
Russian Osteopathic Journal, 2023/12
117

Osteopathic Manipulative Treatment to Treat Patients with Long-Haul COVID Loss of Smell and Taste: A Report of Four Cases
Berkowitz, M. R.
The AAO Journal, 2023/12
118

Osteopathic Manipulative Treatment for the Management of Irritable Bowel Syndrome: A Case Report
Heineman, K.
The AAO Journal, 2023/12
119

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
120

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text
121

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text
122

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12
123

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text
124

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12
125

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text
126

Osteopathy Referrals to and from General Practitioners: Secondary Analysis of Practitioner Characteristics from an Australian Practice-Based Research Network
Vaughan, B., Fleischmann, M., Grace, S., Engel, R., Fitzgerald, K., Steel, A., Peng, W., Adams, J.
Healthcare, 2023/12
Free full text
127

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12
128

The Influence of Osteopathic Manipulative Treatment (OMT) on Cognitive Performance and Recovery Following a Sport-Related Concussion
Bennett, R., Peart, Z., Brett, J., Posey, A.
Journal of Osteopathic Medicine, 2023/12
129

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12
130

Safety and Efficacy of Osteopathic Manipulative Treatment (OMT) in the Pediatric Oncology Inpatient Setting
Brown, A., Hoffman, L., Eyassu, E., Cooke, P., Patel, D., Schroeder, M., Wooten, S., Belsky, J.
Journal of Osteopathic Medicine, 2023/12
131

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12
132

OMT Alleviated Migraine-Like Pain via Blockade of Trigeminal Activation
Child, K., Fowler, D., Pan, Y., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2023/12
133

Retrospective Study of Osteopathic Manipulative Treatment Use for Pain in Patients with Ehlers Danlos Syndromes and Hypermobility Spectrum Disorder (EDS/HSD)
Chung, M. J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
134

National Prevalence and Quality of Medical Spanish Education in US Osteopathic Medical Schools: An Approach to Improve Health Equity
Dey, K. A., Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2023/12
135

Social congruence between Osteopathic medical students and figures of support at NYIT College of Osteopathic Medicine
Doty, J. E., Thompson, N. E.
Journal of Osteopathic Medicine, 2023/12
136

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12
137

Investigation of Osteopathic Manipulation of Spine and Pelvis on Lacrosse Shot Accuracy and Power
Gawrys, S. P., Matthias, A., Roush, A. J., VanderMerwe, D., Starr, E. G., Wong, W. J., Parker, L. M., Nicholas, J. M., Wilson, H.
Journal of Osteopathic Medicine, 2023/12
138

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12
139

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12
140

Effectiveness of Osteopathic Tenet Integration into Basic Science Learning Objectives Using Generative Artificial Intelligence
Harp, E., Hughes, G.
Journal of Osteopathic Medicine, 2023/12
141

Cranial Osteopathic Manipulation Alters Alzheimer’s Disease Phenotype in Wild Type and Transgenic Rats
Hines, D. Y., Tobey, H., Kwaspisz, L., Ingram, A., Duggan, P., Boehringer, S., Piwowarski, J., Ramanathan, A., Anandakrishnan, R.
Journal of Osteopathic Medicine, 2023/12
142

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12
143

Osteopathic Cranial Manipulation and its Possible Application in Managing Hypertension for the Optimization of Care
Jackson, S., Chung, T. C., Arellano, A., Keane, J. F., Goldstein, L. B.
Journal of Osteopathic Medicine, 2023/12
144

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12
145

Differences in Learning Approach and Resource Utilization Between First- and Second-Year Osteopathic Medical Students
Jose, R. M., Goldstein, L.
Journal of Osteopathic Medicine, 2023/12
146

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12
147

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12
148

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12
149

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
150

The Efficacy of Osteopathic Manipulation Treatment (OMT) on Post-Operative Outcomes: An Abstract
Reddy, P., Santhakumar, K.
Journal of Osteopathic Medicine, 2023/12
151

Factors contributing to or impeding the development of OPP knowledge and skills among COM students – A Cross-Sectional Survey
Roberts, T., Wardle, M., Pryor, J.
Journal of Osteopathic Medicine, 2023/12
152

Assessing Correlation Between Manual Dexterity, Specialty Choice and Desire to Practice OMT in Newly Admitted Osteopathic Medical Students
Rome, V., Brolis, N.
Journal of Osteopathic Medicine, 2023/12
153

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12
154

Efficacy of Osteopathic Manipulation Therapy in the Treatment of Post-concussive Versus Primary Migraines
Song, J., Hall, T., Waddington, M.
Journal of Osteopathic Medicine, 2023/12
155

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12
156

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12
157

Osteopathic Manipulative Treatment on Predominantly African American Hospitalized Coronavirus Disease 2019 Patients during Michigan’s First Wave.
Soni, E., Kattan, M., Jackson, N.M., Mainor, I., Corser, W.
MI Medical Education and Health Bulletin, 2023/11
158

Effects of osteopathic manipulative therapy on recurrent pelvic pain and dyspareunia in women after surgery for endometriosis: a retrospective study
Alboni, C., Melegari, S., Camacho Mattos, L., Farulla, A.
Minerva Obstetrics and Gynecology, 2023/11
159

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text
160

Effects of osteopathic manipulative treatment on children with plagiocephaly in the context of current pediatric practice: a retrospective chart review study
King, H. H., Mai, J., Morelli Haskell, M. A., Wolf, K., Sweeney, M.
Journal of Osteopathic Medicine, 2023/11
Free full text
161

Efficacy of pulsed electromagnetic field therapy on pain and physical function in patients with non-specific low back pain: a systematic review
Kull, P., Keilani, M., Remer, F., Crevenna, R.
Wiener Medizinische Wochenschrift, 2023/11
Free full text
162

Transrectal osteopathic manipulation treatment for chronic coccydynia: feasibility, acceptability and patient-oriented outcomes in a quality improvement project
Nourani, B., Norton, D., Kuchera, W., Rabago, D.
Journal of Osteopathic Medicine, 2023/11
Free full text
163

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
164

Neurophysiology, Neuro-Immune Interactions, and Mechanobiology in Osteopathy in the Cranial Field: An Evidence-Informed Perspective for a Scientific Rationale
Barsotti, N., Casini, A., Chiera, M., Lunghi, C., Fornari, M.
Healthcare, 2023/11
Free full text
165

Osteopathic Cranial Manipulative Medicine as a Proposed Addition to the Treatment Regimen for Idiopathic Sudden-Onset Unilateral Sensorineural Hearing Loss: A Case Report
Sina, R. E., Lippert, J., Guardardo, K.
Cureus, 2023/11
Free full text
166

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text
167

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text
168

The Effect of Craniosacral Therapy on Blood Levels of Stress Hormones in Male Firefighter Cadets: A Randomized Clinical Trial
Wójcik, M., Bordoni, B., Siatkowski, I., Żekanowska, E.
Behavioral Sciences, 2023/11
169

The impact of complementary and integrative medicine following traumatic brain injury: A scoping review
Mortera, M., Kim, S., Wen, P.S., Thompson, K., Lundgren, K., Reed, W. R., Sasson, N., Wright, S. T., Vora, A., Krishnan, S., Joseph, J., Heyn, P., Chin, B. S.
Brain Injury, 2023/11
Free full text
170

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11
171

Die Selbsteinschätzung von Intuition und analytischer Erkenntnis in Bezug auf Anamnese und Befund bei österreichischen OsteopathInnen
(Self-assessment of intuition and analytical knowledge in relation to anamnesis and diagnosis of Austrian osteopaths)
Brandstötter, M.
Unpublished MSc thesis, 2023/11
172

Osteopathie bei Spannungskopfschmerzen - Eine systematische Übersichtsarbeit
(Osteopathy for tension-type headache - a systematic review)
Gollonitsch, P.
Unpublished MSc thesis, 2023/11
Free full text
173

Ein systematischer Überblick über die Wirkung der Osteopathie auf die Atemfunktion bei gesunden und kranken Erwachsenen
(A Systematic Review on the Effect of Osteopathic Treatment on Respiratory Function in Healthy and Sick Adults)
Haas, E.
Unpublished MSc thesis, 2023/11
174

Der Einfluss des „general osteopathic treatment“ (GOT) auf das Gangbild, die Funktionalität und posturale Kontrolle von Schlaganfallpatient*innen. Eine randomisierte kontrollierte Pilotstudie
(The influence of “general osteopathic treatment“ (GOT) on gait, functionality and postural control in stroke patients. A randomized controlled pilot study)
Mühlbauer, T.
Unpublished MSc thesis, 2023/11
175

Effekte von Osteopathie auf Migräne
(Effects of osteopathy on migraine)
Pöchlauer-Schneck, J.
Unpublished MSc thesis, 2023/11
176

Wirksamkeit osteopathischer Techniken bei Endometriose
(Efficacy of osteopathic techniques in endometriosis)
Schiche, S.
Unpublished MSc thesis, 2023/11
177

Hat eine auf Körperflüssigkeit und Diaphragmen basierende osteopathische Behandlung in Kombination mit Physiotherapie eine bessere Wirkung auf die gesundheitsbezogene Lebensqualität bei ambulant betreuten MS-PatientInnen als ausschließlich physiotherapeutische Behandlung?
(Does body fluid and diaphragm-based osteopathic treatment combined with physical therapy have a better effect on health-related quality of life in outpatients with MS than physical therapy alone?)
Shikha, K.
Unpublished MSc thesis, 2023/11
178

Welchen Einfluss hat eine osteopathische Behandlung auf Stress?
(What is the impact of osteopathic treatment on stress?)
Soika, V.
Unpublished MSc thesis, 2023/11
179

Die Wirksamkeit osteopathischer Interventionen auf die Parameter FEV1 and FVC gemessen mittels Spirometrie
(Effectiveness of osteopathic interventions on the spirometric values FEV1 and FVC)
Söllradl, C.
Unpublished MSc thesis, 2023/11
180

Die Wirksamkeit der osteopathischen Therapie als Komplementärmedizin bei PatientInnen mit einer kardiovaskulären Erkrankung Systematischer Review
(The effectiveness of osteopathic manipulative treatment as complementary medicine for patients with cardiovascular disease A systematic review)
Tänzer, M. C.
Unpublished MSc thesis, 2023/11
Free full text
181

Pericardial Adhesion and Chronic Non-Specific Neck Pain following Thoracentesis: An Osteopathic Approach
Bordoni, B., Escher, A.
Clinics and Practice, 2023/10
Free full text
182

Osteopathic Manipulative Medicine and Its Role in Psychiatry
Bowes, M. R., Speicher, M. R., Tran, L. T., Santiago, P. N.
Cureus, 2023/10
Free full text
183

Updates on Diversity Among Cardiology-Related Fellowships
Walk, C. T., Lantz, R.
Cureus, 2023/10
184

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10
185

Effect of acupuncture combined with rehabilitation on Postoperative gastrointestinal dysfunction after abdominal operation
Xing, W.
Clinical Nutrition ESPEN, 2023/10
186

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2023/10
Free full text
187

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text
188

A biopsychosocial approach as a part of an osteopathic intervention in the management of chronic prostatitis/chronic pelvic pain: A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2023/10
189

The Use of Osteopathic Manipulative Treatment for Treatment of Sore Throat, Headache, and Facial Pain: A Case Report
Berkowitz, M. R.
The AAO Journal, 2023/09
190

Case History #4
Coffey, D.
The AAO Journal, 2023/09
191

Diagnosis and Treatment of a Dynamic Strain Vector after a Motor Vehicle Accident
Gustowski, S.
The AAO Journal, 2023/09
192

Resolution of Stridor, Gastritis and Cephalgia in an Adolescent with Reflex Sympathetic Dystrophy Following Osteopathic Manipulative Treatment—A Case Report
Habenicht, A. L.
The AAO Journal, 2023/09
193

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text
194

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09
195

The extent and quality of evidence for osteopathic education: A scoping review
MacMillan, A., Gauthier, P., Alberto, L., Gaunt, A., Ives, R., Williams, C., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/09
196

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09
197

The profile of French osteopaths: A cross-sectional survey
Wagner, A., Ménard, M., Jacquot, E., Marangelli, G., Merdy, O., Clouzeau, C., Tavernier, P., Verbeeck, J., Vaucher, P., Esteves, J. E., Cerritelli, F., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2023/09
198

Osteopathic treatment for cam-type Femoroacetabular impingement syndrome: A case report
Kilic, R. T., Yosmaoglu, H. B., Bayrakci Tunay, V.
International Journal of Osteopathic Medicine, 2023/09
199

Der Einwärtsgang – Physiologie oder Pathologie?
(The inward gait - physiology or pathology?)
Halasz, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09
200

Возможности немедикаментозных методов лечения при синдроме хронической тазовой боли у мужчин (систематический обзор)
(Possibilities of non-drug methods of treatment for chronic pelvic pain syndrome in men (systematic review))
Krikunov, A. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/09
201

Эффективность остеопатического лечения пациентов, страдающих фибромиалгией (обсервационное исследование)
(Observational study of the effects of an osteopathic treatment for patients with fibromyalgia)
Laroche, F., Bellan, E., Doléac, M., Meslé, R., Marty, M., Rostaing, S.
Russian Osteopathic Journal, 2023/09
202

Изменение клинического статуса пациента с дисфункцией височно-нижнечелюстного сустава после остеопатической коррекции соматических дисфункций
(Change in the clinical status of a patient with dysfunction of the temporomandibular joint after osteopathic correction of somatic dysfunctions)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2023/09
203

Исследование возможности применения остеопатической коррекции для лечения пациентов с неэрозивной гастроэзофагеальной рефлюксной болезнью
(Study of the possibility of using osteopathic correction for the treatment of patients with non-erosive gastroesophageal reflux disease)
Pirogov, R. V., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/09
204

(Changes in the osteopath′s brain bioelectrical activity while listening to the patient′s cranial rhythmic impulse (pilot study))
Piskunova, G. E., Belyaev, A. F.
Russian Osteopathic Journal, 2023/09
205

Osteopathic Manipulative Therapy (OMT) as an adjunct to postoperative care for patients with gynecologic malignancies (174)
Ettorre, V., Wagreich, A., Meelheim, B., Torres, J.
Gynecologic Oncology, 2023/09
206

Influence of Osteopathic Manipulative Treatment on the Quality of Life and the Intensity of Lumbopelvic Pain in Pregnant Women in the Third Trimester: A Prospective Observational Study
Correia, M. L. A., Peixoto Filho, F. M., Gomes Júnior, S. C.
Healthcare, 2023/09
Free full text
207

Osteopathic Manual Therapy for Infant Colic: A Randomised Clinical Trial
Martínez-Lentisco, M. D. M., Martín-González, M., García-Torrecillas, J. M., Antequera-Soler, E., Chillón-Martínez, R.
Healthcare, 2023/09
Free full text
208

Evaluation of the effects of osteopathic manipulative treatment associated with transcranial direct current stimulation in chronic nonspecific low back pain. A protocol for a randomised controlled trial
Armbrust, D., Fonseca, C. L., Lopes Dumont, A. J., Viegas da Trindade, A. M., Neto, H. P., Oliveira, C. S.
International Journal of Osteopathic Medicine, 2023/09
209

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09
210

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2023/09
Free full text
211

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/09
Free full text
212

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/09
Free full text
213

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09
214

The biomechanical links between pelvic floor dysfunction and testicular pain: A clinical review
Jackson, C., Fawcett, L.
Osteopathic Family Physician, 2023/09
215

Clinical Effectiveness of Craniosacral Therapy in Patients with Headache Disorders: A Systematic Review and Meta-analysis
Carrasco-Uribarren, A., Mamud-Meroni, L., Tarcaya, G. E., Jiménez-Del-Barrio, S., Cabanillas-Barea, S., Ceballos-Laita, L.
Pain Management Nursing, 2023/09
216

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text
217

A Novel Approach to Assessing and Conservatively Treating Anterior Cutaneous Nerve Entrapment Syndrome: A Case Study
Newman, D. P., Holkup, S. M., Masi, E. L., Soto, A. T.
Cureus, 2023/09
Free full text
218

Osteopathic Manipulative Treatment for a Chronic Rotator Cuff Tear: A Case Report
Scypinski, L. J., Bonitz, T. J., Lomiguen, C. M., Chin, J.
Cureus, 2023/09
Free full text
219

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09
220

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09
221

Die Schilddrüse aus der Sicht der Osteopathie: Teil 3: Behandlung
(The thyroid gland from the point of view of osteopathy: Part 3: Treatment)
Frühwein, J.
Osteopathische Medizin, 2023/09
222

Effect of osteopathic visceral manipulation for individuals with functional constipation and chronic nonspecific low back pain: randomized controlled trial
Boas Fernandes, W. V., Correa, F. I., Fidelis de Paula Gomes, C. A., Blanco, C. R., Lucareli, P. R. G., Politti, F., Correa, J. C. F.
Gait and Posture, 2023/09
223

Forschung zum Cranial Rhythmic Impulse (CRI) in der osteopathischen Medizin
(Research on the Cranial Rhythmic Impulse (CRI) in Osteopathic Medicine)
Pelz, H., Keller, M., Müller, G., Borik, S., Perlitz, V.
Osteopathische Medizin, 2023/09
224

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09
225

Fallbericht: Phänodynamisch-osteopathische Behandlung eines Hygroms
(Case report: Phenodynamic-osteopathic treatment of a hygroma)
Weber, K.H.
Osteopathische Medizin, 2023/09
226

Medical Uncertainty of Future Physicians: Socialization and Uncertainty Management in Medical Education
Duty, K. M.
Unpublished PhD thesis, 2023/08
227

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text
228

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text
229

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text
230

Effectiveness of Osteopathic Manipulative Treatment in Adults with Irritable Bowel Syndrome: A Systematic Review and Meta-Analysis
Buffone, F., Tarantino, A. G., Belloni, F., Spadafora, A., Bolzoni, G., Bruini, I., Bergna, A., Vismara, L.
Healthcare, 2023/08
Free full text
231

Effects of the Fourth Ventricle Compression Technique and Rib Raising Osteopathic Technique on Autonomic Nervous System Activity Measured by Heart Rate Variability in 35 Healthy Individuals
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2023/08
Free full text
232

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text
233

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text
234

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07
235

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/07
Free full text
236

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text
237

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/07
Free full text
238

Modifying functional brain networks in focal epilepsy by manual visceral-osteopathic stimulation of the vagus nerve at the abdomen
Lehnertz, H., Broehl, T., Rings, T., von Wrede, R., Lehnertz, K.
Frontiers in Network Physiology, 2023/07
Free full text
239

Systematic review and meta-analysis showed that complementary and alternative medicines were not effective for infantile colic
Cabanillas-Barea, S., Jiménez-del-Barrio, S., Carrasco-Uribarren, A., Ortega-Martínez, A., Pérez-Guillén, S., Ceballos-Laita, L.
Acta Paediatrica: Nurturing the Child, 2023/07
Free full text
240

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07
241

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text
242

Cambios físicos y metabólicos desencadenados tras la manipulación osteopática
(Physical and metabolic changes triggered by osteopathic manipulation)
Melo, M., Alberto, R.
Unpublished MSc. thesis, 2023/07
Free full text
243

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text
244

Osteopathic manipulative treatment in improving symptoms and quality of life in patients with Graves’ ophthalmopathy: A case report
Luong, Q., Evitts, M., Rakowsky, K. C.
International Journal of Osteopathic Medicine, 2023/07
245

Effectiveness of visceral fascial therapy targeting visceral dysfunctions outcome: systematic review of randomized controlled trials
da Silva, F. C., Vieira, L. S., Santos, L V., Gaudreault, N., Cruvinel-Júnior, R H., Santos, G M.
BMC Complementary Medicine and Therapies, 2023/07
Free full text
246

Operative Herangehensweise bei und osteopathische Behandlung nach Hüft-TEP-Implantation
(Operative approach to and osteopathic treatment after hip TEP implantation)
Grasmück, J., Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
247

Der biodynamische Behandlungsansatz in der osteopathischen Praxis – eine qualitative Interviewstudie
(The biodynamic treatment approach in osteopathic practice - a qualitative interview study)
Grasmück, J., Müller, F., Kienzler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
248

Die Lebendigkeit des Selbst – das gesunde Immunsystem
(The vitality of the self - the healthy immune system)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
249

Resolution of a Plica Band Syndrome with Osteopathic Manipulative Treatment
Barr, J., Heller, G.
The AAO Journal, 2023/06
250

An Osteopathic Approach to Chronic Inflammatory Demyelinating Polyneuropathy
Baxter, C., Grote, J., Wallace-Ross, J.
The AAO Journal, 2023/06
251

Examination of “The Tide,” CRI, and Physiologic Respiration: A Mathematical Analysis
Berkowitz, M. R.
The AAO Journal, 2023/06
252

Osteopathic Management of Pediatric Feeding Disorder, Oral Aversion, and Growth Faltering: A Case Report
Beveridge, E., Magoun, M. A.
The AAO Journal, 2023/06
253

Nervous System Under Attack
Blaukovitch, C., Unger, M., Thorsvik, N., Heller, G.
The AAO Journal, 2023/06
254

Happy Feet are Dancing Feet, Response to OMT in a Patient with Morphea Profunda: A Case Report
Bomani-Bailey, A., Ettlinger, H.
The AAO Journal, 2023/06
255

Comparison of Tone and Stiffness Changes to Lumbar Paraspinal Muscle with Varying Osteopathic Treatment Modalities (254)
Companion, N., Guha, A., Naeem, A., Abu-Sbaih, R., Keys, J., Yao, S.
The AAO Journal, 2023/06
256

The Effects of Osteopathic Manipulative Treatment (OMT) on an Infant with Failure to Thrive (FTT); A Case Study
Cornwell, S., Yao, S., Abu-Sbaih, R.
The AAO Journal, 2023/06
257

Osteopathic Manipulative Treatment Reduces Pain and Improves Range of Motion in Patients with Chronic Neck Pain
Daly, E., Prodoehl, J., Bolch, C., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2023/06
258

Tackling Structure and Function with an Osteopathic Approach: A Patient with a Herniated Lumbar Disc and a Small Hemipelvis
Danto, S. E., Danto, J. B.
The AAO Journal, 2023/06
259

Stop Chasing the Pain: An Osteopathic Approach to Treating Migrating Pain Caused by Lumbar Radiculopathy- the Importance of Treating the Cause not the Symptoms
Desai, B., Baxter, C., Widboom, N.
The AAO Journal, 2023/06
260

Drug Induced Tibial Nerve Neuropathy in Former Collegiate Baseball Player
Dickey, Z., Turnbull, J., Sharma, N., Aldret, S.
The AAO Journal, 2023/06
261

Cranial Osteopathic Manipulative Treatment for Post-COVID Syndrome
Drakeley, C., Shah, R., Waters, H., Mehra, R., Kumaran, N., Johnson, T.
The AAO Journal, 2023/06
262

Stalled out: An Osteopathic Approach To A Post-Traumatic Gastroparesis
Fisher, B., Vijayakar, R., Coppinger, J., Motashaw, V.
The AAO Journal, 2023/06
263

An Osteopathic Approach to Shoulder Injury Following Post-Hemorrhage Hemiparesis
Geyer-Roberts, E., Helderlein, P., Wallace-Ross, J.
The AAO Journal, 2023/06
264

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06
265

“That’s The Way We Have Always Done It”: Resetting the Hips
Fremarek, N., Hammond, E., Digambar, S., Tobey, H., Harden, D., Redden, D. T., Sullivan, N., Desai, G., Treffer, K., Kozar, A.
The AAO Journal, 2023/06
266

An Osteopathic Approach to Dizziness Secondary to Meniere’s Disease
Grote, J., Perez, J., Wallace-Ross, J.
The AAO Journal, 2023/06
267

Free to Fly: A Case of A Dancer’s Flexor Hallucis Longus Tendonitis
Perez, J., Helderlein, P., Widboom, N.
The AAO Journal, 2023/06
268

Cranial for Chronic pain: The efficacy of osteopathic manipulative treatment (OMT) in the management of chronic post-traumatic headache (CPTHA)
Helderlein, P., Geyer-Roberts, E., Widboom, N.
The AAO Journal, 2023/06
269

Intersegmental sacral dysfunction as primary etiology of low back pain in a college athlete: A case study
Householder, L., Veach, A., Diefenderfer, J.
The AAO Journal, 2023/06
270

Treatment of A Pediatric Patient with Right Eye Esotropia using Osteopathic Manipulative Treatment
Inouye, K., Magoun, M. A.
The AAO Journal, 2023/06
271

Assessing Differences in Palpation Pressure between Osteopathic Medical Students and Osteopathic Physicians
Jacob, T., Khalid, A., Syed, F., Jose, R., Nikprelaj, K., Frankini, E., Yao, S., Toma, M.
The AAO Journal, 2023/06
272

International Overview of Osteopathic Manipulative Treatment in Infants with Nonsynostotic Plagiocephaly: A Scoping Review to Aid in the Inclusion of OMT into the Current Evidence-Based Treatment Guidelines
Jimenez, R., Cao, G., Bomstad, C., Myxter, K., Lozano, A., Tran, M.T., Roettger, V., Gubler, K. D., Brooks, B., Branda, A.
The AAO Journal, 2023/06
273

The Effects of Osteopathic Manipulative Treatment (OMT) on Rare Diseases- Gordon Syndrome
Johnson, T. A., Waters, H.
The AAO Journal, 2023/06
274

Osteopathic Manipulative Treatment for Enhanced Functional Recovery in Stroke Survivors
Kumaran, N., Drakeley, C., Waters, H., Mehra, R.
The AAO Journal, 2023/06
275

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
276

Use of Micronized Lipoaspirate with Platelet-rich Plasma Injection and 3D Tenotomy for Treatment of a Longitudinal Peroneal Brevis Tear
Lambert, M., Fremarek, N., Kozar, A.
The AAO Journal, 2023/06
277

The 5 Models of Osteopathic Medicine, An Approach to Transgendered Care: A Case Report
Lentz, A., Koehler, T., Caldwell, G., Fremarek, N.
The AAO Journal, 2023/06
278

Case Study on the Effect of Osteopathic Manipulation on Gallbladder Ejection Fraction
Lin, E., Montalvo, E., Garcia Garcia, D., Adams, N., Sparks, C., Gibson, J., Seals, R.
The AAO Journal, 2023/06
279

Effect of Muscle Energy Technique (MET) on muscle parameters and lower extremity functionality in a Parkinson’s Disease (PD) patient: A case report
Macmillan, G., Radigan, R., Finkelstein, A., Yao, S.
The AAO Journal, 2023/06
280

Osteopathic Treatment of Chronic Chest Pain After Trauma
Martini, J., Veach, A.
The AAO Journal, 2023/06
281

Osteopathy—A philosophical perspective. Reflections on Sutherland’s experience of the tide
Masiello, D. J.
The AAO Journal, 2023/06
282

Effects of OMT on Running Performance and Recovery
Matz, O., Gustafson, H., Hartwell, L., Rudberg-Post, L., Lewis, D.
The AAO Journal, 2023/06
283

Osteopathic Manipulative Treatment for Chemotherapy-Induced Abdominal Pain and Anorexia in Glioblastoma Multiforme
McIntire, R., Terry, R., Gebhardt, G.
The AAO Journal, 2023/06
284

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study, Part 2
Miranda, E., Feketeova, E., Giza, J.
The AAO Journal, 2023/06
285

An Osteopathic Approach to Dysmenorrhea
Paul, H., Bonner, P., Mehra, R.
The AAO Journal, 2023/06
286

A Case of Chronic Postoperative Abdominal Wall Pain Successfully Treated with the Fascial Distortion Model
Pelletier, J., Boucher, J.
The AAO Journal, 2023/06
287

Osteopathie in Österreich: Wirksamkeit und Sicherheit bei Schmerzen des Bewegungsapparats und Überblick über Ausbildung und Qualitätsanforderungen
(Osteopathy in Austria: Effectiveness and safety in treating pain of the musculoskeletal system and overview of training and quality requirements)
Gassner, L., Hofer, V.
Osteopathische Medizin, 2023/06
Free full text
288

The Effect of OMT on Insulin Sensitivity and Glucose Control in Rodent Models: A Pilot Study
Petrillo, G., Cai, W., Keys, J.
The AAO Journal, 2023/06
289

An Osteopathic Approach To Refractory Sternal Pain
Risov, D., Geer, R.
The AAO Journal, 2023/06
290

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06
291

An Osteopathic Approach to Plagiocephaly in the Absence of Pre-Post Sphenoid Fusion
Rosten, C., Nixon, K., Jons-Cox, L.
The AAO Journal, 2023/06
292

Releasing the Restriction: A Study of Myofascial Release to Improve Pain and Range of Motion in Post-Cesarean Section Patients in the Peruvian Amazon
Scott, G., Gordon, T.
The AAO Journal, 2023/06
293

Expertenmeinungen zur viszeralen Osteopatie
(Experts' opinions on visceral osteopathy)
Newiger, C., Eichhorn, V.
Osteopathische Medizin, 2023/06
Free full text
294

Refractory Temporomandibular Joint Pain Resolved with Intraoral Osteopathic Manipulative Treatment
Shah, R., Drakeley, C., Mehra, R.
The AAO Journal, 2023/06
295

Ultrasound Assessment of OMT on Diaphragm Motion
Snow, N., DeDi, C., Rathjen, S., Redden, D. T., Kozar, A., Robinson, L.
The AAO Journal, 2023/06
296

26.2 Miles: A Case Study of Osteopathic Manipulative Treatment in Marathon Training
Sofka, M., Giovanis, A.
The AAO Journal, 2023/06
297

Symptomatic Mitigation of a Rare Case of Chronic Active Epstein-Barr Virus (CAEBV)Disease Using Lymphatic Osteopathic Manipulative Treatment
Song, Y., Waddington, M.
The AAO Journal, 2023/06
298

Approaching the barrier: Improved pediatric resident knowledge and confidence in osteopathic manipulative medicine after a resident-led educational intervention
Tyler, S., McMunn, R., Ruedinger, E.
The AAO Journal, 2023/06
299

Effects of Osteopathic Manipulative Treatment (OMT) on Functional Impairment in Limb Girdle Muscular Dystrophy Patient: A Case Report (271)
Unser, K., Yao, S.
The AAO Journal, 2023/06
300

Faszien als sensorisches und emotionales Organ: Emotionen, Faszien und Immunsystem
(Fasciae as sensory and emotional organ: Emotions, fasciae and immune system)
Schleip, R., Bartsch, K.
Osteopathische Medizin, 2023/06
Free full text
301

Osteopathic Manipulative Medicine as an Adjuvant Treatment for Hemicrania Continua: A Case Study
Van Fossen, E., Kanithi, M., Jelneck, S., Ferguson, D., Tran, J., Bui, N., Hassan, D., Gordon, T.
The AAO Journal, 2023/06
302

A Case Study of Osteopathic Manipulative Treatment (OMT) in Deformational Plagiocephaly (DP)
Vega, K., Ettlinger, H.
The AAO Journal, 2023/06
303

The Planetary Benefit of Suspending USMLE Step 2 CS: Estimating Carbon Emissions Associated with US Medical Students' Travel to Testing Centers
Sherpa, J. R., Donahue, L., Tsai, J., Nguemeni Tiako, M. J.
The Yale Journal of Biology and Medicine, 2023/06
Free full text
304

Banging Out Concussions: The Role of Osteopathic Manipulative Treatment in Post-Concussion Syndrome in Children
Wajid, A., Ettlinger, H.
The AAO Journal, 2023/06
305

Osteopathic Manipulative Treatment of Chronic Pelvic Pain due to High-Tone Pelvic Floor Dysfunction
Barnett, M. E., Henderson, K. K., Elliott-Burke, T. L., Heinking, K. P.
Osteopathic Family Physician, 2023/06
306

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
307

Effect of OMT on post-anoxic brain injury resulting in intractable myoclonus
Zhong, X., Campo, Z., Torrents, M.
The AAO Journal, 2023/06
308

The first step to strengthening graduate level osteopathic education: a national review
Cain, R. A.
Journal of Osteopathic Medicine, 2023/06
Free full text
309

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06
310

The effectiveness of disinfection protocols in medical school osteopathic manipulative medicine labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/06
Free full text
311

Osteopathic manipulative treatment for concussions and postconcussive syndrome in athletes: a literature review
Thomas, K. D., Lombard, Z. K., Shadiack, A. L.
Journal of Osteopathic Medicine, 2023/06
Free full text
312

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/06
Free full text
313

Влияние остеопатической коррекции на объем движения и качество жизни у пациентов с артрозом плечевого сустава I–II степени
(Influence of osteopathic correction on range of motion and quality of life in patients with arthrosis of the shoulder joint of I–II degrees)
Avzaletdinov, B. K., Akhmetov, B. H.
Russian Osteopathic Journal, 2023/06
314

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
315

Сила давления на ткани при различных остеопатических техниках (пилотное исследование)
(Pressure force on tissues in various osteopathic techniques (pilot study))
Mokhov, D. E., Tregubova, E. S., Potekhina, Y. P., Smirnova, L. M., Kolyshnitsyn, N. Y., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/06
316

Уровень физического здоровья и остеопатический статус студентов
(Physical health level and osteopathic status of students)
Tyuleneva, A. A., Potekhina, Y. P.
Russian Osteopathic Journal, 2023/06
317

Влияние общего остеопатического лечения на качество жизни людей пожилого возраста
(The influence of general osteopathic treatment on the quality of life of elderly people)
Usupbekova, B. S., Zhusupbekova, N. E., Shyikymanarov, E. S.
Russian Osteopathic Journal, 2023/06
318

Возможности применения остеопатической коррекции для лечения детей с синдромом дефицита внимания и гиперактивности
(The possibilities of osteopathic correction using for the treatment of children with attention deficit hyperactivity disorder)
Zaev, A. I., Stenkova, O. V.
Russian Osteopathic Journal, 2023/06
319

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06
320

Making sense of cranial osteopathy: An interpretative phenomenological analysis
Banton, A., Vogel, S., Lee-Treweek, G.
International Journal of Osteopathic Medicine, 2023/06
Free full text
321

Use of osteopathic manipulative treatment in management of intractable singultus and associated symptoms
Bloch, R. R., Kempa, M. R., Lippert, J. A.
International Journal of Osteopathic Medicine, 2023/06
322

Effects of a myofascial technique on the structure and biomechanical properties of the thoracolumbar fascia in chronic low back pain adults assessed by sonoelastography and myotonometry: a study protocol
Devantéry, K., Morin, M., Gaudreault, N.
Journal of Complementary and Integrative Medicine, 2023/06
323

Accompagner les changements curriculaires vers l’approche par compétences dans les formations en santé : étude d’une stratégie de changement pragmatique portée par un individu-tercéisateur dans un institut de formation en ostéopathie français
(Facilitating curricular changes towards the competency-based approach in health education : study of a pragmatic change strategy supported by a third-party with terceisation function in an osteopathic training institute)
Quesnay, P.
Unpublished PhD thesis, 2023/06
324

Exploring the effects of standardized soft tissue mobilization on the viscoelastic properties, pressure threshold and touch threshold of the caesarean section scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Complementary and Integrative Medicine, 2023/06
325

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text
326

What complementary and alternative medicine therapy recommendations exist across clinical practice guidelines for low back pain? A systematic review
Mohiuddin, U., Ng, J.
Journal of Complementary and Integrative Medicine, 2023/06
327

Pharmacology Education, Osteopathic Principles Integration, Osteopathic Manipulation Treatment relations: Osteopathic Graduating Seniors' Perception
Eldeeb, K.
Journal of Pharmacology and Experimental Therapeutics, 2023/06
328

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05
329

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05
330

Osteopathy in the Early Diagnosis and Management of Degenerative Cervical Myelopathy: National Survey
Brannigan, J. F. M., Mowforth, O. D., Rogers, M., Wood, H., Karimi, Z., Kotter, M. R. N., Davies, B. M.
JMIR Formative Research, 2023/05
Free full text
331

The effect of cranial techniques on the heart rate variability response to psychological stress test in firefighter cadets
Wójcik, M., Siatkowski, I.
Scientific Reports, 2023/05
Free full text
332

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/05
Free full text
333

The process and outcomes of chronic low back pain treatment provided by osteopathic and allopathic physicians: a retrospective cohort study
Licciardone, J. C., Kellerlee, J., Joseph, M., Mohammad, M. B., Kim, K. G., Jain, J., Aryal, S.
Journal of Osteopathic Medicine, 2023/05
Free full text
334

The Short-Term and Long-Term Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D. Y., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
335

Serological Assessment of the Effectiveness of Osteopathic Manipulative to Augment the Covid-19 Vaccine Immune Response
Martinez, E., Loveless, B., Crone, P., Szurmant, H., Fuchs, S., Sanchez, J.
Journal of Investigative Medicine, 2023/05
336

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05
337

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05
338

Evaluation of Osteopathic Manipulative Treatment in Patients with Chikungunya Fever in the Chronic Phase: A Randomized Controlled Trial
Tenorio, L., Mello, K., Maia, M., Valença, A., Duarte, Â., Marques, C.
Journal of Clinical Rheumatology, 2023/05
339

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text
340

Manejo de la espondilolistesis lumbar desde la osteopatía. Una revisión bibliométrica
(Management of lumbar spondylolisthesis from osteopathy. A bibliometric review)
Apolinar Cruz, G. A.
Unpublished MSc thesis, 2023/05
Free full text
341

Effect of a Stress Management Module on First-Year Osteopathic Medical Students’ Stress Levels
Hill, Y. M.
Unpublished PhD thesis, 2023/05
342

Identifying Predictors of Eventual Rural Practice Among Female Osteopathic Medical Students
Kahl, D.
Unpublished Dissertation, 2023/05
343

Perceptions of experienced osteopaths on interprofessional communication
Grech, R.
Unpublished MSc thesis, 2023/05
Free full text
344

The Preferences of Osteopathy Patients, Students, and Osteopaths on the Patient-Centered Orientation in Osteopathic Care
Mendes, B.
Unpublished MSc thesis, 2023/05
Free full text
345

Osteopathic Manual Treatment Compared to Kaltenborn-Evjenth Orthopedic Manual Therapy for Chronic Low Back Pain: A Randomized Study
Lizis, P., Kobza, W., Jaszczur-Nowicki, J., Wisniewski, D.
Alternative Therapies in Health and Medicine, 2023/05
346

Is there a mean difference in attitude when care for LGBTQ patients between primary care provider subgroups?
Doan, T.
Unpublished MSc thesis, 2023/05
Free full text
347

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05
348

Medical Education Fellowship: Who's Doing It and Why?
Cueva, J., Jobeun, N., Mody, S.
Western Journal of Emergency Medicine, 2023/05
Free full text
349

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/04
350

Efficacy of the Osteopathic Pedal Pump in Reducing Lower Limb Volume in Older Adults with Lymphedema
Parikh, S. H., Adams, J. S., Goodwin, B. J., McLaughlin, M. H., Noll, D. R.
Journal of the American Geriatrics Society, 2023/04
351

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match. Letter
Bohler, F., Aggarwal, N. D.
The Journal of Urology, 2023/04
Free full text
352

A New Barrier in the Urology Residency Application Process For Students: Growth of U.S. Medical Schools Increasingly Outpaces the Development of Urology Programs
Nelwan, D., Donato, U., Patel, T., Imam, A. S.
The Journal of Urology, 2023/04
353

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text
354

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text
355

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text
356

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text
357

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text
358

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
359

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
360

Communication strategies in psychologically informed osteopathic practice: A case report
Abbey, H.
International Journal of Osteopathic Medicine, 2023/03
361

Interventional Radiology in Osteopathic Medical Education
Cyphers, E., Groskreutz, D., Grilli, C., Ahuja, R.
Journal of Vascular and Interventional Radiology, 2023/03
362

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text
363

OSCAR (Osteopathic Single CAse Research) – Assessing the effect of standard and biopsychosocial osteopathic management for patients with non-specific low back pain: Protocol for a Single Case Experimental Design (SCED)
Draper-Rodi, J., Abbey, H., Brownhill, K., Vogel, S.
International Journal of Osteopathic Medicine, 2023/03
364

Die osteopathische Technik – ein Metakonzept
(The osteopathic technique - a meta concept)
Engel, M.
Osteopathische Medizin, 2023/03
365

Covid-19 Fatigue: Diagnosis and Treatment for the Osteopathic Physician
Foss, V. B., Maddie, N., Frankini, E. L., Landman, S., Maccagnano, J., Yao, S. C.
Osteopathic Family Physician, 2023/03
366

Abwertung als Ziel: Über den Artikel „Die Scheinwirkung der Osteopathie” von Edzard Ernst
(Devaluation as a Goal: About the Article “The Sham Effect of Osteopathy“ by Edzard Ernst)
Franke, H.
Osteopathische Medizin, 2023/03
367

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03
368

A Case Study of Postural Imbalance with Lymphatic Congestion Which Responded to OMT
Lockhart, W. C.
The AAO Journal, 2023/03
Free full text
369

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text
370

Response to “Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine“
Rehman, Y., Kirsch, J., Snider, K. T.
Journal of Osteopathic Medicine, 2023/03
Free full text
371

Akupunktur und osteopathische Medizin bei atopischer Dermatitis: Eine explorative randomisiert kontrollierte Studie (CAMATOP-Studie)
(Acupuncture and osteopathic medicine in atopic dermatitis: an exploratory randomized controlled trial (CAMATOP study))
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Osteopathische Medizin, 2023/03
372

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03
373

Osteopathic Findings and Treatment of Patient with Crohn’s Disease and Post-Ileocecal Resection: A Case Report
Shulman, D., Volokitin, M., Song, A., Burns, D.
The AAO Journal, 2023/03
Free full text
374

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text
375

Osteopathische Behandlung von Säuglingen mit infantiler Kolik/exzessivem Schreien: Eine prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of infants with infantile colic/excessive crying: A prospective, multicenter, controlled randomized trial.)
Zimmer, M., Göpfert, J., Laux, P., Langenmair, S.
unpublished D.O. thesis, 2023/03
376

Anorexie mentale et médiations somatiques : évaluations croisées de l’ostéopathie et de la psychomotricité sur les préoccupations corporelles
(Osteopathy and Anorexia Nervosa: Cross-evaluations of osteopathy and psychomotricity on bodily concerns)
Mattatia, J., Gaha, N., Cottin, L., Mattatia, D., Morelle, Q., Truong, R., Saussé-Corbière, L., Yi, M.K.
Annales Médico-psychologiques, revue psychiatrique, 2023/03
377

Метод коррекции соматических дисфункций
(Method for correcting somatic dysfunctions)
Aptekar, I. A.
Russian Osteopathic Journal, 2023/03
378

Влияние остеопатической коррекции на ликвородинамику у пациентов с головной болью напряжения
(The influence of osteopathic correction on liquorodynamics in patients with tension-type headache)
Belash, V. O., Starostenko, V. A.
Russian Osteopathic Journal, 2023/03
Free full text
379

Гониометрическая оценка применения остеопатической техники активного вытяжения со специфической точкой фиксации. Влияние на подвижность плечевого пояса
(Goniometric effects of an osteopathic technique, active stretching with specific, fixation on the mobility of the Scapular Waist)
Campillar, M. A.
Russian Osteopathic Journal, 2023/03
Free full text
380

Результаты остеопатической коррекции по данным стабилографии у пациентов с ампутацией нижних конечностей на уровне голени
(Results of osteopathic correction according to the stabilography data in patients with lower limb amputation at the transtibial level)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2023/03
Free full text
381

Обоснование эффективности остеопатической коррекции при лечении пациентов, страдающих постпункционным синдромом
(Substantiation of the effectiveness of osteopathic correction in the treatment of patients suffering from post-puncture syndrome)
Krivenya, M. S., Gorobets, L. V.
Russian Osteopathic Journal, 2023/03
Free full text
382

Результаты остеопатического лечения дисфункции височно-нижнечелюстного сустава (метаанализ)
(Results of the osteopathic treatment of the temporomandibular joint dysfunction (meta-analysis))
Milutka, Y. A., Dyachkova, Y. Y., Evdokimova, A. V.
Russian Osteopathic Journal, 2023/03
Free full text
383

Возможность применения остеопатической коррекции при синдроме хронической тазовой боли
(The possibilities of using osteopathic correction for chronic pelvic pain syndrome)
Sharapov, I. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2023/03
Free full text
384

Российский остеопатический журнал: основные этапы развития в 2012–2022 гг.
(Russian Osteopathic Journal: the main stages of development in 2012–2022)
Tregubova, E. S., Plokhov, R. A., Potekhina, Y. P., Belash, V. O.
Russian Osteopathic Journal, 2023/03
385

Остеопатическая реабилитация пациентов, перенесших внебольничную пневмонию
(Osteopathic rehabilitation of patients after community-acquired pneumonia)
Usupbekova, B. S., Sartmyrzaeva, S. S., Murzakhmetova, S. A.
Russian Osteopathic Journal, 2023/03
386

Патогенетические предпосылки применения остеопатической коррекции при хроническом тонзиллите
(Pathogenetic prerequisites for the use of osteopathic correction in chronic tonsillitis)
Vedyashkina, A. S., Potekhina, Y. P., Mokhov, D. E.
Russian Osteopathic Journal, 2023/03
387

Обоснование применения остеопатической коррекции в комплексной реабилитации пациентов после операции реконструкции передней крестообразной связки
(Substantiation of the application of osteopathic correction in the complex rehabilitation of patients after anterior cruciate ligament reconstruction surgery)
Vorobyev, S. V., Dolinina, O. Y., Mokhov, A. D., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2023/03
388

Osteopathic intervention for infants with breastfeeding difficulty: A retrospective case series
Greenwood, K., Engel, R., Grace, S.
International Journal of Osteopathic Medicine, 2023/03
389

Kann mittels Osteopathie der Hormonstatus von infertilen Frauen mit Polyzystischem-Ovarial-Syndrom (PCOS) beeinflusst werden?
(Is it possible to influence the hormone levels of infertile women with polycystic ovarian syndrome (PCOS) by osteopathic treatments?)
Hartl, V.
Unpublished MSc thesis, 2023/03
390

Response to Lo et al. regarding “The role of 3D digital applications in Manual Therapy Education – A scoping review”
Kovanur Sampath, K., Arumugam, A., Jull, G.
International Journal of Osteopathic Medicine, 2023/03
Free full text
391

Letter to the editor, regarding: The role of 3D digital applications in manual therapy education – A scoping review
Lo, C. N.
International Journal of Osteopathic Medicine, 2023/03
392

Osteopathic education: A scoping review protocol
MacMillan, A., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2023/03
393

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03
394

Evaluating the impact of a curriculum intervention using an assessment rubric for communication skill development of osteopathy students
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2023/03
395

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text
396

Die klinische Wirksamkeit des Fasziendistorsionsmodells
(Clinical Efficacy of the Fascial Distortion Model)
Honc, C.
Unpublished MSc thesis, 2023/03
397

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/03
Free full text
398

Der Effekt einer Stillpunktinduktion am Sakrum auf das vegetative Nervensystem, im Vergleich zu einer Scheinbehandlung, gemessen anhand der Herzratenvariabilität (HRV)
(The Effect of a sacrum stillpoint induction on the autonomic nervous system compared to a sham treatment, as measured by heart rate variability (HRV))
Franzin, K.
Unpublished MSc thesis, 2023/03
399

The Early Impact of Deciding to Take the United States Medical Licensing Examination Step 1 for Osteopathic Medical Students in the Pass/Fail Era
Hedgepeth, D., Wlasowicz, S., Lott, R., Smith, T.
Cureus, 2023/03
Free full text
400

Effekt einer Unwinding-Technik des zervikothorakalen Diaphragmas auf die Herzratenvariabilität (HRV) im Vergleich zu einer Scheinbehandlung
(Effect of an unwinding technique of the cervicothoracic diaphragm on the heart rate variability (HRV) compared to a sham treatment)
Gwendolyn, A.
Unpublished MSc thesis, 2023/03
401

Osteopathie bei Frauen mit Blasenentleerungsstörung sowie Blasenspeicherstörungen
(Effect of osteopathy on bladder storage dysfunctions and voiding difficulties in women)
Schwarzenlander, U.
Unpublished MSc thesis, 2023/03
402

Effektivität einer craniosacralen Behandlung bei Multiple-Sklerose-PatientInnen mit Störungen im Urogenitaltrakt im Vergleich zur physiotherapeutischen Behandlung mittels aktiver Beckenbodenübungen
(Effectiveness of a craniosacral treatment on patients with multiple sclerosis with problems of the urogenital system compared with pelvic floor training)
Karner, A.
Unpublished MSc thesis, 2023/03
403

Effektivität von osteopathischen Techniken und Behandlungen bei COPD. Systematisches Review
(Effectiveness of osteopathic techniques and treatments in patients with COPD. A systematic review)
Safran, T.
Unpublished MSc thesis, 2023/03
404

Die Wirksamkeit der Osteopathie auf die Okulomotorik nach einer Gehirnerschütterung
(The effectiveness of osteopathy on oculomotor function after concussion)
Dalder, K.
Unpublished MSc thesis, 2023/03
405

Der Einfluss einer visceralen Behandlungstechnik auf die Beweglichkeit der Halswirbelsäule
(The influence of a visceral treatment technique on the mobility of the cervical spine)
Koch, K.
Unpublished MSc thesis, 2023/03
406

Connecting the dots: alterations in bioelectric activity at acupuncture Ting (Jing-Well) points following CV4 cranial manipulation
Hendryx, J. T., Kannan, A., Prashad, J., Falk, K.
Journal of Osteopathic Medicine, 2023/03
Free full text
407

Der Einfluss der Osteopathie auf infantile nicht-synostotische Plagiozephalie
(The Influence of Osteopathy on infantile non-synostotic Plagiocephaly)
Archam, S.
Unpublished MSc thesis, 2023/03
408

Effects of a Myofascial Technique on the Stiffness and Thickness of the Thoracolumbar Fascia and Lumbar Erector Spinae Muscles in Adults with Chronic Low Back Pain: A Randomized before-and-after Experimental Study
Devantéry, K., Morin, M. P., Grimard, J., Gaudreault, N.
Bioengineering, 2023/03
Free full text
409

Osteopathic Manipulation as a Method of Cortisol Modification: A Systematic Review
Thibaut, D., Santarlas, V., Hoppes, J., Vásquez-Castillo, A., Morrow, A., Oviedo, E., Toldi, J.
Cureus, 2023/03
Free full text
410

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text
411

Osteopathische Behandlung bei Rückenschmerzen. Akuter, nicht- spezifischer
(Osteopathic Manipulative Treatment for acute, non-specific Low Back Pain)
Jankovic-Preslmayer, M.
Unpublished MSc thesis, 2023/03
412

Die Messung der vertikalen Sprunghöhe bei VolleyballerInnen nach einer osteopathischen Behandlung
(Vertical jump height of volleyball players after an osteopathic treatment)
Archer, K.
Unpublished MSc thesis, 2023/03
413

Weibliche Genitalverstümmelung und Osteopathie
(Female genital mutilation and osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03
414

An Update on Medical School Accreditation in the United States: Implications for the Single Graduate Medical Education (GME) Era
Ahmed, H., Kortz, M., Carmody, J. B.
Cureus, 2023/02
Free full text
415

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text
416

Perceived Value of Osteopathic Recognition
Maier, R., Weaver, J., Ginoza, J. A., Meyer, D., Gothard, D.
Family Medicine, 2023/02
Free full text
417

Management of Post-Viral Postural Orthostatic Tachycardia Syndrome With Craniosacral Therapy
Tafler, L., Chaudry, A., Cho, H., Garcia, A.
Cureus, 2023/02
Free full text
418

To the Editor: COMLEX-USA vs USMLE? Irrelevant
Terry, R., Lavertue, S.
Journal of Graduate Medical Education, 2023/02
Free full text
419

Osteopathic manipulative techniques in the treatment of vestibular dizziness not related to the cervical spine
Alvarez, G., Lucas, S., Roura, S.
Journal of Osteopathic Medicine, 2023/02
Free full text
420

Osteopathic manipulative treatment of patients with chronic low back pain in the United States: a retrospective cohort study
Licciardone, J. C., Moore, S., Fix, K., Blair, L. G., Ta, K.
Journal of Osteopathic Medicine, 2023/02
Free full text
421

Abordaje de Manejo de dolor en Niños desde la perspectiva de la Medicina Alternativa
(Approach to Pain Management in Children from an Alternative Medicine Perspective)
Sierra Sánchez, A. P.
Unpublished MSc thesis, 2023/02
Free full text
422

Effectiveness of osteopathic treatment in patients with Lower Urinary Tract Symptoms (LUTS)
Arora, A., Ghosh, T.
Biomedicine, 2023/02
423

Einklemmungsphänomene als Ursache für eine Parese des N. abducens
(Entrapment phenomena as a cause of abducens nerve paresis)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
424

Bedeutung des differenzierten Säuglingsbefunds
(Importance of the differentiated infant finding)
Ginsberg, I.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
425

Fragen und die Existenz verschiedener Wahrheiten
(Questions and the existence of various truths)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
426

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01
427

Neck pain service utilization and costs: association with timing of non-pharmaceutical services for individuals initially contacting a primary care provider. A retrospective cohort study
Elton, D., Zhang, M.
medRxiv, 2023/01
Free full text
428

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01
429

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text
430

Including LGBTQIA+ Healthcare Education in the Pre-Clinical Curriculum at Osteopathic Medical Schools
Harrison, C. C.
Unpublished Dissertation, 2023/01
431

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text
432

Structural abnormalities and osteopathic considerations in primary immunodeficiencies
Rowane, M. J., Callahan, M. A., Schend, J. E., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2023/01
Free full text
433

Concussion-related visual memory and reaction time impairment in college athletes improved after osteopathic manipulative medicine: a randomized clinical trial
Mancini, J. D., Angelo, N., Abu-Sbaih, R., Kooyman, P., Yao, S.
Journal of Osteopathic Medicine, 2023/01
Free full text
434

Effectiveness of osteopathic manipulative treatment in cardiovascular function: a systematic review protocol
Vanier, C., Johnston, K., DeArmond, M., Salloum, L., Arjmand, S., Toder, E., Ioudina, M.
JBI Evidence Synthesis, 2023/01
Free full text
435

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: systematic review and meta-analysis
Rehman, Y., Kirsch, J., Wang, M. Y., Ferguson, H., Bingham, J., Senger, B., Swogger, S. E., Johnston, R., Snider, K. T.
Journal of Osteopathic Medicine, 2023/01
436

(Osteopathy as a treatment proposal for patients with temporomandibular disorders: a systematic review)
Pereira de Paula, R., Oliveira da Silva Almeida, D., Garcia de Paula, G., Moreira Alves, L., Oliveira Silva, M., Rodrigues da Cunha, M., Iatecola, A., Ramos Fernandes, V.A., Rodrigues Silva, V., de França, E., Barroso Hirota, V.
Revista Multidisciplinar da Saúde, 2023
Free full text
437

Osteopathic Manipulative Treatment as Adjuvant Therapy in Peripheral Arterial Disease.
Lombardini, R., Collebrusco, L.
, 2023
Free full text
438

Revisión sistemática: análisis de la terapia osteopática en la tendinitis del manguito rotador
(Analysis of the efficacy of osteopathic therapy in the treatment of rotator cuff tendinitis. A systematic review)
Sanchez, C., Alexandra, Y.
Unpublished MSc thesis, 2023
Free full text
439

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12
440

Mental health outcomes among osteopathic physicians during COVID-19
Lee, E., Lo, Jo., Zhu, P., Fernandez Sweeny, Y., Fuchs, S.
International Journal of Osteopathic Medicine, 2022/12
Free full text
441

The intersection of the two complimentary fields of preventive cardiology and integrative cardiology: A Fellow's voice
Cheung, B.
American Journal of Preventive Cardiology, 2022/12
Free full text
442

Corrigendum to “Treatment of infant colic with craniosacral therapy. A randomized controlled trial“ [Complement Ther Med 71 (2022) 102885]
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/12
Free full text
443

COVID-19 in Patients with Asthma: Review and Implications for Care of Adult Patients with an Osteopathic Component
Frasca, D. J., Wolf, S.
Osteopathic Family Physician, 2022/12
Free full text
444

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12
445

Historical Osteopathic Principles and Practices in Contemporary Care: An Anthropological Perspective to Foster Evidence-Informed and Culturally Sensitive Patient-Centered Care. A Commentary
Zegarra-Parodi, R., Baroni, F., Lunghi, C., Dupuis, D.
Healthcare, 2022/12
Free full text
446

A randomized, controlled study to assess if allopathic-osteopathic collaboration influences stereotypes, interprofessional readiness, and doctor-patient communication
Jones, I. A., LoBasso, M., Shapiro, J., Amin, A.
PLoS One, 2022/12
Free full text
447

Die Geschichte der Osteopathie in Deutschland
(The history of osteopathy in Germany)
Engel, M.
Osteopathische Medizin, 2022/12
448

Wirksamkeit der osteopathischen Behandlung bei pädiatrischen Beschwerden: Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manipulative treatment in pediatric complaints: A systematic review)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2022/12
Free full text
449

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 2)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 2))
Klemm, S., Spiertz, M., Asche, M.
Osteopathische Medizin, 2022/12
450

Osteopathie als personenzentrierte und integrierende Behandlungsmethode (Teil 2)
(Osteopathy as a person-centered and integrative treatment method (Part 2))
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/12
451

Osteopathische Geriatrie. Teil 2: Behandlung - Prinzipien und Methoden
(Osteopathic geriatrics. Part 2: Treatment - Principles and methods)
Mayer, J., Heller, R.
Osteopathische Medizin, 2022/12
452

The Role of Osteopathic Manipulative Medicine in the Rehabilitation of a Competitive Dancer after a Major Abdominal Surgery
Berenbeim, G., Figueroa, J.
The AAO Journal, 2022/12
Free full text
453

D.O.-Thesen im klinischen Bereich. Das neue Konzept der Akademie für Osteopathie AFO)
(D.O. Theses in the clinical area: The new concept of the Academy of Osteopathy (AFO))
Schwerla, F.
Osteopathische Medizin, 2022/12
454

ObiH – Osteopathie bei infantiler Haltungs asymmetrie und Plagiozephalie (Teil 1)
(ObiH - Osteopathy for infantile postural asymmetry and plagiocephaly (Part 1))
Spiertz, M., Asche, M., Klemm, S.
Osteopathische Medizin, 2022/12
455

Effects of osteopathic manipulative treatment associated with pain education and clinical hypnosis in individuals with chronic low back pain: study protocol for a randomized sham-controlled clinical trial
Luchesi, G. L. S., da Silva, A. K. F., Amaral, O. H. B., de Paula, V. C. G., Jassi, F. J.
Trials, 2022/12
Free full text
456

Модель фасциальных дисторсий (FDM) Стивена Типальдоса с позиций современных исследований и терапевтических концепций
(Fascial Distortion Model (FDM) by Stephen Typaldos from the modern research and therapeutic concepts point of view)
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. E., Agasarov, L. G.
Russian Osteopathic Journal, 2022/12
457

Исследование возможности включения остеопатической коррекции в состав комплексной терапии синдрома тазовой боли у женщин в позднем послеродовом периоде
(Study of the possibility of osteopathic correction inclusion in the complex therapy of pelvic pain syndrome in women at the late postpartum period)
Chumakova, I. B., Nasibullina, R. N., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/12
458

Обоснование использования остеопатической коррекции в комплексном лечении пациентов с плечелопаточным болевым синдромом
(Substantiation of the possibility of using osteopathic correction in the complex treatment of patients with shoulder-shoulder pain syndrome)
Emelyanova, C. K., Zolkova, O. V., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
459

Использование аутоиммунологических показателей для оценки результатов остеопатической коррекции: пилотное исследование
(The use of autoimmunological parameters to evaluate the results of osteopathic correction: pilot study)
Ikhlef, A., Potekhina, Y. P., Tregubova, E. S., Kurbatov, O. I., Pukhalenko, A. I.
Russian Osteopathic Journal, 2022/12
460

Инфракрасная термография в исследовании результатов остеопатической коррекции у пациентов с ампутационными дефектами нижних конечностей
(Application of infrared thermography in the study of the osteopathic correction results in patients with amputation defects of the lower extremities)
Kolyshnitsyn, N. Y., Mokhov, D. E., Smirnova, L. M., Fogt, E. V., Ermolenko, T. V.
Russian Osteopathic Journal, 2022/12
461

Возможности применения остеопатической коррекции у подростков с варикоцеле: пилотное исследование
(The possibilities of osteopathic correction using in adolescents with varicocele: a pilot study)
Kutsebo, Y. V., Shchuchkina, E. A., Kozlova, N. S.
Russian Osteopathic Journal, 2022/12
462

Остеопатическая коррекция в составе комплексного лечения дисфункции височно-нижнечелюстного сустава
(Osteopathic correction as part of the complex treatment of temporomandibular disorder)
Nesterov, A. M., Tsymbalov, E. E., Nikulina, M. A., Kantsepolsky, A. N.
Russian Osteopathic Journal, 2022/12
463

Эффекты остеопатической коррекции и возможности их исследования
(Effects of osteopathic correction and the possibility of their study)
Potekhina, Y. P., Tregubova, E. S., Mokhov, D. E.
Russian Osteopathic Journal, 2022/12
464

Остеопатическое лечение цервикалгии у врачей-стоматологов, испытывающих продолжительные профессиональные перегрузки
(Osteopathic treatment of cervicalgia in dentists experiencing prolonged professional overloads)
Usupbekova, B. S., Mombekova, S. A.
Russian Osteopathic Journal, 2022/12
465

Epiploic Appendagitis Mimicking Acute Appendicitis: An Osteopathic Case Report
Chin, J., Oseguera, B., Hon, K., Lomiguen, C. M., McBride, T.
Cureus, 2022/12
Free full text
466

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N., Eddy, A. J.
Journal of osteopathic medicine, 2022/12
Free full text
467

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text
468

Pain and functional recovery from chronic low back pain over 12 months: implications for osteopathic medicine
Licciardone, J. C., Pandya, V.
Journal of Osteopathic Medicine, 2022/12
Free full text
469

A Case Study Examining Women in Leadership at a College of Osteopathic Medicine
Kelley, S.
Unpublished Dissertation, 2022/12
470

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12
471

The effects of osteopathic manipulative treatment on pain and disability in patients with chronic neck pain: A single-blinded randomized controlled trial
Cholewicki, J., Popovich, J. M., Jr., Reeves, N. P., DeStefano, L. A., Rowan, J. J., Francisco, T. J., Prokop, L. L., Zatkin, M. A., Lee, A. S., Sikorskii, A., Pathak, P. K., Choi, J., Radcliffe, C. J., Ramadan
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/12
472

Quality of Care: An Assessment of the Contributions of Osteopathic Medicine
Chila, A. G.
The AAO Journal, 2022/12
Free full text
473

The Touch Taboo: Origins for the Prohibition of Touch in Psychiatry and a Rational Osteopathic Approach
Huzij, T.
The AAO Journal, 2022/12
Free full text
474

Preliminary Results from a Randomized Controlled Trial on the Efficacy of Osteopathic Manipulative Medicine in Recovery from Concussions
Benedict, A. B., Torretta, C., Cholewicki, J., DeStefano, L. A., Fitton, N., Saffarian, M., Popovich, J. M., Zatkin, M., Lee, A., Sikorskii, A., Leslie, L., Shiver, Z.
Journal of Osteopathic Medicine, 2022/12
475

Effects of Osteopathic Manipulative Treatment on Primary Dysmenorrhea
Companion, N., Ahmed, E., Keys, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
476

The Use of Osteopathic Manipulative Treatment (OMT) in the Management of Patients With Post-COVID Symptoms
Foss, V., Kaur, J., Stoukides, G., Yao, S. C.
Journal of Osteopathic Medicine, 2022/12
477

Thomas L. Northup Lecture: Integrating Osteopathic Principles into Patient Care: An Approach for All Specialties
Snider, K.
The AAO Journal, 2022/12
Free full text
478

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12
479

A Feasibility Study to Assess OMT for NAS
Householder, L., Glynn, B., Wadman, H., Hoffmann, K.
Journal of Osteopathic Medicine, 2022/12
480

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12
481

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12
482

Use of Osteopathic Manipulative Medicine in Treating Migraines
Lund, M., Pan, Y., Burns-Martin, J., Fleming, R. K., Xie, J. Y.
Journal of Osteopathic Medicine, 2022/12
483

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12
484

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12
485

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12
486

Impact of Osteopathic Manipulative Techniques on the Management of Dizziness Caused by Neuro-Otologic Disorders: Systemic Review and Meta-Analysis
Senger, B., Rehman, Y., Snider, K. T., Kirsch, J., Wang, M. Y.F., Johnston, R., Bingham, J., Ferguson, H., Swogger, S.
Journal of Osteopathic Medicine, 2022/12
487

Osteopathic Manipulative Treatment Efficacy in Mean HIT-6 Score Reduction in Tension-Type Headaches: A Meta-Analysis
Tran, E., Thomas, C., Zheng, T., Thalody, A., Winegar, A., Torelli, V., Wu, S. S.
Journal of Osteopathic Medicine, 2022/12
488

Augmentation of Immune Response to COVID-19 mRNA Vaccination Through Osteopathic Manipulative Treatment
Lee, E., Comer, A., Martinez, E., Crone, P., Loveless, B., Fuchs, S., Szurmant, H., Zammuto, J., Hostoffer, R., Sanchez, J.
Journal of Osteopathic Medicine, 2022/12
Free full text
489

Diagnosis and management of headache disorders in osteopathic practice: A qualitative study
Tripodi, N., Cordina, J., Jaffre, D., Mason, K., McMahon, G., Xeureb-Graham, B., Yanovsky, R., Wospil, R.
International Journal of Osteopathic Medicine, 2022/12
490

Manual therapy as a management approach for gastroesophageal reflux disease: A systematic review
Brendon dos Santos, C., Artioli, D. P., Bertolinie, G. R. F.
International Journal of Osteopathic Medicine, 2022/12
491

An exploration of the clinical reasoning used by registered osteopaths in their choice of therapeutic approach
Clifford, A., Segal, A., Guterres, A., Orrock, P. J.
International Journal of Osteopathic Medicine, 2022/12
492

Evocations of Osteopathy's founder and questions for contemporary osteopathic professional identity: A thematic analysis
Skinner, D., Esber, T., Walkowski, S.
International Journal of Osteopathic Medicine, 2022/12
493

Preliminary Effects of Osteopathic Manipulative Medicine on Reactive Oxygen Species in Parkinson’s Disease: A Randomized Controlled Pilot Study
Docherty, J., Leheste, J. R., Mancini, J, Yao, S.
Cureus, 2022/11
Free full text
494

The Austrian Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
van Dun, P. L. S., Arcuri, L., Verbeeck, J., Esteves, J. E., Cerritelli, F.
PLoS One, 2022/11
Free full text
495

Physiotherapists and Osteopaths' Attitudes: Training in Management of Temporomandibular Disorders
Saran, S., Saccomanno, S., Petricca, M. T., Carganico, A., Bocchieri, S., Mastrapasqua, R. F., Caramaschi, E., Levrini, L.
Dentistry Journal, 2022/11
Free full text
496

Le toucher en ostéopathie, une ouverture au dialogue et à la relation.
(Touch in osteopathy, an opening to dialogue and relationship)
Beaulieu, A.
Soins Pédiatrie/Puériculture, 2022/11
497

The effectiveness of visceral osteopathy in pain, disability, and physical function in patients with low-back pain. A systematic review and meta-analysis
Ceballos-Laita, L., Mingo-Gómez, M. T., Medrano-de-la-Fuente, R., Hernando-Garijo, I., Jiménez-Del-Barrio, S.
Explore (NY), 2022/11
498

Osteopathic Manipulative Medicine for Chronic Pain in the Setting of Cerebral Palsy
Dixon, D. S., Elwert, N. C., McDermott, G. A.
PM&R: The Journal of Injury, Function and Rehabilitation, 2022/11
499

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2022/11
Free full text
500

A Systematic Review on Spinal Asymmetries in Case Studies of Unilateral Nephroptosis from a Viscerosomatic Point of View
Oliva-Pascual-Vaca, Á, Castillo-Cañuelo, M. J., Oliva-Pascual-Vaca, J., Pérez-Montalbán, M., Ordonez, F. J., Martínez-Fernández, J. A.
Healthcare, 2022/11
Free full text
501

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11
502

Osteopathy: effectiveness and safety for musculoskeletal pain and overview of training and quality requirements. AIHTA Project Report No.: 144 2022
Gassner, L., Hofer, V.
HTA Austria – Austrian Institute for Health Technology Assessment GmbH, 2022/11
Free full text
503

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11
504

Model-Base Estimation of Non-Invasive Ventilation Weaning of Preterm Infants Exposed to Osteopathic Manipulative Treatment: A Propensity-Score-Matched Cohort Study
Tarantino, A. G., Vismara, L., Buffone, F., Bianchi, G., Bergna, A., Vanoni, M., Tabbi, C., Bresesti, I., Agosti, M.
Healthcare, 2022/11
Free full text
505

A Randomized Controlled Trial of Osteopathic Manipulative Therapy to Reduce Cranial Asymmetries in Young Infants with Nonsynostotic Plagiocephaly
Bagagiolo, D., Priolo, C. G., Favre, E. M., Pangallo, A., Didio, A., Sbarbaro, M., Borro, T., Daccò, S., Manzoni, P., Farina, D.
American Journal of Perinatology, 2022/11
506

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text
507

The Profile of Belgian Osteopaths: A Cross-Sectional Survey
van Dun, P. L. S., Verbeeck, J., Arcuri, L., Esteves, J. E., Cerritelli, F.
Healthcare, 2022/10
Free full text
508

Osteopathy in the Cranial Field as a Method to Enhance Brain Injury Recovery: A Preliminary Study
Dickerson, M., Murphy, S., Hyppolite, N., Brolinson, P. G., VandeVord, P.
Neurotrauma Reports, 2022/10
Free full text
509

The Benefits of Integrative Medicine in the Management of Chronic Pain: A Review
Trivedi, H., Avrit, T. A., Chan, L., Burchette, M., Rathore, R.
Cureus, 2022/10
Free full text
510

Effect of osteopathic techniques on human resting muscle tone in healthy subjects using myotonometry: a factorial randomized trial
Bohlen, L., Schwarze, J., Richter, J., Gietl, B., Lazarov, C., Kopyakova, A., Brandl, A., Schmidt, T.
Scientific Reports, 2022/10
Free full text
511

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of osteopathic medicine, 2022/10
Free full text
512

Postoperative Osteopathic Manipulative Treatment in Children with Esophageal Atresia: Potential Benefits on the Anthropometric Parameters
Manzotti, A., Alati, A., Galli, M., Cerritelli, F., Leva, C., Alberti, A., Stizzoli, A., Costanzo, S., Canonica, C. P. M., Destro, F., Zuccotti, G., Calcaterra, V., Pelizzo, G.
Pediatric Reports, 2022/10
513

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/10
514

Osteopathie in relatie tot menstruatieklachten bij een patiënte die lijdt aan endometriose en adenomyose. Een casestudie
(Osteopathy in relation to menstrual complaints in a patient who is suffering from endometriosis and adenomyosis. A case study)
den Braver- Scherpenzeel, M. R.
unpublished D.O. thesis, 2022/10
Free full text
515

Effectiveness of cranial osteopathy therapy on nociception in equine back as evaluated by pressure algometry
Vokietytė-Vilėniškė, G., Nagreckienė, S., Duliebaitė, I., Žilaitis, V.
Acta Veterinaria Brno, 2022/10
Free full text
516

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
517

Chronischer Reizhusten in der osteopathischen Praxis
(Chronic dry cough in osteopathic practice)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
518

Traumasensible Vorgehensweise in der osteopathischen Praxis
(Trauma-sensitive approach in osteopathic practice)
Heuer, I., Tann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
519

Die Rolle der Osteopathie im Geburtsprozess – eine qualitative Studie
(The role of osteopathy in the birth process - a qualitative study)
Janisz, M., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
520

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie – Teil 2
(Positional plagiocephaly: The role of brainstem sensitization in the pathophysiology of positional plagiocephaly - Part 2)
Zweedijk, R.
Osteopathische Medizin, 2022/09
521

A Thematic Analysis of Osteopathic Physicians' Identities and Experiences in North American Professional Sports
Blacha, K., Cade, A., Russell, T., Skinner, D.
Open Access Journal of Sports Medicine, 2022/09
Free full text
522

Andrew Taylor Still lebt: Ent-wicklungslinien der osteopathischen Forschung und Lehre
(Andrew Taylor Still is alive: Lines of development of osteopathic research and teaching)
Levin, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
523

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text
524

Zirkumventrikuläre Organe und phänodynamische Osteopathie
(Circumventricular organs and phenodynamic osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09
525

Остеопатический статус лиц, перенесших новую коронавирусную инфекцию, через 3–6 мес после заболевания
(Osteopathic status in people who have had a new coronavirus infection, 3–6 months after the disease)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2022/09
526

Обоснование использования остеопатической коррекции при плановой подготовке больных к общей анестезии с интубацией трахеи
(Justification of the use of osteopathic correction in the planned preparation of patients for general anesthesia with tracheal intubation)
Kurnoskin, V. L., Kurbatov, O. I.
Russian Osteopathic Journal, 2022/09
527

Исследование эффективности остеопатической коррекции вальгусной деформации I пальца стопы I–II степени
(Study of the effectiveness of osteopathic correction of the Ist toe valgus deformity of the I–II degree)
Minakova, A. L., Ustinov, A. V.
Russian Osteopathic Journal, 2022/09
528

Современные подходы к остеопатической диагностике, её теоретические и практические основы
(Modern approaches to osteopathic diagnostics, its theoretical and practical foundations)
Mokhov, D. E., Potekhina, Y. P., Gurichev, A. A.
Russian Osteopathic Journal, 2022/09
529

Влияние остеопатической коррекции на качество жизни беременных
(The impact of osteopathic correction on the life quality of pregnant women)
Nenashkina, E. N.
Russian Osteopathic Journal, 2022/09
530

Мультидисциплинарный подход при лечении хронической головной боли напряжения на фоне COVID-19
(Multidisciplinary approach in the treatment of chronic tension headache on the background of COVID-19)
Novikov, Y. O., Akopian, A. P., Amigues, F. A.
Russian Osteopathic Journal, 2022/09
531

Влияние остеопатической техники сбалансированного лигаментозного натяжения (BLT) на LV при люмбалгии
(Effects of Balanced Ligamentous Osteopathic Technique over LV in low back pain)
Schenone, L. E.
Russian Osteopathic Journal, 2022/09
532

Обоснование экономической эффективности авторской мануальной методики вправления вывиха плеча
(Substantiation of the economic efficiency of the author′s manual repositioning method of the shoulder joint)
Slabospitskii, M. A., Mokhov, D. E., Limarev, V. V., Tkachenko, P. V., Tkachenko, A. N., Mansurov, D. S., Khaydarov, V. M.
Russian Osteopathic Journal, 2022/09
533

Case Report on Visceral Manipulation in Adolescent Idiopathic Scoliosis
Chahab, M., Donnet, P., Hernandez, D.
International Journal of Therapeutic Massage and Bodywork, 2022/09
534

Osteopathic Medical Students’ Subjective Preparedness for LGBTQ+ Patient Care and Influencing Factors: A Multi-Institutional Survey Study
Morimoto, K., Uy, J. C., Blair, L., Barab, H., Wu, W., Oosterbaan, C., Ozdowski, L., Guenther, E.
The AAO Journal, 2022/09
Free full text
535

Interaktion zwischen Gehirn und Herz: Modifikation der Interaktion zwischen Gehirn und Herz bei chronischen Schmerzen durch osteopathische Behandlung
(Interaction between brain and heart: modification of brain-heart interaction in chronic pain by osteopathic treatment)
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Ferretti, A.
Osteopathische Medizin, 2022/09
536

OSTLIB – Die osteopathische Datenbank
(OSTLIB - The osteopathic database)
Franke, H.
Osteopathische Medizin, 2022/09
537

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09
538

Osteopathie als personenzentrierte und integrierende Behandlungsmethode – Teil 1
(Osteopathy as a person-centered and integrative treatment method - Part 1)
Liem, T., Lunghi, C.
Osteopathische Medizin, 2022/09
539

Osteopathische Medizin – Wo bleibt der Beweis?
(Osteopathic medicine - Where is the evidence?)
Schleusener, R.
Osteopathische Medizin, 2022/09
540

Osteopathische Behandlung von Patienten mit episodischer Migräne. Prospektive, multizentrische, kontrollierte randomisierte Studie
(Osteopathic treatment of patients with episodic migraine. Prospective, multicenter, controlled randomized study)
Stolzmann, K., Ziller, M., Britz, I., de Braganca, L., Thielen, F.
Unpublished D.O. thesis, 2022/09
541

Die Behandlung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr. Eine systematische Literaturrecherche
(The treatment of idiopathic asymmetry and positional plagiocephaly in infants in the first year of life. A systematic literature review)
Daake, B.
Unpublished D.O. thesis, 2022/09
542

Osteopathische Behandlung von Frauen mit Beckengürtelschmerz post partum (PPGP). Randomisierte kontrollierte Studie
(To evaluate the effectiveness of custom tailored osteopathic treatment in women suffering from pelvic girdle pain after childbirth.)
Richterink, J., Bruns, A.
Unpublished D.O. thesis, 2022/09
543

Lassen sich durch osteopathische Behandlungen von Patienten mit gastroösophagealem Reflux zusätzlich zur medikamentösen Standardbehandlung die Symptome verbessern? Randomisierte kontrollierte Studie
(Osteopathic treatment in addition to medical standard therapy in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial.)
Dannmeyer, A., Severin, F., Stisser, C.
Unpublished D.O. thesis, 2022/09
544

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text
545

Comparing In-person vs. Live-streamed Osteopathic Manual Medicine Lab Instruction
Ellis, M., Finneran, K., Jie, C., Lewis, D.
The AAO Journal, 2022/09
Free full text
546

Osteopathic Manipulative Treatment for Optic Pathway Glioma
Gordon, S., Hagopian, S.
The AAO Journal, 2022/09
Free full text
547

Treatment of infant colic with craniosacral therapy. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Todri, J., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2022/09
Free full text
548

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text
549

Effectiveness of Osteopathic Manipulation Treatment in the Rehabilitation of Post-External Immobilization for a Supracondylar Fracture of the Distal Humerus: A Case Report
Paiva, A., Bruntmyer, H. C.
The AAO Journal, 2022/09
Free full text
550

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text
551

Thoracic outlet syndrome due to first rib subluxation in a 69-year-old woman
Deveze, E., Daligault, M., Ammi, M., Picquet, J.
Annals of Vascular Surgery - Brief Reports and Innovations, 2022/09
Free full text
552

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text
553

Effectiveness of osteopathic interventions in patients with non-specific neck pain: A systematic review and meta-analysis
Dal Farra, F., Buffone, F., Risio, R. G., Tarantino, A. G., Vismara, L., Bergna, A.
Complementary Therapies in Clinical Practice, 2022/08
554

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text
555

“What you feel under your hands“: exploring professionals' perspective of somatic dysfunction in osteopathic clinical practice-a qualitative study
Arcuri, L., Consorti, G., Tramontano, M., Petracca, M., Esteves, J. E., Lunghi, C.
Chiropractic & Manual Therapies, 2022/08
Free full text
556

Osteopathic Treatment for Gastrointestinal Disorders in Term and Preterm Infants: A Systematic Review and Meta-Analysis
Buffone, F., Monacis, D., Tarantino, A. G., Farra, F., Bergna, A., Agosti, M., Vismara, L.
Healthcare, 2022/08
Free full text
557

The Role of Osteopathic Care in Gynaecology and Obstetrics: An Updated Systematic Review
Ruffini, N., D', Alessandro, G., Pimpinella, A., Galli, M., Galeotti, T., Cerritelli, F., Tramontano, M.
Healthcare, 2022/08
Free full text
558

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08
559

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/08
Free full text
560

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/08
Free full text
561

The Function of Osteopathic Medicine in the Treatment of Adhesive Capsulitis
Tafler, L., Santanello, A., Lysakova, Y.
Cureus, 2022/08
Free full text
562

Effectiveness of Osteopathic Treatment on the Spinal Column as Measured by the Spinal Mouse®: A Case Series
Colati, R., Pagano, A.
Cureus, 2022/08
Free full text
563

Osteopathic Manipulative Treatment and the Management of Headaches: A Scoping Review
Jara Silva, C. E., Joseph, A. M., Khatib, M., Knafo, J., Karas, M., Krupa, K., Rivera, B., Macia, A., Madhu, B., McMillan, M., Burtch, J., Quinonez, J., Albert, T., Khanna, D.
Cureus, 2022/08
Free full text
564

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08
565

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07
566

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text
567

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text
568

Reported completion of the USMLE Step 1 and match outcomes among senior osteopathic students in 2020
Nikolla, D. A., Stratford, C. V., Bowers, K. M.
Journal of Osteopathic Medicine, 2022/07
Free full text
569

Osteopathic Manipulative Treatment for Pediatric Conditions: An Update of Systematic Review and Meta-Analysis
Posadzki, P., Kyaw, B. M., Dziedzic, A., Ernst, E.
Journal of Clinical Medicine, 2022/07
Free full text
570

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07
571

The utilisation and attitudes to patient reported outcome measures by Australian osteopaths: A cross sectional study
Fleischmann, M., Fryer, G
International Journal of Osteopathic Medicine, 2022/07
572

Osteopathic practice in the United Kingdom: A retrospective analysis of practice data
Plunkett, A., Fawkes, C., Carnes, D.
PLoS One, 2022/07
Free full text
573

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07
574

Successful Osteopathic Manipulative Treatment of Foot Drop
Tafler, L., Katz, V., Kolesnikov, V., Singh, R.
Cureus, 2022/07
Free full text
575

Reduction and Resolution of a Hiatal Hernia Using Osteopathic Manipulative Treatment: A Case Report
Volokitin, M., Song, A., Peck, M. T., Milani, S.
Cureus, 2022/07
Free full text
576

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07
577

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07
578

Acupuncture and Osteopathic Medicine for Atopic Dermatitis – a Three-armed Randomized Controlled Explorative Clinical Trial
Rotter, G., Ahnert, M. W., Geue, A. V., Icke, K., Binting, S., Tissen-Diabaté, T., Roll, S., Ortiz, M., Reinhold, T., Kass, B., Staab, D., Pfab, F., Willich, S. N., Brinkhaus, B.
Clinical and Experimental Dermatology, 2022/07
Free full text
579

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/07
580

Resolution of rosacea-associated persistent facial edema with osteopathic manipulative treatment
Jay, R., Rodger, J.
JAAD Case Reports, 2022/07
Free full text
581

Response to “Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects“
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2022/07
Free full text
582

Wirkung osteopathischer Behandlungen im 1. Lebensjahr
(Effect of osteopathic treatments in the 1st year of life)
Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
583

Im Gespräch mit … Christian Hartmann
(In dialog with ... Christian Hartmann)
Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
584

Non-pharmacological and non-surgical treatment of pain in children and adolescents with cerebral palsy: A scoping review
Flyckt, N., Wong, C., Michelsen, J. S.
Journal of Pediatric Rehabilitation Medicine, 2022/07
585

Die Osteopathie aus Sicht der ärztlichen Osteopathen – eine qualitative Interviewstudie
(Osteopathy from the point of view of medical osteopaths - a qualitative interview study)
Waubert de Puiseau, A., Belz, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07
586

Técnicas osteopáticas para la liberación emocional: Monografía
(Osteopathic Techniques for Emotional Release: Monograph)
Vallecia Barragán, L. J.
Unpublished MSc thesis, 2022/07
Free full text
587

The Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ) - A content validity study
Thomson, O. P., Vaughan, B., Sampath, K., Draper-Rodi, J., Fleischmann, M., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/07
588

Osteopathic Manipulative Treatment for Refractory Gastroesophageal Reflux Disease (GERD)
Yassin, K., Mutter, C., Waters, H., Mehra, R.
The AAO Journal, 2022/06
Free full text
589

Holistic osteopathic approach to the care of veterans with post-traumatic stress disorder: Case report
Lovy, A., Berkowitz, M. R.
The AAO Journal, 2022/06
Free full text
590

The Effect of Osteopathic Manipulative Treatment in Pregnancy on Labor Duration: A Meta-Analysis
Zak, A., Streeter, E., Tran, N., Wales, A., Yep, M., Rowane, M.
The AAO Journal, 2022/06
Free full text
591

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text
592

Lagerungsplagiozephalie: Die Rolle der Hirnstammsensibilisierung in der Pathophysiologie der Lagerungsplagiozephalie –Teil 1
(Positional plagiocephaly: the role of brainstem sensitization in the pathophysiology of positional plagiocephaly -Part 1)
Zweedijk, R.
Osteopathische Medizin, 2022/06
593

Reply to Kudus, A.L. Comment on “Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845“
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2022/06
Free full text
594

Chronic cough as seen by allergy specialists: An internet survey of providers in a large nation-wide practice
Prenner, Bruce M., Topp, Robert, McCan, William A.
Allergy and Asthma Proceedings, 2022/06
595

Остеопатическое лечение новорожденных и грудных младенцев: эффективность и связанные с ним риски (систематический обзор англоязычной и франкоязычной литературы)
(Osteopathic treatment of newborns and infants: efficiency and associated risks (a systematic review of literature in English and in French))
Maroye, L., Klein, P., Dethier, C., Dugailly, P.M.
Russian Osteopathic Journal, 2022/06
596

No cuts, no buts: Satisfaction of first-year medical students with a hybrid prosection-based model for learning gross anatomy during the Covid-19 pandemic
Schurr, A. F., Burg, B. J., Dickinson, E., Granatosky, M. C.
Anatomical Sciences Education, 2022/06
597

Применение остеопатической коррекции в комплексной реабилитации пациентов с острым нарушением мозгового кровообращения
(The use of osteopathic correction in the complex rehabilitation of patients with acute cerebrovascular accident)
Belash, V. O., Gritsay, E. O., Musina, T. S.
Russian Osteopathic Journal, 2022/06
598

Остеопатический статус родильниц после спинномозговой анестезии и возможности его коррекции
(Osteopathic status of maternity patients after spinal anesthesia and the possibility of its correction)
Bobrova, A. S., Shkryabina, A. M., Khatkevich, A. K., Nenashkina, E. N.
Russian Osteopathic Journal, 2022/06
599

Comment on Brandl et al. Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial. Life 2021, 11, 845
Kudus, A. L.
Life (Basel), 2022/06
Free full text
600

Osteopathy and physiotherapy compared to physiotherapy alone on fatigue in long COVID: Study protocol for a pragmatic randomized controlled superiority trial
Certain Curi, A. C., Antunes Ferreira, A. P., Calazans Nogueira, L. A., Mello Meziat Filho, N. A., de Sá Ferreira, A.
International Journal of Osteopathic Medicine, 2022/06
Free full text
601

Исследование цервико-оральных синергий у пациентов, проходящих ортодонтическое лечение
(Study of cervico-oral synergies in patients undergoing orthodontic treatment)
Milutka, Y. A., Basieva, E. V., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2022/06
602

A Proposal for the Use of Craniosacral Therapy in Firefighter Cadets to Decrease Cortisol Levels and Improve Postural Stability—A Randomized Trial
Wójcik, M., Siatkowski, I., Żekanowska, E.
Journal of Men's Health, 2022/06
Free full text
603

Остеопатия — новое направление медицины (современная концепция остеопатии)
(Osteopathy — a new direction of medicine (modern concept of Osteopathy))
Mokhov, D. E., Potekhina, Y. P., Tregubova, E. S., Gurichev, A. A.
Russian Osteopathic Journal, 2022/06
604

Возможность применения остеопатических методов коррекции в терапии лицевой боли
(The possibility of osteopathic correction methods in the treatment of facial pain)
Popov, A. S.
Russian Osteopathic Journal, 2022/06
605

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text
606

Deutschsprachige Osteopathieliteratur: Eine Übersicht von der Entdeckung der Osteopathie bis zum Jahr 2000
(German-language osteopathic literature: a survey from the discovery of osteopathy to the year 2000)
Engel, M.
Osteopathische Medizin, 2022/06
607

Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2021: Der INIOST-Studienreport 2021
(Overview of osteopathic studies published worldwide in 2021: The INIOST Study Report 2021.)
Franke, H.
Osteopathische Medizin, 2022/06
608

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06
609

Durch dissipative Strukturierung zu Kohärenzgefühl und Gesundsein?
(Through dissipative structuring to a sense of coherence and being healthy?)
Pelz, H.
Osteopathische Medizin, 2022/06
610

Die vier vegetativen Nervensysteme
(The four autonomic nervous systems)
Plathner, M.
Osteopathische Medizin, 2022/06
611

Osteopathic Evaluation and Positional Plagiocephaly: A Descriptive Study on a Population of Children with ASD
Di Renzo, M., Laurenti, A., Di Castelbianco, F. B., Vanadia, E., Petrillo, M., D’Errico, S., Ferrara, R., Racinaro, L., Rea, M.
American Journal of Pediatrics, 2022/06
Free full text
612

Are We There Yet? Doctor of Osteopathic Medicine Students and the Urology Match
McCormick, M. E., Seideman, C. A.
The Journal of Urology, 2022/06
613

Comparison of the Effect of Osteopathic Manipulations and Exercises on the Myoelectric Activity of the Pelvic Floor: A Randomized Controlled Trial
Arcanjo, G. N., Pires, Jlvr, Jacinto, M. E. M., Colares, J. M., Belo, L. M. C., Lima, P. O. P., Vilaça-Alves, J.
Journal of Chiropractic Medicine, 2022/06
614

Adjunctive osteopathic therapy for hospitalized COVID-19 patients: A feasibility-oriented chart review study with matched controls
Lennon, R. P., Dong, H., Zgierska, A. E., Demetriou, T., Croad, J., Livelsberger, C., Hodge, L., Mendez-Miller, M., Darby, A., Rabago, D.
International Journal of Osteopathic Medicine, 2022/06
615

Tongue stretching: technique and clinical proposal
Buscemi, A., Coco, M., Rapisarda, A., Frazzetto, G., Di Rosa, D., Feo, S., Piluso, M., Presente, L. P., Campisi, S. S., Desirò, P.
Journal of Complementary and Integrative Medicine, 2022/06
Free full text
616

The Portuguese osteopaths attitudes towards a biomechanical or biopsychosocial model in the approach of chronic low back pain – A cross-sectional questionnaire-based survey
Dinis, M., Silva, C., Cruz, R., Esteves, J., Nunes, A.
International Journal of Osteopathic Medicine, 2022/06
617

Effect of Physique on Medical Students’ Perceived Physical Ability to Perform Osteopathic Manipulative Treatment (OMT)
Than, S., Santos, L., Lin, X., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
618

Medical student research opportunities: a survey of osteopathic medical schools in the United States
Hamby, T., Wilson, D. P., Bui, P., Lowery, J., Basha, R.
Journal of Osteopathic Medicine, 2022/06
Free full text
619

The Successful Use of Osteopathic Manipulative Treatment (OMT) for Positional Plagiocephaly: Now He's an Ambi-turner!
Harris, Z., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
620

„Das philosophische Fundament Stills in die heutige Zeit überführen“
(“Bringing Still's philosophical foundation into the modern times.“)
Prediger, G., Buekens, J.
Osteopathische Medizin, 2022/06
621

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text
622

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text
623

Abnormal Foot Progression Angle Kinematics in Cervical Dystonia Improved After Osteopathic Manipulative Medicine: A Prospective Case Series
Mancini, J., Oliff, Z., Abu-Sbaih, R., Simone, J., LaRosa, A., Mody, S., Li, T. S., Leder, A.
Cureus, 2022/06
Free full text
624

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/06
625

Cranial osteopathic techniques and electroencephalogram (EEG) alpha power: a controlled crossover trial
Cella, M., Acella, E., Aquino, A., Pisa, V.
Journal of Osteopathic Medicine, 2022/06
Free full text
626

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text
627

Effects of Organ System Courses of the First Two Years of Medical School on the Performance of the Comprehensive Osteopathic Medical Licensing Examination of the United States (COMLEX-USA) Level 2-Cognitive Evaluation
McNeil, K., Mashhouri, V., Christensen, P., Wang, H., Zhong, Q.
Cureus, 2022/06
Free full text
628

A long COVID patient and their experience of osteopathic care: A case report
Monro, M.
International Journal of Osteopathic Medicine, 2022/06
629

Professional identity in osteopathy: A scoping review of peer-reviewed primary osteopathic research
Phillips, A. R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
630

Effectiveness of osteopathic manipulative treatment for pediatric conditions: A systematic review
Franke, H, Franke, J.D., Fryer, G.
Journal of Bodywork and Movement Therapies, 2022/06
631

Relevance of historical osteopathic principles and practices in contemporary care: Another perspective from traditional/complementary and alternative medicine
Vogel, S., Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2022/06
Free full text
632

An Osteopathic Manipulative Treatment (OMT) Evaluation and Treatment Protocol to Improve Gastrointestinal Function
Heineman, K.
The AAO Journal, 2022/06
Free full text
633

Исследование эффективности остеопатической коррекции пекталгического синдрома у студентов
(Study of the osteopathic correction effectiveness of pectalgic syndrome in students)
Valiullova, L. V., Gilmutdinova, G. R., Safiullina, A. A.
Russian Osteopathic Journal, 2022/06
634

Why I Became an FAAO and Why You Should As Well
Kessler, R.
The AAO Journal, 2022/06
Free full text
635

Сравнительный анализ остеопатической коррекции и стандартной комплексной реабилитации пациентов с посттравматическими контрактурами суставов верхней конечности
(Comparative analysis of osteopathic correction and standard comprehensive rehabilitation of patients with posttraumatic contractures of the upper limb joints)
Zamanov, A. R., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2022/06
636

Osteopathic Manipulation of Pelvic Floor Muscle Dysfunction Improves Chronic Lower Back Pain
Torres, J.
The AAO Journal, 2022/06
Free full text
637

Исследование потребительских ожиданий и требований к качеству услуг по остеопатии у родителей несовершеннолетних пациентов
(A study of consumer expectations and requirements for the quality of osteopathic services in parents of minor patients)
Vinitskaya, T. V.
Russian Osteopathic Journal, 2022/06
638

Response to Osteopathic Manipulative Treatment in a Patient with Amyotrophic Lateral Sclerosis: A Case Report
Bomani-Bailey, A., Xu, T., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
639

Variations in Average Cranial Rhythmic Impulse Rates
Crider, T., Grimm, J., Kozar, A., Tobey, A. H.
The AAO Journal, 2022/06
Free full text
640

An Osteopathic Approach to Secondary Enuresis and Encopresis: Recovering Autonomic Stability
Goodman, F., Ammons, R., Gebhardt, G., Largent, J.
The AAO Journal, 2022/06
Free full text
641

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
642

SCIWORA: A Pediatric Case
Masterson, C., Byrd, A., Gebhardt, G.
The AAO Journal, 2022/06
Free full text
643

The effect of longitudinal osteopathic experiences on family medicine resident confidence and utilization of osteopathic manipulative treatment
Matsushita, S., Lee, E., Pipitone, O., Vester, A.
The AAO Journal, 2022/06
Free full text
644

Nurturing the Breath of Life: A Retrospective Analysis of the Effect of Osteopathic Manipulative Treatment on Patients Ventilated for COVID-19
Murphy, S., Mercer, A., Ettlinger, H.
The AAO Journal, 2022/06
Free full text
645

A Randomized Pilot Study Comparing Bilirubin Levels of Newborns Treated with Osteopathic Manipulative Treatment (OMT) Versus Routine Newborn Care Alone
Stephenson, C. M., Fremarek, N., Lentz, A., Klene-Bowns, A., Boeve, M., Brinsky, K., Chatterley, L., Yarling, C., Caldwell, G., Grundwaldt, D.
The AAO Journal, 2022/06
Free full text
646

Osteopathic Manipulative Treatment plus Phototherapy in the Management of Neonatal Hyperbilirubinemia: A Case Report
Zylinski, B. L., Stephenson, C. M., Dean, A. L., Rajala, J. W., Miller, D. J.
The AAO Journal, 2022/06
Free full text
647

Picking Apples and Somatic Dysfunctions: A Case Study of Osteopathic Manipulative Treatment in the Farmworker Community
Ackerman, K., Gavin, K., Johnson, D.
The AAO Journal, 2022/06
648

The Effects of a Novel Virtual Reality Osteopathic Manipulative Medicine Program on First Year Practical Exam Scores
Ahmed, E., Jose, J., Stout, R., Yao, S. C.
The AAO Journal, 2022/06
Free full text
649

Utilizing Osteopathic Manipulative Techniques to Mitigate Fall Risk Among Hospitalized Elderly Patients: A Literature Review
Arshad, U., Baum, B., Carter, R., Gustowski, S.
The AAO Journal, 2022/06
Free full text
650

Upper Cross Syndrome and a Guarded Heart: Posture in a Case of Depression
Benzell, J. A., Abend, D., Bailey, J., Cooley, D., King Channell, M.
The AAO Journal, 2022/06
Free full text
651

Osteopathic Manipulative Treatment of Individual with Intractable Singultus
Bloch, R., Kempa, M., Lippert, J.
The AAO Journal, 2022/06
Free full text
652

SOAP Note Review: Evaluating Osteopathic Principles and Practice in Clinical Education
Budny, B., Gigliotti, D., Diggs, B., Fotopoulos, T., Johns, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
653

An Osteopathic Approach to Chronic Pelvic Pain
Cameron, D. L., Mainville, M., Wallace-Ross, J.
The AAO Journal, 2022/06
Free full text
654

Effects of Osteopathic Manipulative Treatment (OMT) on Anosmia and Ageusia in Post-COVID-19 Patient: A Case Report
Companion, N., Ventimiglia, M., Yao, S. C.
The AAO Journal, 2022/06
Free full text
655

An Uncommon Cause of Common Peroneal Nerve Paresthesia: The Effect of Osteopathic Manipulative Treatment on Ganglion Cyst-Induced Common Peroneal Nerve Paresthesia
Cortes, M., Shah, N., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
656

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text
657

Relief of Post-COVD-19 Burning Mouth Syndrome (BMS) with OMM- A case study
Frankini, E. L., Leder, A., Yao, S. C.
The AAO Journal, 2022/06
Free full text
658

Blended Learning: Evaluating the effectiveness of various instructional methods
Garo, J. A., Dasar, Y., Nichols, M., Goering, E., Blumer, J.
The AAO Journal, 2022/06
Free full text
659

A Guide for Transitioning Osteopathic Research from Medical School to Residency to Increase Research Productivity across Medical Training
Gober, C., Daly, E., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
660

Body-Mind-Spirit Connection as an Approach to Treatment of Spasmodic Torticollis
Haley, L., Clark, M., Litman, R., Heller, G.
The AAO Journal, 2022/06
Free full text
661

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
662

Osteopathic Manipulative Treatment may be a Cost-Effective Approach to Reducing Pain Associated with Acute Flare of Interstitial Cystitis
Hermann, S. J., Barnett, M. E., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
663

Effects of Osteopathic Manipulative Therapy on Temporomandibular Joint Disorders
Honeyman, J., Robke, B., Reed, G., Jacob, L., O'Donnell, M., Lynch, W. D., Moore, W.
The AAO Journal, 2022/06
Free full text
664

Out of Place: An Osteopathic Approach to Recurrent Shoulder Dislocations in an Ehlers Danlos Patient
Lambros, S., Tuyn, D., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
665

Effect of Medical School Experiences on Perceived Likelihood of Performing Osteopathic Manipulative Treatment (OMT) in Future Practice
Lin, X., Santos, L., Than, S., Terzella, M., Jung, M.K.
The AAO Journal, 2022/06
Free full text
666

Managing Muscle Rigidity: An Osteopathic Approach to the Treatment of Stiff Person Syndrome
Mainville, M., Cameron, D. L., Barry, P.
The AAO Journal, 2022/06
Free full text
667

Osteopathic Manipulative Treatment of the Deep Fascia for the Treatment of Chronic Trauma-induced Somatic Dysfunction
Nelson, C., Henderson, J., Kim, C., Le, B., Mintier, K.
The AAO Journal, 2022/06
Free full text
668

The Soft Tissue Clinic Experience (SCTE): A sustainable way for early medical students to develop patient interaction and manipulative treatment skills
Ouyang, Z., Murphy, R., Heinking, K. P., Henderson, K. K.
The AAO Journal, 2022/06
Free full text
669

An Osteopathic Approach to Childhood Scoliosis and Leg Length Inequality in a Pediatric Patient with Chiari I Malformation
Schultz, R., Baig, Y., Henderson, K. K., Heinking, K. P.
The AAO Journal, 2022/06
Free full text
670

Establishing OMT as a Key Treatment Modality in Injury Rehabilitation: Teres Major Tear
Shah, N., Cortes, M., Posey, A.
The AAO Journal, 2022/06
Free full text
671

Osteopathic Manipulative Therapy Effects on Prolonged Post-COVID Olfactory Dysfunction
Stenta, M. E., Bacon, C., Haile, Z. T., Walkowski, S. A.
The AAO Journal, 2022/06
Free full text
672

Novel Lymphatic Counterstrain (LC) in a Case of Low Ankle Sprain
Trinh, D., Henderson, J., Goering, E.
The AAO Journal, 2022/06
Free full text
673

Uncovering Trigger Points Masked by Lumbar Radiculopathy
Tuyn, D., Lambros, S., Sandhouse, M., Qureshi, Y.
The AAO Journal, 2022/06
Free full text
674

“Skateboard to the Head” A Case of Persistent Headaches Following Blunt Eye Trauma
Williams, D., Richie, C.
The AAO Journal, 2022/06
Free full text
675

Restricted Shoulder Range of Motion: A Neglected Component That May Surprise You
Williams, J., Biery, J. C. Jr.
The AAO Journal, 2022/06
Free full text
676

Effects of osteopathic manipulative treatment of the pivots on lower limb function in young professional football players
Thomas, E., Petrucci, M., Barretti, M., Messina, G., Cavallaro, A. R., Bianco, A.
Journal of Bodywork and Movement Therapies, 2022/05
677

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text
678

Das Karpaltunnelsyndrom in der Schwangerschaft aus osteopathischer Sicht
(Carpal tunnel syndrome in pregnancy from an osteopathic point of view)
Schneider-Milo, U.
Akupunktur Praxis, 2022/05
679

Complementary medicine visits by palliative care patients: a cross-sectional survey
Steel, Amie, Schloss, Janet, Diezel, Helene, Palmgren, Per J., Maret, Jean Baptiste, Filbet, Marilène
BMJ Supportive and Palliative Care, 2022/05
680

Reasons Office-Based Physicians in the United States Recommend Common Complementary Health Approaches to Patients: An Exploratory Study Using a National Survey
Stussman, B. J., Nahin, R. L., Barnes, P. M., Scott, R., Feinberg, T., Ward, B. W.
Journal of Integrative and Complementary Medicine, 2022/05
Free full text
681

Cross-Sectional Study of Osteopathic General Surgeons in University-Based General Surgery Departments
Khan, M. T., Patnaik, R., Wheeler, C., Ibrahim, M., Wolf, H., Baumgardner, K. C., Lovely, R. S.
Cureus, 2022/05
Free full text
682

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text
683

Advocacy for Change: An Osteopathic Review of Traumatic Brain Injury Among Combat Veterans
Pendlebury, G. A., Oro, P., Haynes, W., Byrnes, T. R., Keane, J., Goldstein, L.
Cureus, 2022/05
Free full text
684

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text
685

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text
686

The Importance of Pelvic and Leg Length Assessment in the Setting of Postpartum Lower Back Pain
Tafler, L., Wilson, D., Tafler, P.
Cureus, 2022/05
687

Obesity Stigma in Anatomy and Osteopathic Manipulative Medicine
Hall, S., Reynolds, A.
FASEB journal, 2022/05
Free full text
688

Effect of osteopathic manipulation of the sacroiliac joint vs electrotherapy on pain and functional disability in patients with low back pain: A pilot study
Rodríguez-Pastor, J. A., Caro-Puértolas, B., Caña-Pino, A., Sánchez-Preciado, A. M., Garrido-Ardila, E. M., Apolo-Arenas, M. D.
Journal of Back and Musculoskeletal Rehabilitation, 2022/05
689

Patient Perceptions of Osteopathic Manual Therapy (OMT) and Impact of OMT on Symptom Outcomes When Added to Standard Palliative Intervention
Terra, A., Derrick, J., Westfall, E., Genewick, J., Devetter, N., Flynn, M., Fischer, G.
Journal of Pain and Symptom Management, 2022/05
690

Association of sleep quality and chronification of musculoskeletal pain in an older adult: A case report
Westendorp, R., Thaker, V., Srbely, J.
International Journal of Osteopathic Medicine, 2022/05
691

Effect of visceral manipulation on menstrual complaints in women with polycystic ovarian syndrome
Yosri, M. M., Hamada, H. A., Yousef, A. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
692

Response to “Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine“
Marshall, S.
Journal of Osteopathic Medicine, 2022/05
Free full text
693

Assessing the United States' most frequently asked questions about osteopathic medicine, osteopathic education, and osteopathic manipulative treatment
Sajjadi, N. B., Ottwell, R., Shepard, S., Bray, N., Dyer, R., Wilson, J., Vassar, M., Hartwell, M.
Journal of Osteopathic Medicine, 2022/05
Free full text
694

Effects of osteopathic manipulative treatment vs. osteopathic cranial manipulative medicine on Parkinsonian gait
Terrell, Z. T., Moudy, S. C., Hensel, K. L., Patterson, R. M.
Journal of Osteopathic Medicine, 2022/05
Free full text
695

Interrater Reliabilität des 3 Phasen Tests
(Interrater reliability of the 3 phases test)
Grömer, M.
Unpublished MSc thesis, 2022/05
696

Die Interrater-Reliabilität der Routineuntersuchung cranialer Dysfunktionen der vier Schädelzonen
(The Interrater-Reliability of the routine examination of cranial dysfunctions based on four skull zones)
Götz, T.
Unpublished MSc thesis, 2022/05
Free full text
697

An updated brief overview on post-traumatic headache and a systematic review of the non-pharmacological interventions for its management
Argyriou, A. A., Mitsikostas, D. D., Mantovani, E., Litsardopoulos, P., Panagiotopoulos, V., Tamburin, S.
Expert Review of Neurotherapeutics, 2022/04
Free full text
698

Efficacy and safety of osteopathic manipulative treatment: an overview of systematic reviews
Bagagiolo, D., Rosa, D., Borrelli, F.
BMJ Open, 2022/04
Free full text
699

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/04
Free full text
700

Exploring the Effects of Standardized Soft Tissue Mobilization on the Viscoelastic Properties, Pressure Pain Thresholds, and Tactile Pressure Thresholds of the Cesarean Section Scar
Gilbert, I., Gaudreault, N., Gaboury, I.
Journal of Integrative and Complementary Medicine, 2022/04
Free full text
701

Osteopathy as a complementary/alternative medicine for breast cancer: a Canadian case study and comprehensive review
Fortin, J., Beaupré, A., Thamar Louis, L. A., Roy, C.A., Bourque, M. A., Cappeliez, S., Fadhlaoui, A.
Breast Cancer Management, 2022/04
Free full text
702

Incidence Rate of Somatic Dysfunction in Previously Undiagnosed Spotted Fever Rickettsiosis: A Case Report
Unger, M. D., Palmer, J. L., Thorsvik, N. M.
Cureus, 2022/04
Free full text
703

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text
704

The effect of osteopathic manipulative treatment on anaerobic performance and lactate clearance in male athletes: a double-blind, randomized, sham-controlled, crossover study
Akkaş, M. B., Belviranli, M., Okudan, N.
The Journal of Sports Medicine and Physical Fitness, 2022/04
705

Osteopathic management of dysmenorrhea: A qualitative snapshot of New Zealand women’s experiences
Leys, A. E.
Unpublished MSc thesis, 2022/04
Free full text
706

Having Heart: Affective and Cognitive Empathy Scores vs. Residency Specialty Match at an Osteopathic Medical School
Newton, B. W.
Medical Science Educator, 2022/04
707

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text
708

Store-and-forward teledermatology impact on diagnosis, treatment and dermatology referrals: Comparison between practice settings
Pasadyn, S. R., McAfee, J. L., Vij, A., Warren, C. B.
Journal of Telemedicine and Telecare, 2022/04
709

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text
710

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text
711

To Boost or Not to Boost: Acceptability of a COVID-19 Booster Dose among Osteopathic Medical Students: A Cross-Sectional Study from a Medical School in New York
Al Janabi, T., Pino, M.
Epidemiologia (Basel), 2022/04
Free full text
712

A Review of Glymphatics and the Impact of Osteopathic Manipulative Treatment in Alzheimer's Disease, Concussions, and Beyond
Marino, M. A., Petrova, S., Sweiss, R., Duong, J., Miulli, D. E.
Cureus, 2022/03
Free full text
713

A Content Analysis of Osteopaths' Attitudes for a More Inclusive Clinical Practice towards Transgender People
Baldin, I., Esteves, J. E., Tramontano, M., Macdonald, M., Baroni, F., Lunghi, C.
Healthcare, 2022/03
Free full text
714

Osteopathie bei Atopischer Dermatitis - eine randomisiert kontrollierte monozentrische explorative Studie
(Osteopathy in Atopic Dermatitis - a randomised controlled monocentric exploratory trial)
Ahnert, M. W.
Unpublished PhD thesis, 2022/03
Free full text
715

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text
716

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text
717

Эффективность реабилитации пациентов после перенесенной ковид-пневмонии методами остеопатии
(The effectiveness of rehabilitation of patients after covid pneumonia with osteopathic methods)
Belyaev, A. F., Fotina, O. N., Kharkovskaya, T. S., Yurchenko, A. A.
Russian Osteopathic Journal, 2022/03
Free full text
718

Отдаленные результаты совместного применения логопедической и остеопатической коррекции у детей 5–6 лет с дизартрией
(Long-term results of combined use of speech therapy and osteopathic correction in 5–6 year old children with dysarthria)
Bychkova, E. Y., Sandakov, A. V., Kuzmina, Y. O.
Russian Osteopathic Journal, 2022/03
Free full text
719

Исследование эффективности остеопатической коррекции в лечении пациентов детского возраста с идиопатическим сколиозом I степени
(Investigation of the osteopathic correction effectiveness in the treatment of pediatric patients with idiopathic scoliosis of the first degree)
Kamaletdinov, V. L., Kamaletdinova, O. V., Safin, R. F.
Russian Osteopathic Journal, 2022/03
Free full text
720

Инструментальные методы и технические средства для оценки результатов остеопатической коррекции у пациентов после ампутации нижних конечностей
(Instrumental methods and technical means for assessing the results of osteopathic correction in patients after lower limb amputation)
Kolyshnitsyn, N. Y., Mokhov, D. E.
Russian Osteopathic Journal, 2022/03
Free full text
721

Исследование сочетанного применения остеопатической коррекции и ЭЭГ-БОС-тренингов у детей с синдромом дефицита внимания и гиперактивности
(Study of the combined use of osteopathic correction and EEG-biofeedback training in children with attention deficit hyperactivity disorder)
Kudryashova, V. G., Chetverikova, N. A.
Russian Osteopathic Journal, 2022/03
Free full text
722

Эффекты остеопатических методов уравновешивания сфенобазилярного синхондроза и разделения переднерешетчатого шва у детей с узким нёбом
(Effects of osteopathic techniques of balancing SEB and separating the front-ethmoid suture in children with narrow palate)
Quesada, B. M.
Russian Osteopathic Journal, 2022/03
Free full text
723

Возможность применения остеопатических методов коррекции в терапии миофасциального болевого синдрома
(Possibility of using osteopathic methods of correction in the treatment of myofascial pain syndrome)
Safiullina, A. A., Safiullina, G. I.
Russian Osteopathic Journal, 2022/03
Free full text
724

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text
725

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text
726

Impressionen von A.T. Stills Osteopathie
(Impressions of A.T. Stills osteopathy)
Stecker, D.
Osteopathische Medizin, 2022/03
727

Standardization of osteopathic manipulative treatment in telehealth settings to maximize patient outcomes and minimize adverse effects
Gawrys, S. P., Bradshaw, J. T., Parker, L. M.
Journal of Osteopathic Medicine, 2022/03
Free full text
728

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
729

Study to assess existing knowledge of headache disorders among registered osteopaths practising in the UK: A cross-sectional survey
Huzzey-Cunningham, E., McWilliam, M., Mahtani, V., Bridge, H., Breukel, C., Schytz, H. W., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2022/03
730

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text
731

Patellofemoral pain syndrome: a review of the literature with osteopathic emphasis
Balint, T., Jones, J., Paquette, M., Amalfitano, J.
The AAO Journal, 2022/03
Free full text
732

Osteopathic Approach to Treatment of Radial Head Dysfunction: The Radial Head Range of Motion Technique
Ellis, M. M., Lewis, D. D.
The AAO Journal, 2022/03
Free full text
733

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text
734

Efficacy and Feasibility of an Osteopathic Intervention for Neurocognitive and Behavioral Symptoms Usually Associated With Fetal Alcohol Spectrum Disorder
Cases-Solé, R., Varillas-Delgado, D., Astals-Vizcaino, M., García-Algar, Ó.
Frontiers in Behavioral Neuroscience, 2022/03
Free full text
735

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text
736

The Portuguese Osteopathic Practitioners Estimates and RAtes (OPERA): A cross-sectional survey
Santiago, R. J., Nunes, A., Esteves, J. E., Cerritelli, F., Verbeeck, J., Lopes, S., Paquete, M., van Dun, P.
International Journal of Osteopathic Medicine, 2022/03
737

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text
738

Active learning in osteopathic education: Evaluation of think-pair-share in an undergraduate pathology unit
Wong, D.
International Journal of Osteopathic Medicine, 2022/03
739

Результаты остеопатической коррекции у детей и подростков с недифференцированной дисплазией соединительной ткани
(Results of osteopathic correction in children and adolescents with undifferentiated connective tissue dysplasia)
Valiev, K. R., Vildanov, I. K., Zyatdinov, R. R., Gainullin, I. R.
Russian Osteopathic Journal, 2022/03
Free full text
740

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
741

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
742

Lymphatic osteopathic manipulative treatment and soreness after receiving the COVID-19 vaccine
Sookaromdee, P., Wiwanitkit, V.
Journal of Osteopathic Medicine, 2022/03
Free full text
743

In bestimmter Weise auf jemanden wirken …
(To affect someone in a certain way...)
Schleusener, R.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03
744

Poster Award des Osteopathic Research Institute (ORI)
Poster award of the Osteopathic Research Institute (ORI)
Bohlen, L.
Osteopathische Medizin, 2022/03
745

Nebennierendysfunktion als Schlüssel bei therapieresistentem Zervikalsyndrom: Ein Fallbericht
(Adrenal gland dysfunction as a key in therapy-resistant cervical syndrome: a case report.)
Ebner, M.
Osteopathische Medizin, 2022/03
746

Vom Selbsterleben osteopathischer Praxis im Wirk-Bündnis der Tastwelt: Phänomenologisch-anthropologischer Bericht einer tastenden Praxis
(From the self-perception of osteopathic practice in the active alliance of the world of touch: Phenomenological-anthropological report of a practice of touching)
Kaiser, A. K.
Osteopathische Medizin, 2022/03
747

Online-Konferenz: Osteopathie trifft Psychologie: 19.–20. November 2021
(Online Conference: Osteopathy Meets Psychology. November 19-20, 2021)
Richter, J.
Osteopathische Medizin, 2022/03
748

Osteopathische Diagnostik und Behandlung funktioneller Gallenblasendyskinesien: Eine qualitative Interviewstudie
(Osteopathic diagnosis and treatment of functional gallbladder dyskinesia: A qualitative interview study)
Roth, P., Belz, S.
Osteopathische Medizin, 2022/03
749

Efeitos da abordagem osteopática em neonatos com dificuldade na biomecânica da amamentação: ensaio clínico randomizado
(Effects of the osteopathic approach in neonates with difficulties in the biomechanics of breastfeeding: a randomized clinical trial)
Barros, R. C. T., Vilagra, J. M., Taglietti, M., Tori, F.S., Cagnini, T. L., Camilo, J.M., Grando, F., Abico, R. M., Abico, S. T.
Research, Society and Development, 2022/03
Free full text
750

Interrater-Reliabilitätsstudie des allgemeinen osteopathischen Diaphragma-Schnelltests kranial der Symphysis pubica hinsichtlich Bewegung bei tiefer und tiefer abdominaler Inspiration
(Interrater reliability study of the general osteopathic diaphragm rapid test cranial to the symphysis pubica regarding movement during deep and deep abdominal inspiration)
Gärber, A.
Unpublished MSc thesis, 2022/03
751

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03
752

The AOA/ACGME Single Accreditation System and Its Immediate and Future Impact on Family Medicine
Fugazzi, L., Cummings, M.
Family Medicine, 2022/02
Free full text
753

Osteopathische Medizin in vier chronischen muskuloskeletalen Schmerzerkrankungen: Eine Beobachtungsstudie mit Follow-up.
Osteopathic Medicine in Four Chronic Musculoskeletal Pain Diseases: An Observational Trial with Follow-Up
Rotter, G., Binting, S., Tissen-Diabaté, T., Ortiz, M., Brinkhaus, B.
Complementary Medicine Research, 2022/02
Free full text
754

Inflammatory Biochemical Mediators and Their Role in Myofascial Pain and Osteopathic Manipulative Treatment: A Literature Review
Leicht, B. T., Kennedy, C., Richardson, C.
Cureus, 2022/02
Free full text
755

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text
756

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02
757

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text
758

Alimentación y osteopatía: el papel de la alimentación en el funcionamiento del sistema fascial. Revisión sistemática
(Diet and Osteopathy: The role of diet in the functioning of fascial system. Systematic Review)
Mora Mora, S. N.
Unpublished MSc thesis, 2022/02
Free full text
759

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text
760

The Role of Advanced Academic Degrees in Orthopaedic Sports Medicine Faculty
Chen, A. Z., Greaves, K. M., Fortney, T. A., Ahmad, C. S., Levine, W. N., Trofa, D. P., Lynch, T. S.
Orthopaedic Journal of Sports Medicine, 2022/02
Free full text
761

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02
762

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text
763

Advances in the therapeutic approach of pudendal neuralgia: a systematic review
Murer, S., Polidori, G., Beaumont, F., Bogard, F., Polidori, E., Kinne, M.
Journal of Osteopathic Medicine, 2022/01
Free full text
764

The rationale for including osteopathic manipulative treatment in the management of infections: a hermeneutic review
Lesho, E., McKeown, A., Laguio-Vila, M.
Expert Review of Anti-Infective Therapy, 2022/01
Free full text
765

International Overview of Somatic Dysfunction Assessment and Treatment in Osteopathic Research: A Scoping Review
Tramontano, M., Tamburella, F., Farra, F., Bergna, A., Lunghi, C., Innocenti, M., Cavera, F., Savini, F., Manzo, V., D', Alessandro, G.
Healthcare, 2022/01
Free full text
766

Osteopathic manipulation of the sphenopalatine ganglia versus sham manipulation, in obstructive sleep apnoea syndrom: A randomised controlled trial
Attali, V., Jacq, O., Martin, K., Arnulf, I., Similowski, T.
Journal of Clinical Medicine, 2022/01
Free full text
767

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text
768

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text
769

Effects of Adding Respiratory Training to Osteopathic Manipulative Treatment on Exhaled Nitric Oxide Level and Cardiopulmonary Function in Patients With Pulmonary Arterial Hypertension
Naci, B., Demir, R., Onder, O. O., Sinan, U. Y., Kucukoglu, M. S.
The American Journal of Cardiology, 2022/01
770

Inhibiting the Musculoskeletal Pathological Processes in Post-knee Replacement Surgery With Osteopathic Manipulative Treatment: A Systematic Review
Zhou, Y., Chin, J., Evangelista, A., Podger, B., Wan, P. J., Lomiguen, C. M.
Cureus, 2022/01
771

20/20 Vision
Finch, T.
Health Communication, 2022/01
Free full text
772

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text
773

The immediate effect of thoracolumbar manipulation and diaphragmatic release on inspiratory muscle strength in healthy smokers: A randomized clinical trial
Albarrati, A., Taher, M., Nazer, R., Alshameri, T.
Journal of Back and Musculoskeletal Rehabilitation, 2022/01
774

Relationship between osteopathic manipulative treatment of the temporomandibular joint, molar shim and the orthostatic position: A randomized, controlled and double blinded study
Detoni, R., Heartz, C. S., Fusatto, E. L., Bicalho, E., Nacimento-Moraes, K. S. G., Rizzatti-Barbosa, C. M., Lopes, F. O. T.
Journal of Bodywork and Movement Therapies, 2022/01
Free full text
775

Osteopathic treatment in addition to standard care in patients with Gastroesophageal Reflux Disease (GERD) – A pragmatic randomized controlled trial
Lynen, A., Schömitz, M., Vahle, M., Jäkel, A., Rütz, M., Schwerla, F.
Journal of Bodywork and Movement Therapies, 2022/01
776

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text
777

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
778

Development of Osteopathic Neuromusculoskeletal Medicine (ONMM) residency curriculum guidelines to meet Accreditation Council for Graduate Medical Education (ACGME) milestones
Balyakina, E. S., Hansen, M. M., Mason, D.
Journal of Osteopathic Medicine, 2022/01
Free full text
779

Retention of tissue texture change after cervical muscle energy and high velocity low amplitude intervention: implications for treatment intervals
Barnes, P. L., Casella, F. J., Lai, H., Airaksinen, O., Kuchera, M. L.
Journal of Osteopathic Medicine, 2022/01
Free full text
780

Lymphatic osteopathic manipulative treatment reduces duration of deltoid soreness after Pfizer/BioNTech COVID-19 vaccine
Marshall, S., Winter, S., Capobianco, J. D.
Journal of Osteopathic Medicine, 2022/01
Free full text
781

Temporomandibulargelenk: Diskusverlagerung nach anterior
(Temporomandibular joint: disc displacement anteriorly)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
782

Im Zwischen – eine am Leib orientierte osteopathische Besprechung
(In between - An osteopathic discussion oriented toward the body)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
783

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/01
784

Osteopathische Behandlungsaspekte bei COVID-19
(Aspects of osteopathic treatment for COVID-19)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01
785

The Effect of Pedal Pump Lymphatic Technique Versus Passive Recovery Following Maximal Exercise: A Randomized Cross-Over Trial
DiFrancisco-Donoghue, J., Chan, T., Jensen, A. S., Docherty, J. E. B., Grohman, R., Yao, S. C.
Sports Medicine - Open, 2022/01
Free full text
786

Results of a feasibility randomised controlled trial of osteopathy on neck-shoulder pain in computer users
Santiago, R. J., Esteves, J. E., Baptista, J. S., Magalhães, A., Costa, J. T.
Complementary Therapies in Clinical Practice, 2022/01
Free full text
787

A New Zealand osteopathic perspective on the choice of working in an integrated care environment alongside other regulated health care providers: A qualitative descriptive study
Cox, V.
Unpublished MSc thesis, 2022
Free full text
788

O papel das citocinas no apoio à monitorização e diagnóstico das condições alvo ao tratamento osteopático: Revisão sistemática da literatura
(The role of cytokines in supporting the monitoring and diagnosis of conditions targeted for osteopathic treatment: A systematic review of the literature)
Coelho, D.
Unpublished thesis, 2022
Free full text
789

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text
790

Übersicht der weltweit veröffentlichten osteopathischen Studien im Jahr 2020: Der INIOST-Studienreport 2020
(Review of osteopathic studies published worldwide in the year 2020: The INIOST Study Report 2020)
Franke, H.
Osteopathische Medizin, 2021/12
791

Vagusaktivierung und Stressreaktion aus Sicht der Osteopathie
(Vagus activation and stress reactions from the point of view of osteopathy)
Liem, T.
Osteopathische Medizin, 2021/12
792

Burnout und Stress – Korrelation mit viszeralem und kraniosakralem System
(Burnout and stress - Correlation with the visceral and craniosacral system)
Rössler, M., Kronstorfer, D.
Osteopathische Medizin, 2021/12
793

Wissenschaft und Forschung in der Osteopathie: Teil 2: Forschung in der Osteopathie
(Science and research in osteopathy - Part 2: Research in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/12
794

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12
795

Эффективность ортодонтической и остеопатической коррекции у пациентов с зубочелюстными аномалиями и мышечно-суставными дисфункциями височно-нижнечелюстного сустава при наличии сопутствующих соматических дисфункций и без них
(The effectiveness of orthodontic and osteopathic correction in patients with dental anomalies and musculoskeletal dysfunction of the temporomandibular joint in the presence of concomitant somatic dysfunctions and without it)
Basieva, E. V., Milutka, Y. A., Tarasov, N. A., Silin, A. V., Mokhov, D. E.
Russian Osteopathic Journal, 2021/12
796

Сочетанное применение остеопатической коррекции и транскраниальной микрополяризации головного мозга в лечении детей с синдромом дефицита внимания и гиперактивностью
(Combined use of osteopathic correction and transcranial micropolarization of the brain in the treatment of children with attention deficit hyperactivity disorder)
Belash, V. O., Bayer, D. V., Kostousov, V. V.
Russian Osteopathic Journal, 2021/12
797

Остеопатический статус пациентов с новой коронавирусной инфекцией COVID-19
(Osteopathic status in patients with new coronavirus infection COVID-19)
Belash, V. O., Lisenkova, N. A.
Russian Osteopathic Journal, 2021/12
798

Влияние остеопатической коррекции на функцию внешнего дыхания у пациентов, перенесших коронавирусную пневмонию COVID -19
(The effect of osteopathic correction on the function of external respiration in patients after COVID-19 coronavirus pneumonia)
Belyaev, A. F., Kharkovskaya, T. S., Fotina, O. N., Yurchenko, A. A.
Russian Osteopathic Journal, 2021/12
799

Исследование возможной эффективности остеопатической коррекции в составе комплексного лечения детей первого года жизни с дисплазией тазобедренных суставов
(Investigation of the possible effectiveness of osteopathic correction in the complex treatment of children in the first year of life with hip dysplasia)
Fabristova, N. A., Gainullin, I. R.
Russian Osteopathic Journal, 2021/12
800

Гистологическое исследование синхондрозов черепа, функционально значимых в краниальной остеопатической концепции
(Histological examination of cranial synchondroses as functionally significant elements in the cranial osteopathic concept)
Osipov, V. A., Pastukhov, A. N., Kurbatov, O. I., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/12
801

Возможности применения остеопатических методов диагностики и коррекции при дискинезии желчного пузыря
(Possibilities of osteopathic methods of diagnosis and correction in gallbladder dyskinesia)
Panaseiko, Y. N.
Russian Osteopathic Journal, 2021/12
802

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
803

The immediate effect of harmonic therapy on peripheral blood flow in young males: A cross-over pilot study
Alsayani, K. Y. A., Aslan, U. B., Büker, N., Şavkın, R., Yağcı, A. B.
International Journal of Osteopathic Medicine, 2021/12
804

Immediate alteration of the lumbar intervertebral foramen during the so-called osteopathic locking technique: A preliminary analysis on healthy subjects
Dugailly, P.M., Dethier, C., Salem, W.
International Journal of Osteopathic Medicine, 2021/12
805

Use of muscle energy technique amongst a nationally representative sample of Australian osteopaths
Fryer, G., Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2021/12
806

Epidemiology, common diagnoses, treatments and prognosis of shoulder pain: A narrative review
Hodgetts, C., Walker, B.
International Journal of Osteopathic Medicine, 2021/12
807

Pain knowledge and fear-avoidance beliefs of French osteopathy students and educators towards chronic low back pain: An osteopathic educational institution-based cross-sectional survey
Mhadhbi, H., Thierry-Hildenbrand, B., Draper-Rodi, J., Esteves, J. E., Ménard, M.
International Journal of Osteopathic Medicine, 2021/12
808

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12
809

How does French initial osteopathic training value relational competency, patient education, and the competency-based approach? A cross-sectional survey
Quesnay, P., Poumay, M., Gagnayre, R.
International Journal of Osteopathic Medicine, 2021/12
810

Effects of Visceral Manipulation Treatment on Women with Infertility and Adults with Low Back Pain
Parker, A.
Unpublished Dissertation, 2021/12
811

Impact of osteopathic manipulative techniques on the management of dizziness caused by neuro-otologic disorders: Protocol for systematic review and meta-analysis
Rehman, Y., Kirsch, J., Bhatia, S., Johnston, R., Bingham, J., Senger, B., Swogger, S., Snider, K. T.
International Journal of Osteopathic Medicine, 2021/12
812

Decreasing Headache Pain Secondary to a Subarachnoid Hemorrhage with the use of Osteopathic Manipulative Medicine
Barnes, P. L, Haas, H., Beck, B.
The AAO Journal, 2021/12
Free full text
813

Correction: Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/12
Free full text
814

An Osteopathic Approach to Complex Regional Pain Syndrome (CRPS)
Deol, N., Nuño, V., Schuman, M., Contreras, C.
The AAO Journal, 2021/12
Free full text
815

Effects of Compression of the 4th Ventricle (CV4) Treatment on Medical Student Anxiety
Goering, E., Herner, M., Smith, M., Galka, M., Kammerzell, S., Best, K., Anderson, P., Steinauer, M.
The AAO Journal, 2021/12
Free full text
816

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text
817

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11
818

A comparative study of the effectiveness of an osteopathic primary care sports medicine led intervention on performance in men's collegiate lacrosse players
Rao, N. C., Zwibel, H., Berezanskaya, J., Pena, P., Jung, M. K.
Journal of Osteopathic Medicine, 2021/11
Free full text
819

Effectiveness of Non-Pharmacological Interventions for Irritable Bowel Syndrome: A Systematic Review
Amsallem, F., Sanchez, S., Armoiry, X., Mion, F.
Evidence-based Complementary and Alternative Medicine, 2021/11
Free full text
820

“If you don't use or understand visceral osteopathy you're not a real osteopath“: Professional identity in Australian osteopathy through the lens of a single traditional technique
Grace, S., Fleischmann, M., Vaughan, B.
Explore (NY), 2021/11
821

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text
822

Effect of joint manipulation and muscle energy technique in patients with Chronic Obstructive Pulmonary Disease: A review
Bains, D., Goyal, M., Chahal, A., Shaphe, M. A.
Annals of Clinical and Analytical Medicine, 2021/11
Free full text
823

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11
824

Fast improvements in functional status after osteopathic manipulative treatment based on myofascial release in patients with moderate or severe fibromyalgia: a retrospective study
Farra, F., Chiesa, A., Risio, R. G., Vismara, L., Bergna, A.
Journal of Complementary and Integrative Medicine, 2021/11
Free full text
825

Effect of osteopathic manipulation on gait asymmetry
Hill, C. N., Romero, M., Rogers, M., Queen, R. M., Brolinson, P. G.
Journal of Osteopathic Medicine, 2021/11
Free full text
826

Der Einfluss der Osteopathie auf den Schmerz und die Beweglichkeit nach einer Rotatorenmanschettenrekonstruktion
(The influence of osteopathy on pain and mobility after rotator cuff reconstruction)
Schrempf, I.
Unpublished MSc thesis, 2021/11
827

Die Auswirkungen einer allgemein osteopathischen Behandlung bei Patientinnen/Patienten mit rheumatoider Arthritis
(The effects of general osteopathic treatment on patients with rheumatoid arthritis)
Sommeregger, B. M.
Unpublished MSc thesis, 2021/11
828

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11
829

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11
830

Les bienfaits de l’ostéopathie sur la constipation
(The benefits of osteopathy on constipation)
Pitel, C., Rojot, A.
Pratiques en Nutrition, 2021/11
831

Response to Alvarez et al
Coste, J., Medkour, T., Maigne, J. Y., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/11
Free full text
832

The ACAMTO study—impact of add-on osteopathic treatment on adolescent patients with anorexia nervosa: study protocol for a randomized controlled trial
Letranchant, A., Montebello, Y., Dugré-Le bigre, C., Wagner, A., Curt, F., Silva, J., Nicolas, I., Votadoro, P., Kalindjian, N., Korchonnoff, A., Gutierre, A., Novelli, Ana B., Pham-Scottez, A., Corcos, M.
Trials, 2021/11
Free full text
833

Wirksamkeit osteopathischer Behandlungen von Craniomandibulärer Dysfunktion bei Tinnitus Systematsiches Review
(Efficacy of osteopathic treatments for craniomandibular dysfunction in tinnitus. A Systematic Review)
Pollak, E.
Unpublished MSc thesis, 2021/11
834

Der Einfluss von osteopathischen Behandlungen auf die Beschwerdesymptomatik bei Patienten mit CPPS als Ergänzung zur konventionellen Therapie
(The influence of osteopathic treatments on symptomatology in patients with CPPS as an addition to conventional therapy)
Nezaj, B.
Unpublished MSc thesis, 2021/11
835

Osteopathie bei chronischen Beckenschmerzen
(Osteopathic treatment in patients with chronic pelvic pain)
Koza, M.
Unpublished MSc thesis, 2021/11
836

Effektivität osteopathischer Behandlungen der Osteitis pubis bei männlichen Amateurfußballspielern im Vergleich zum Goldstandard
(Effectiveness of osteopathic treatments of osteitis pubis in male amateur soccer players in comparison to the gold standard)
Klima, C
Unpublished MSc thesis, 2021/11
837

Effekt sakraler Mobilisationen auf die Herzratenvariabilität bei Patienten mit einem milden bis hohen Stressempfinden. Eine randomisierte, kontrollierte Einzelblindstudie
(Effect of sacrum mobilizations on the heart rate variability in patients with a moderate to high perceived stress score. A single blind randomized controlled study)
Chaumont, Y.
Unpublished MSc thesis, 2021/11
838

Predictors for Actual COVID-19 Vaccine Uptake and Intended Booster Dosage among Medical Students of an Osteopathic Medical School in New York
Al Janabi, T., Pino, M.
Epidemiologia (Basel), 2021/11
Free full text
839

Effectiveness of myofascial release on pain, sleep, and quality of life in patients with fibromyalgia syndrome: A systematic review
Ughreja, R. A., Venkatesan, P., Balebail Gopalakrishna, D., Singh, Y. P.
Complementary Therapies in Clinical Practice, 2021/11
840

A Missing Voice: The Lingual Complex and Osteopathic Manual Medicine in the Context of Five Osteopathic Models
Bordoni, B., Escher, A. R.
Cureus, 2021/10
Free full text
841

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners – results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A.K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
842

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text
843

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text
844

Association Between the Modalities of Complementary and Alternative Medicine Use and Cost-Related Nonadherence to Medical Care Among Older Americans: A Cohort Study
Zhang, J. X., Meltzer, D. O.
The Journal of Alternative and Complementary Medicine, 2021/10
845

Most common infant health concerns in osteopathic practices in Germany. A survey
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2021/10
846

Spinal Manipulative Therapy for Acute Neck Pain: A Systematic Review and Meta-Analysis of Randomised Controlled Trials
Chaibi, A., Stavem, K., Russell, M. B.
Journal of Clinical Medicine, 2021/10
Free full text
847

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text
848

Остеопатия как метод коррекции и профилактики формирования соматических дисфункций опорно-двигательного аппарата у офисных работников
(Osteopathy as a method of correction and prevention of the formation of somatic dysfunctions of the musculoskeletal system in office workers)
Aptekar, I. A., Abramova, E. V.
Russian Osteopathic Journal, 2021/10
Free full text
849

Оценка клинической эффективности остеопатической коррекции у детей с хроническим бронхитом в условиях санатория
(Evaluation of the clinical effectiveness of the osteopathic correction in children with chronic bronchitis in a sanatorium)
Belash, V. O., Khaibullina, G. A.
Russian Osteopathic Journal, 2021/10
Free full text
850

Синдром последствий интенсивной терапии (ПИТ-синдром) у детей
(Post-intensive care syndrome (PICS) in children)
Karimova, L. K., Belash, V. O.
Russian Osteopathic Journal, 2021/10
Free full text
851

Исследование эффективности остеопатической коррекции в комплексном лечении больных с прооперированной первичной открытоугольной глаукомой
(Study of the effectiveness of osteopathic correction in the complex treatment of patients with operated primary open-angle glaucoma)
Zubkov, O. V., Smirnova, E. A., Kramar, V. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2021/10
Free full text
852

Effects of osteopathic approach in infants with deformational plagiocephaly: an outcome research study
Gasperini, M., Vanacore, N., Massimi, L., Consolo, S., Haass, C., Scapillati, M. E., Petracca, M.
Minerva Pediatrics, 2021/10
853

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10
854

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10
855

Wirksamkeit der Osteopathie bei Depressionen als Begleitsymptom chronischer Erkrankungen: Systematic Review
(The Effect of Osteopathy on Comorbid Depression in Chronic Disease: Systematic Review)
Zajicek, M.
Unpublished MSc thesis, 2021/10
Free full text
856

Osteopathy in Germany: attitudes, beliefs and handling among general practitioners - results of a nationwide cross-sectional questionnaire survey
Schmid, G. L., Kluge, J., Deutsch, T., Geier, A. K., Bleckwenn, M., Unverzagt, S., Frese, T.
BMC Family Practice, 2021/10
Free full text
857

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text
858

Osteopathic Treatment of Infants in Their First Year of Life: A Prospective Multicenter Observational Study (OSTINF Study)
Schwerla, F., Daake, B., Möckel, E., Resch, K.L.
Complementary Medicine Research, 2021/10
Free full text
859

Palpation of the Respiratory System in Osteopathic Manual Medicine: From the Trachea to the Lungs
Bordoni, B., Escher, A. R.
Cureus, 2021/09
Free full text
860

Geist-Körper-Interdependenz in der osteopathischen Behandlung
(Mind-body interdependence in osteopathic treatment)
Liem, T., Van Den Heede, P.
Osteopathische Medizin, 2021/09
861

Osteopathische Überlegungen zur Begleitung der Therapie des Mammakarzinoms
(Osteopathic considerations to support the therapy of breast carcinoma)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
862

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
863

Behandlung bei posttraumatischer Belastungsstörung
(Treatment for post-traumatic stress disorder)
Treu, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
864

Klassische Osteopathie – ein ganzheitlicher Ansatz
(Classical osteopathy - a holistic approach)
Williams, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
865

General Osteopathic Treatment (GOT) – ein Überblick
(General Osteopathic Treatment (GOT) - an overview)
Schiller, B.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09
866

Efficacy of osteopathic manipulative treatment in patients with Parkinson's disease: a narrative review
Li, R., Jose, A., Poon, J., Zou, C., Istafanos, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/09
Free full text
867

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text
868

Exploring the Utility of Motion Analysis in Osteopathic Clinical Trials; a School-Based Pilot Study on Jaw and Cervical Range of Motion
Bagory, T., Vaucher, P., Mhadhbi, H., Ménard, M.
International Journal of Osteopathic Medicine, 2021/09
869

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09
870

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, Dr C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09
871

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09
872

Wissenschaft und Forschung in der Osteopathie: Teil 1: Der Begriff der Wissenschaft in der Osteopathie
(Science and research in osteopathy - Part 1: The concept of science in osteopathy)
Stecker, D., Scheuchl, F.
Osteopathische Medizin, 2021/09
873

Osteopathic Cranial Manipulation for a Patient With Whiplash-Associated Disorder: A Case Report
Parravicini, G., Ghiringhelli, M.
Journal of Chiropractic Medicine, 2021/09
874

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text
875

Embracing industry sponsored research to expand osteopathic medical student research experiences
Morehouse, Z. P., Nash, R. J.
Journal of Osteopathic Medicine, 2021/09
Free full text
876

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09
877

Pain and symptom management in a case of cervical dystonia with comorbid generalized joint hypermobility using prolotherapy with osteopathic manipulative medicine
Mancini, J., Whitfield, D.
Movement Disorders, 2021/09
878

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09
879

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09
880

Kognitive Fähigkeiten und Berufsrollen von Osteopath*innen nach A.T. Still: Teil 1: Philosophisch-ethischer Hintergrund
(Cognitive skills and professional roles of osteopaths according to A.T. Still - Part 1: Philosophical-ethical background)
Engel, M., Krause, K. C.
Osteopathische Medizin, 2021/09
881

Meaning Construction for Biodynamic Osteopathy Terms in Translation Practice
Kalinina, I.
Taikomoji Kalbotyra, 2021/09
Free full text
882

Nebenwirkungen nach einer osteopathischen Behandlung. Eine quantitative Fragebogenstudie
(Adverse Events After Osteopathic Treatment. A Quantitative Questionnaire Study)
Kloibhofer, M.
Unpublished MSc thesis, 2021/09
883

Effects of Osteopathic Manipulation and Other Manual Manipulative Treatments on Cystic Fibrosis
Ball, K. T., Kraft, D. E., Snider, K. T.
The AAO Journal, 2021/09
Free full text
884

Single Osteopathic Manipulative Treatment Session Eliminates Percutaneous Coronary Intervention-Induced Upper Thoracic Pain in Elderly Male
Hoffman, P., Belogorodsky, D., Noto-Bell, L.
The AAO Journal, 2021/09
Free full text
885

Conductive Hearing Loss: A Case Report
Lloyd, C. A., Wehner, B. L., Fleming, R. K.
The AAO Journal, 2021/09
Free full text
886

Osteopathic Manipulative Treatment in Patients with Anxiety and Depression: A Pilot Study
Miranda, E., Giza, J., Feketeova, E., Castro-Nunez, C., Vieux, U., Huynh, M.D.
The AAO Journal, 2021/09
Free full text
887

Wertesysteme in der osteopathischen Palpation – Gespräche mit OsteopathInnen über subjektive Wertesysteme in der osteopathischen Befundung und Behandlung
(Value systems in osteopathic palpation – Interviews with osteopaths about subjective value systems in osteopathic diagnosis and treatment)
Müller, F.
Unpublished MSc thesis, 2021/09
Free full text
888

Interrater Reliabilitätstestung des Flexionstests der ersten Rippe bei symptomatischen und asymptomatischen Erwachsenen
(Interrater reliability of the flexion test for the first rib in symptomatic and asymptomatic adults)
Kondler, V.
Unpublished MSc thesis, 2021/09
889

Wie stellt sich die Gesundheitsstörung der idiopathischen Asymmetrie und lagebedingten Plagiozephalie bei Säuglingen im ersten Lebensjahr in Bezug auf die Therapie dar? Eine systematische Literaturrecherche
(How does the health disorder of idiopathic asymmetry and posi-tional plagiocephaly in infants in the first year of life relate to therapy? A systematic literature review)
Daake, B.
Unpublished MSc thesis, 2021/09
890

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09
891

A Systematic Review of Musculoskeletal Mobilization and Manipulation Techniques Used in Veterinary Medicine
Haussler, K. K., Hesbach, A. L., Romano, L., Goff, L., Bergh, A.
Animals, 2021/09
Free full text
892

(Osteopoathic medical treatment of pediatric patient)
Angersbach, N.
Unpublished MSc thesis, 2021/09
893

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text
894

Osteopatia na atenção primária à saúde: resultados parciais de uma experiência de educação permanente e alguns efeitos iniciais.
Osteopathy in primary health care: partial results of continuing education experience and some initial outcomes
Schneider, L. M., Tesser, C. D.
Ciencia & Saude Coletiva, 2021/09
Free full text
895

Osteopaths’ Perspectives on Patient Adherence to Self-Management Strategies: A Qualitative Content Analysis
Tripodi, N., Krajina, T., Lea, N., Giudice, H., Eskaf, S., Ojea, M., D&rsquo, Souza, T., McLeod, G., Feehan, J.
International Journal of Osteopathic Medicine, 2021/09
896

Erratum: Vertigo and balance disorders - The role of osteopathic manipulative treatment: A systematic review (Complementary Medicine Research (2020) DOI: 10.1159/000512673)
Tramontano, M., Consorti, F., Morone, G., Lunghi, C.
Complementary Medicine Research, 2021/08/01
897

Practicing Medicine in Underserved Areas: Differences that Make a Difference in Vocational Anticipatory Socialization
Walker, T. M.
Unpublished PhD thesis, 2021/08
Free full text
898

Practitioner and practice characteristics of Australian osteopaths who discuss lifestyle factors with patients: Findings from a national practice-based research network
Adams, J., Sibbritt, D., Steel, A., Peng, W.
Health & Social Care in the Community, 2021/08
899

Osteopathic Manipulative Treatment for Chronic Low Back Pain
Licciardone, J. C.
JAMA Internal Medicine, 2021/08
900

Osteopathic Manipulative Treatment for Chronic Low Back Pain—Reply
Nguyen, C., Zegarra-Parodi, R, Boutron, I.
JAMA Internal Medicine, 2021/08
901

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08
902

Osteopathic interventions via telehealth in a pediatric population: a retrospective case series
Kramer, J. L., De Asis, K.
Journal of Osteopathic Medicine, 2021/08
Free full text
903

Patient-centered care or osteopathic manipulative treatment as mediators of clinical outcomes in patients with chronic low back pain
Licciardone, J. C., Aryal, S.
Journal of Osteopathic Medicine, 2021/08
Free full text
904

Single Accreditation Does Not Mean Double Jeopardy for Osteopathic Medical Students
Gimpel, J. R.
Academic Medicine, 2021/08
Free full text
905

Immediate Effects of Myofascial Release on the Thoracolumbar Fascia and Osteopathic Treatment for Acute Low Back Pain on Spine Shape Parameters: A Randomized, Placebo-Controlled Trial
Brandl, A., Egner, C., Schleip, R.
Life (Basel), 2021/08
Free full text
906

An investigation of osteopaths’ attitudes and self-reported practices towards psychosocial content in sports-injury rehabilitation
Ferguson, S.
Unpublished MSc thesis, 2021/08
Free full text
907

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08
908

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text
909

Implications of the United States Medical Licensing Examination Step 1 Examination Transition to Pass/Fail on Medical Students Education and Future Career Opportunities
Ehrlich, H., Sutherland, M., McKenney, M., Elkbuli, A.
The American Surgeon, 2021/08
910

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text
911

Vertigo and Balance Disorders-The Role of Osteopathic Manipulative Treatment: A Systematic Review
Tramontano, Marco, Consorti, Giacomo, Morone, Giovanni, Lunghi, Christian
Complementary Medicine Research, 2021/08
912

The Lymphatic System: An Osteopathic Review
Hruby, R. J., Martinez, E. S.
Cureus, 2021/07
Free full text
913

Osteopathie bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom
(Osteopathy for chronic prostatitis/chronic pelvic pain syndrome)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
914

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
915

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07
916

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07
917

Osteopathic Principles and Practice: Essential Training for the Primary Care Physician of Today and Tomorrow
Misra, S.
Family medicine, 2021/07
Free full text
918

Modulation of vestibulo-ocular reflex gain-symmetry induced by osteopathic manipulations on the fascial system in young healthy subjects: A three-arm randomized controlled trial
Romagnoli, M., Ntino, A. T., Galli, M., Origo, D.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2021/07
919

Effects of myofascial release or self-myofascial release and control position exercises on lower back pain in idiopathic scoliosis: A systematic review
López-Torres, O., Mon-López, D., Gomis-Marzá, C., Lorenzo, J., Guadalupe-Grau, A.
Journal of Bodywork and Movement Therapies, 2021/07
920

Secondary dysmenorrhea and dyspareunia associated with pelvic girdle dysfunction: A case report and review of literature
Origo, D., Piloni, S., Tarantino, A. G.
Journal of Bodywork and Movement Therapies, 2021/07
921

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text
922

Оценка эффективности лечения соматических дисфункций костей таза с применением компьютерной стабилографии с биологической обратной связью
(Estimation of the efficiency of treatment of somatic dysfunctions of the pelvis bones using the technology of computer stabilography with biological feedback)
Andreev, V. V., Sychev, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
923

Возможность применения остеопатической коррекции в комплексной терапии пациентов с болезнью Паркинсона
(Possibility of osteopathic correction in the complex therapy of patients with Parkinson′s disease)
Belash, V. O., Batenina, A. M., Machulina, A. I.
Russian Osteopathic Journal, 2021/07
Free full text
924

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text
925

Knowledge of osteopathic manipulative medicine and osteopathic physicians in a New York South Asian community
Lee, J., Maung, C., Espares, J., Chen, J., Yip, F., Lin, W., Zhao, L., Li, T. S.
Journal of Osteopathic Medicine, 2021/07
Free full text
926

Возможность включения остеопатической коррекции в комплексное лечение недостаточности анального сфинктера у подростков
(Possibility of osteopathic correction inclusion in the complex treatment of anal incontinence in teenagers)
Kovalchuk, T. S., Enaleev, R. R., Kuzmina, Y. O.
Russian Osteopathic Journal, 2021/07
Free full text
927

Эффективность остеопатического подхода в лечении задней плагиоцефалии позиционного происхождения у грудного ребенка
(Effectiveness of osteopathic care in the treatment of infant positional posterior plagiocephaly)
Marangelli, G., Adouard, J., Josse, B., Ducourneau, J., Chastagner, A.S., Messien, C.
Russian Osteopathic Journal, 2021/07
Free full text
928

Исследование особенностей остеопатического статуса у пациентов с плосковальгусной деформацией стоп в сочетании с установочной кривошеей в анамнезе и без такого сочетания
(Study of the peculiarities of the osteopathic status in patients with planovalgus deformity of the feet in combination with a history of placement torticollis and without such a combination)
Mukhammadieva, Y. R., Alshina, A. N., Gainetdinov, I. I., Safin, R. F.
Russian Osteopathic Journal, 2021/07
Free full text
929

Adverse childhood experiences and trauma informed care: treating the whole patient with a more complete osteopathic approach
Marcoux, T. B.
Journal of Osteopathic Medicine, 2021/07
Free full text
930

Возможность применения остеопатических методов коррекции в терапии симфизиопатии у беременных
(Possibility of using of osteopathic methods of correction in the therapy of symphysiopathy in pregnant women)
Nenashkina, E. N., Belash, V. O.
Russian Osteopathic Journal, 2021/07
Free full text
931

Cultural self-awareness: An analysis of the cultural self-awareness in student osteopaths at the Unitec Institute of Technology in Aotearoa/New Zealand
Solomon, C.
Unpublished MSc thesis, 2021/07
Free full text
932

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07
933

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07
934

The efficacy of complementary and alternative medicine methods for chronic epilepsy in pediatric patients: A prisma systematic review and meta-analysis
Johnson, B.
Unpublished MSc thesis, 2021/07
Free full text
935

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text
936

The use of visceral techniques in Australian osteopathic practice: A descriptive cross-sectional study
Fleischmann, M., Vaughan, B., Grace, S., Stewart, A., Hart, C., Brew, E., Masters, G., Smeeton, L., Thompson, L., Brooks, M.
Advances in Integrative Medicine, 2021/07
937

Osteopathic empirical research: a bibliometric analysis from 1966 to 2018
Morin, C., Gaboury, I.
BMC Complementary Medicine and Therapies, 2021/07
Free full text
938

Conceptions de la santé et de la pratique des manipulations vertébrales d’étudiants en ostéopathie au cours de leur formation
(Conceptions of health and spinal manipulation practice of osteopathic students during their training)
Javerliat, P.
Unpublished PhD thesis, 2021/06
Free full text
939

“Understanding patients' narratives” A qualitative study of osteopathic educators’ opinions about using Medical Humanities poetry in undergraduate education
Maretic, S., Abbey, H.
International Journal of Osteopathic Medicine, 2021/06
940

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06
941

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text
942

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06
943

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06
944

An international profile of the practice of osteopaths: A systematic review of surveys
Ellwood, J., Carnes, D.
International Journal of Osteopathic Medicine, 2021/06
945

Inclusivity and accessibility in undergraduate osteopathic education for students with disability: A scoping review
MacMillan, A., Corser, A., Clark, Z.
International Journal of Osteopathic Medicine, 2021/06
946

Туннельная невропатия локтевого нерва: влияние остеопатической коррекции на снижение болевого синдрома
(Cubital tunnel neuropathy: Impact of osteopathic manipulative treatment on pain syndrome relief)
Belyaev, A. F., Belomestnov, P. V.
Russian Journal of Pain, 2021/06
Free full text
947

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text
948

Albrecht Kaisers Appell wird nicht gehört
(Albrecht Kaiser's appeal is not heard)
Sonntag, M.
Osteopathische Medizin, 2021/06
949

Establishing osteopathic assessments to fulfill osteopathic recognition standards: a model for dermatology and other subspecialties
Mahlberg, S. J., Liou, Y. L., Lloyd, J.
Journal of Osteopathic Medicine, 2021/06
Free full text
950

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 2: Diagnostik und Therapie
(Positional plagiocephaly and its osteopathic intervention. Part 2: Diagnostics and therapy)
Engel, M.
Osteopathische Medizin, 2021/06
951

Ersthelferinnen mit posttraumatischer Belastungsstörung: Auswirkung einer globalen osteopathischen Behandlung
(Female first responders with post-traumatic stress disorder: Effect of a global osteopathic treatment)
König, V.
Osteopathische Medizin, 2021/06
952

Spinale Chiropraktische Manipulation (spinale HVLAM): Ein integrativer osteopathischer Ansatz
Spinal chiropractic manipulation (spinal HVLAM): An integrative osteopathic approach
Muntinga, E.
Osteopathische Medizin, 2021/06
953

The Pediatric Workforce: Recent Data Trends, Questions, and Challenges for the Future
Vinci, R. J.
Pediatrics, 2021/06
954

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06
955

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text
956

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text
957

Crochet the Pain Away: A Case Study of Osteopathic Manipulation for Cervical Rib Induced Thoracic Outlet Syndrome
Herring, J. A., Soto, G. N., Silver, S.
The AAO Journal, 2021/06
Free full text
958

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text
959

Integrating Osteopathic Evaluation and Treatment in a Case of Opioid-Induced Hyperalgesia
Rosendahl, N. O.
The AAO Journal, 2021/06
Free full text
960

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text
961

‘Don’t focus on the finger, look at the moon’ - The importance of contextual factors for clinical practice and research
Thomson, O. P., Rossettini, G.
International Journal of Osteopathic Medicine, 2021/06
962

Craniosacral Therapy Use in Normal Pressure Hydrocephalus
Park, Y., Kabariti, J., Tafler, L.
Cureus, 2021/05
Free full text
963

Osteopathic Manipulative Treatment of Herpes Zoster Ophthalmicus/Postherpetic Neuralgia
Volokitin, M., Izadi, N., Myers, R., Kane Diaw, N., Milani, S.
Cureus, 2021/05
Free full text
964

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text
965

The importance of epistemological consideration in the reporting of evidence for osteopathic care in Covid-19 papers
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/05
Free full text
966

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05
967

The importance of rigour in the reporting of evidence for osteopathic care in Covid-19 papers
Draper-Rodi, J., Vaucher, P., Thomson, O. P.
Explore (NY), 2021/05
Free full text
968

Effect of Osteopathic Manipulative Treatment vs Sham Treatment on Activity Limitations in Patients With Nonspecific Subacute and Chronic Low Back Pain: A Randomized Clinical Trial
Nguyen, C., Boutron, I., Zegarra-Parodi, R., Baron, G., Alami, S., Sanchez, K., Daste, C., Boisson, M., Fabre, L., Krief, P., Krief, G., Lefèvre-Colau, M.M., Rannou, F.
JAMA Internal Medicine, 2021/05
969

The Rule of Three
Abend, D.
Osteopathic Family Physician, 2021/05
Free full text
970

Effects of CranioSacral Therapy upon Symptoms of Post-Acute Concussion and Post-Concussion Syndrome: A Pilot Study
Kratz, S. V., Kratz, D. J.
Journal of Bodywork and Movement Therapies, 2021/05
971

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
972

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text
973

Manual treatment for kidney mobility and symptoms in women with nonspecific low back pain and urinary infections
Lo Basso, F., Pilzer, A., Ferrero, G., Fiz, F., Fabbro, E., Oliva, E., Cazzarolli, C., Turrina, A.
Journal of Osteopathic Medicine, 2021/05
Free full text
974

The usage of multidisciplinary physical therapies at the Rio de Janeiro 2016 Olympic Summer Games: an observational study
Grant, M. E., Steffen, K., Palmer, D.
Brazilian Journal of Physical Therapy, 2021/05
Free full text
975

Gnathological and osteopathic treatments with digital evaluations before and after therapies: a case report of a patient with ehlers-danlos syndrome
Di Giacomo, P., Cerignoli, E., D'Ermes, V., Ferrato, G., Polimeni, A., Di Paolo, C.
La Clinica Terapeutica, 2021/05
Free full text
976

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05
977

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05
978

Effects of Osteopathic Manipulative Treatment on Parkinsonian Gait: A Statistical Parametric Mapping Analysis
Terrell, Z. T.
Unpublished MSc thesis, 2021/05
979

Beeinflussung abdominaler Adhäsionen durch osteopathische oder manuelle Techniken
(Influencing abdominal adhesions through osteopathic or manual techniques: A systematic review)
Kreuzer, M.
Unpublished MSc thesis, 2021/05
Free full text
980

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05
981

The Effectiveness of Pump Techniques and Pompages: A Systematic Review
Vanti, C., Golfari, M., Pellegrini, G., Panizzolo, A., Turone, L., Giagio, S., Pillastrini, P.
Applied Sciences, 2021/05
Free full text
982

Direct and mediated effects of treatment context on low back pain outcome: a prospective cohort study
Bishop, F., Al-Abbadey, M., Roberts, L., MacPherson, H., Stuart, B., Carnes, D., Fawkes, C., Yardley, L., Bradbury, K.
BMJ Open, 2021/05
Free full text
983

The use of osteopathic manipulative treatment in the newborn nursery and its effect on health in the first six months of life: A retrospective observational case-control study
Mills, M. V.
Complementary Therapies in Clinical Practice, 2021/05
Free full text
984

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text
985

Predicting Osteopathic Medical Students' Performance on the United States Medical Licensing Examination From Results of the Comprehensive Osteopathic Medical Licensing Examination
Smith, T., Kauffman, M., Carmody, J. B., Gnarra, J.
Cureus, 2021/04
Free full text
986

Die Phänomenologie als wissenschaftliche Grundlage der Osteopathie
(Phenomenology as the scientific basis of osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/04
987

Evidence-based assessment of potential therapeutic effects of adjunct osteopathic medicine for multidisciplinary care of acute and convalescent COVID-19 patients
Marin, T., Maxel, X., Robin, A., Stubbe, L.
Explore (NY), 2021/04
Free full text
988

Effects of Osteopathic T9-T10 Vertebral Manipulation in Tonsillitis: A Randomized Clinical Trial
Luceño-Mardones, A., Luceño-Rodríguez, I., Rodríguez-López, E. S., Oliva-Pascual-Vaca, J., Rosety, I., Oliva-Pascual-Vaca, Á
Healthcare, 2021/04
Free full text
989

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04
990

Assessment of Studies Evaluating Spinal Manipulative Therapy and Infectious Disease and Immune System Outcomes: A Systematic Review
Chow, N., Hogg-Johnson, S., Mior, S., Cancelliere, C., Injeyan, S., Teodorczyk-Injeyan, J., Cassidy, J. D., Taylor-Vaisey, A., Cote, P.
JAMA Network Open, 2021/04
Free full text
991

The effect of visceral manipulation on Diastasis Recti Abdominis (DRA): A case series
Kirk, B., Elliott-Burke, T.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
992

Telemanagement of Home-Isolated COVID-19 Patients Using Oxygen Therapy With Noninvasive Positive Pressure Ventilation and Physical Therapy Techniques: Randomized Clinical Trial
Adly, A. S., Adly, M. S., Adly, A. S.
Journal of Medical Internet Research, 2021/04
Free full text
993

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
994

Direct measurement of the rhythmic motions of the human head identifies a third rhythm
Rasmussen, T. R., Meulengracht, K. C.
Journal of Bodywork and Movement Therapies, 2021/04
Free full text
995

Оценка данных динамического МРТ-обследования пациентов с грыжами межпозвонковых дисков на фоне комплексного лечения, включавшего остеопатическую коррекцию
(Evaluation of dynamic MRI data in patients with herniated intervertebral discs after the complex treatment including osteopathic correction)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2021/04
Free full text
996

Osteopathic manipulative medicine in the management of headaches associated with postconcussion syndrome
Esterov, D., Thomas, A., Weiss, K.
Journal of Osteopathic Medicine, 2021/04
Free full text
997

Возможности применения остеопатических методов коррекции в терапии дорсопатии на шейно-грудном уровне
(Possibilities of osteopathic correction methods using in the treatment of dorsopathy at the cervicothoracic level)
Belash, V. O., Nenashkina, E. N.
Russian Osteopathic Journal, 2021/04
Free full text
998

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text
999

Возможности коррекции нарушения статодинамического стереотипа у пациентов с дорсопатией на шейно-грудном уровне
(Possibilities of correction of the statodynamic stereotype violations in patients with dorsopathy at the cervical-thoracic level)
Belash, V. O., Vorobyova, A. E., Vasyukovich, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1000

Результаты включения остеопатической коррекции в состав комплексной терапии пациентов с хроническим гастритом
(Results of the inclusion of osteopathic correction in the complex therapy of patients with chronic gastritis)
Fazlyakhmetov, R. T., Safiullin, R. R., Ustinov, A. V.
Russian Osteopathic Journal, 2021/04
Free full text
1001

Эффект техники освобождения при помощи давления на латентную миофасциальную триггерную точку в верхней части трапециевидной мышцы: рандомизированное контролируемое клиническое исследование
(Effects of the release technique by pressing on the latent myofascial trigger point of the upper trapezius muscle: random controlled clinical trial)
Ferreira Faria, M. A., Bautista Aguirre, F.
Russian Osteopathic Journal, 2021/04
Free full text
1002

Эффективность остеопатической коррекции в комплексном лечении взрослых пациентов с гастроэзофагеальной рефлюксной болезнью
(The effectiveness of the osteopathic correction in the complex treatment of adult patients with gastroesophageal reflux disease)
Naletova, T. P., Udintsev, E. P., Oreshko, A. Y., Chusovitina, O. A.
Russian Osteopathic Journal, 2021/04
Free full text
1003

Становление и развитие остеопатии как научной дисциплины
(Formation and development of osteopathy as a scientific discipline)
Novikov, Y. O., Mokhov, D. E., Tregubova, E. S.
Russian Osteopathic Journal, 2021/04
Free full text
1004

Динамический туннельный синдром запястного канала: патофизиология, особенности остеопатической диагностики и лечения
(Dynamic carpal tunnel syndrome: pathophysiology, features of osteopathic diagnosis and treatment)
Stefanidi, A. V., Balabanova, N. V.
Russian Osteopathic Journal, 2021/04
Free full text
1005

Meaningful use of COMSAE Phase 1 in preparation for COMLEX-USA Level 1
Wang, X., Maeda, H., Craig, B., Tsai, T. H., Sandella, J. M., Fleury, M.
Journal of Osteopathic Medicine, 2021/04
Free full text
1006

Результаты остеопатической коррекции при миопии и спазме аккомодации у детей: систематический обзор с применением метаанализа
(Results of osteopathic correction of myopia and accommodation spasm in children: systematic review using meta-analysis)
Vedyashkina, A. S., Milutka, Y. A., Lomakina, Y. N., Potekhina, Y. P.
Russian Osteopathic Journal, 2021/04
Free full text
1007

Обоснование возможности включения остеопатической коррекции в комплекс мер по предоперационной подготовке пациентов, планируемых на расширенные абдоминальные операции
(Substantiation of the possibility of osteopathic correction inclusion in the measures complex for the preoperative preparation of patients planned for extended abdominal surgery)
Volkov, P. A., Litvinov, N. I., Bolotov, D. A.
Russian Osteopathic Journal, 2021/04
Free full text
1008

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text
1009

A Closer Look into the Association between the Sacroiliac Joint and Low Back Pain
Wieczorek, A., Campau, E., Pionk, E., Gabriel-Champine, M. E., Rios-Bedoya, C. F.
Spartan Medical Research Journal, 2021/04
Free full text
1010

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04
1011

Osteopathic medicine for fibromyalgia: a sham-controlled randomized clinical trial
Coste, J., Medkour, T., Maigne, J., Pérez, M., Laroche, F., Perrot, S.
Therapeutic Advances in Musculoskeletal Disease, 2021/04
Free full text
1012

Effektivität der Osteopathie im zentralnervösen/-neurologischen Bereich, Eine systematische Übersichtsarbeit
(Effectiveness of osteopathic manual treatments in the central nervous/ -neurological area, A Systematic review of the literature)
Pflügler, S.
Unpublished MSc thesis, 2021/04
Free full text
1013

Effektivität einer osteopathischen Behandlung der Nieren bei Leistenschmerz von Sportlern – eine einfach verblindete randomisierte Studie
(Effectiveness of an osteopathic kidney treatment for groin pain in athletes – a single blinded randomized trial)
Pakosta, M.
Unpublished MSc thesis, 2021/04
Free full text
1014

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04
1015

Der Effekt des osteopathischen Ansatzes und osteopathischer Techniken auf Symptome, insbesondere Schmerz, und Lebensqualität bei CMD – ein systematischer Review
(Efficacy of osteopathic approach and osteopathic techniques on pain, symptoms and quality of life in temporomandibular joint disorder: a systematic review)
Ixenmaier, D.
Unpublished MSc thesis, 2021/04
Free full text
1016

Auswirkungen eines auf dem Fasziendistorsionsmodell basierenden osteopathischen Interventionsprogramms auf die Hüftmobilität und subjektiv empfundene Lebensqualität von Coxarthrosepatienten im Vergleich zur physiotherapeutischen Standardbehandlung Eine randomisiert kontrollierte Studie
(A randomized controlled trial on the effects of an osteopathic treatment method according to the Fascial Distortion Model on the hip mobility and subjectively perceived quality of life of coxarthrosis patients)
Holzer-Jüttner, S.
Unpublished MSc thesis, 2021/04
1017

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text
1018

Osteopathic manipulative treatment to improve exclusive breast feeding at 1 month
Danielo Jouhier, M., Boscher, C., Roze, J. C., Cailleau, N., Chaligne, F., Legrand, A., Flamant, C., Muller, J. B.
Archives of Disease in Childhood. Fetal and Neonatal Edition, 2021/04
1019

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text
1020

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text
1021

Osteopathic Manipulative Treatment to Optimize the Glymphatic Environment in Severe Traumatic Brain Injury Measured With Optic Nerve Sheath Diameter, Intracranial Pressure Monitoring, and Neurological Pupil Index
Kashyap, S., Brazdzionis, J., Savla, P., Berry, J. A., Farr, S., Patchana, T., Majeed, G., Ghanchi, H., Bowen, I., Wacker, M. R., Miulli, D. E.
Cureus, 2021/03
Free full text
1022

Das benigne Prostatasyndrom im Kontext der Osteopathie
(Benign prostate syndrome in the context of osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1023

Die lagebedingte Plagiozephalie und deren osteopathische Intervention: Teil 1: Die Grundlagen
(Positional plagiocephaly and its osteopathic intervention. Part 1: Basics)
Engel, M.
Osteopathische Medizin, 2021/03
1024

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Expert*inneninterviews – Teil 2: Qualitative empirische Daten
(The osteopathic treatment of interosseous lesions: A qualitative content analysis of experts' interviews - Part 2: Qualitative empirical data)
Stecker, D.
Osteopathische Medizin, 2021/03
1025

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1026

Osteopathische Behandlung bei Vulvodynie
(Osteopathic treatment for vulvodynia)
Morgentau, M. J., Reinartz, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1027

Randomisierte kontrollierte Studien zur osteopathischen Behandlung des Ganglion pterygopalatinum
(Randomized controlled trials for osteopathic treatment of the pterygopalatine ganglion.)
Welzel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1028

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03
1029

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text
1030

Osteopathic model of the development and prevention of occupational musculoskeletal disorders
Price, J. W.
Journal of Osteopathic Medicine, 2021/03
Free full text
1031

Developing a psychologically-informed pain management course for use in osteopathic practice: The OsteoMAP cohort study
Abbey, H., Nanke, L., Brownhill, K.
International Journal of Osteopathic Medicine, 2021/03
1032

Patient expectations of manual and non-manual therapy within an osteopathic consultation: A cross sectional study
Tripodi, N., Garrett, A., Savic, D., Sadrani, K., Robertson, L., Volarich, S., Sirgiovanni, T.
International Journal of Osteopathic Medicine, 2021/03
1033

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03
1034

Effects of osteopathic manipulative treatment and bio-electromagnetic energy regulation therapy on lower back pain
Auger, K., Shedlock, G., Coutinho, K., Myers, N. E., Lorenzo, S.
Journal of Osteopathic Medicine, 2021/03
Free full text
1035

Support for osteopathic manipulative treatment inclusion in chronic pain management guidelines: a narrative review
Franzetti, M., Dries, E., Stevens, B., Berkowitz, L., Yao, S. C.
Journal of Osteopathic Medicine, 2021/03
Free full text
1036

Teaching and use of cervical high-velocity, low-amplitude manipulation at colleges of osteopathic medicine
Hu, A., Motyka, T., Gish, E., Dogbey, G.
Journal of Osteopathic Medicine, 2021/03
Free full text
1037

Endocannabinoids release after Osteopathic Manipulative Treatment. A brief review
Buscemi, A., Martino, S., Scirè Campisi, S., Rapisarda, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2021/03
1038

The use of 3D printing for osteopathic medical education of rib disorders
Moriles, K., Ramnot, A., Lai, M., Jacobs, R. J., Qureshi, Y.
Journal of Osteopathic Medicine, 2021/03
Free full text
1039

Dropout associated with osteopathic manual treatment for chronic noncancerous pain in randomized controlled trials
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
Journal of Osteopathic Medicine, 2021/03
1040

New clinical research urgently needed for adjunctive OMT treatment in elderly patients hospitalized with COVID-19 pneumonia
Vanacore, N.
Journal of Osteopathic Medicine, 2021/03
Free full text
1041

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03
1042

The Impact of the ACGME/AOA Single Accreditation System on Osteopathic Surgical Specialties, Residents, and DO Students
Cummings, M.
Journal of Surgical Education, 2021/03
1043

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text
1044

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03
1045

Impact of different types of revision materials on the learning of musculoskeletal techniques
Launay, F., Ménard, M., Bourgin, M., Mhadhbi, H., Sutre, F., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2021/03
1046

Effekt der Osteopathie auf Patientinnen mit Dysmenorrhoe - Ein Systematischer Review
(Effectiveness of Osteopathy in Patients with Dysmenorrhea - A systematic review)
Thurner, C.
Unpublished MSc thesis, 2021/03
Free full text
1047

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text
1048

Der tiefsitzende Beckenschmerz: Ein osteopathischer Behandlungsalgorithmus in sieben Schritten
(The chronic pelvic pain: An osteopathic treatment algorithm in seven steps)
Liedtke, H.
Osteopathische Medizin, 2021/03
1049

Abwehrreaktionen aus Sicht der viszeralen Osteopathie – Teil 2: Diskussion und Implikationen für die viszerale Osteopathie
(Defense reactions from the perspective of visceral osteopathy - Part 2: Discussion and implications for visceral osteopathy)
Wyvekens, J., Wyvekens, M., Hirth, T.
Osteopathische Medizin, 2021/03
1050

Effect of Autonomic Nervous System Recovery from Sympathetic Challenge Using Osteopathic Cranial Manipulative Medicine – A Pilot Study
Blumer, J. U.
The AAO Journal, 2021/03
Free full text
1051

Thomas L. Northup Lecture: Accepting the Death of Osteopathy: A New Beginning
Jealous, J. S.
The AAO Journal, 2021/03
Free full text
1052

Proprioceptive Coherence: An Expanded View of the Mechanics Behind the Indirect Method and the Introduction of an Innovative Variation
Lockwood, M. D.
The AAO Journal, 2021/03
Free full text
1053

Osteopathic Cranial Manipulation and Myofascial Release of Anterior Fascia to Improve Respiratory Dynamics in Obstructive Sleep Apnea Syndrome: A Case Series
Torres, J. W.
The AAO Journal, 2021/03
Free full text
1054

An Osteopathic Approach to Neck Pain
Zona, J. C., Cranor, M.
American Family Physician, 2021/03
1055

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text
1056

A splenic cyst causing a viscerosomatic reflex in the thoracic spine. A case report
Switters, J. M.
International Journal of Osteopathic Medicine, 2021/03
1057

A blame game and sticky labels: A qualitative study of osteopaths’ experiences of managing patients with pain catastrophising
Pelekanou, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/03
1058

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text
1059

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1060

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text
1061

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text
1062

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text
1063

Mindfulness-based waiting room intervention for osteopathic manipulation patients: a pilot randomized controlled trial
Hanley, A. W., Garland, E. L., Zingg, R. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1064

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text
1065

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1066

A mixed treatment comparison of selected osteopathic techniques used to treat acute nonspecific low back pain: a proof of concept and plan for further research
Price, J. W.
Journal of Osteopathic Medicine, 2021/02
Free full text
1067

Effect of occipitoatlantal decompression on cerebral blood flow dynamics as evaluated by Doppler ultrasonography
Roberts, B., Makar, A. E., Canaan, R., Pazdernik, V., Kondrashova, T.
Journal of Osteopathic Medicine, 2021/02
Free full text
1068

Auswirkung einer Behandlung des lateralen Triggerbandes des Oberschenkels nach Prinzipien des Fasziendistorsionsmodells auf die Hüftbeweglichkeit
(Effect of a treatment of the lateral trigger band of the thigh according to the principles of the fascia distortion model by Dr. Stephen Typaldos on hip mobility)
Schulz, K.
Unpublished MSc thesis, 2021/02
Free full text
1069

Supportive care and osteopathic medicine in pediatric oncology: perspectives of current oncology clinicians, caregivers, and patients
Belsky, J. A., Stanek, J., Skeens, M. A., Gerhardt, C. A., Rose, M. J.
Supportive Care in Cancer, 2021/02
Free full text
1070

Mindfulness: Principles and Application to Decrease Opiate Use in Primary Care With an Osteopathic Component
Frasca, D. J.
Osteopathic Family Physician, 2021/02
Free full text
1071

Effektivität der Osteopathischen Behandlung auf den Blutdruck - Eine Literaturübersichtsarbeit
(The effectiveness of the osteopathic treatment on blood pressure - A systematic review)
Vorreiter, A.
Unpublished MSc thesis, 2021/02
Free full text
1072

Osteopathische Behandlung bei Erwachsenen mit Zerebralparese - Wirkung eines osteopathischen Behandlungsprotokolls im Vergleich zur Vojta-Therapie auf Lungenfunktionsstörungen bei Erwachsenen mit Zerebralparese
(Osteopathic treatment of adults with cerebral palsy – Effects of an osteopathic treatment protocol compared with Vojta-therapy on impaired lung function in adults with cerebral palsy)
Walter, U.
Unpublished MSc thesis, 2021/02
1073

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02
1074

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text
1075

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02
1076

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text
1077

Einfluss der Osteopathie auf das Hormon Cortisol
(The Effects of an Osteopathic Treatment on Cortisol Levels)
Lederbauer, C.
Unpublished MSc thesis, 2021/02
Free full text
1078

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02
1079

Die osteopathische Anwendung der CV4 Technik bei Patientinnen und Patienten mit chemoinduzierter Polyneuropathie nach zytostatischer Chemotherapie
(The Osteopathic Application of the CV4 Technique in Patients with Chemotherapy-induced Polyneuropathy after Cytostatic Chemotherapy)
Flaschberger, P.
Unpublished MSc thesis, 2021/02
Free full text
1080

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text
1081

Einfluss einer osteopathischen Behandlung auf chemotherapeutisch induzierte Nausea und Vomiting (CINV) und auf die gesundheitsbezogene Lebensqualität während emetogen wirkender Chemotherapie
(The Influence of Osteopathic Treatment on Chemotherapy Induced Nausea and Vomiting (CINV) and Health Related Quality of Life (QoL) in Patients with Cancer treated with Emetogenic Chemotherapy)
Aranya-Mayr, J.
Unpublished MSc thesis, 2021/02
1082

A national cross-sectional survey of the attitudes, skills and use of evidence-based practice amongst Spanish osteopaths
Alvarez, G., Justribo, C., Sundberg, T., Thomson, O. P., Leach, M. J.
BMC Health Services Research, 2021/02
Free full text
1083

Forschung in der Osteopathie. Eine qualitative, phänomenologische und systematische Studie.
(Research in Osteopathy. A qualitative, phenomenological and systematic study.)
Stecker, D.
unpublished MSc thesis, 2021/02
Free full text
1084

Osteopathische Behandlung bei Plagiozephalie
(Osteopathic treatment of plagiocephaly)
Kenner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1085

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1086

Die Osteopathie aus Sicht der Allgemeinmediziner – eine qualitative Interviewstudie
(Osteopathy from the point of view of general practitioners - a qualitative interview study)
Waubert de Puiseau, A., Hörcher, M., Belz, S., Esch, S.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1087

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1088

Ist kraniale Osteopathie zuverlässig und wirksam?
(Is cranial osteopathy reliable and effective?)
Reißmann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01
1089

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text
1090

Osteopathic manipulative treatment in individuals with vertigo and somatic dysfunction: a randomized, controlled, comparative feasibility study
Fraix, M., Badran, S., Graham, V., Redman-Bentley, D., Hurwitz, E. L., Quan, V. L., Yim, M., Hudson-McKinney, M., Seffinger, M. A.
Journal of Osteopathic Medicine, 2021/01
Free full text
1091

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1092

Thematic Analysis of Attitudes Held by a Group of Italian Osteopaths Toward Osteopathic Evaluation, Treatment, and Management in the Neonatal and Pediatric Field: A Qualitative Study
Lunghi, C., Iacopini, A., Baroni, F., Consorti, G., Cerritelli, F.
Journal of Manipulative and Physiological Therapeutics, 2021/01
1093

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text
1094

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01
1095

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1096

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text
1097

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text
1098

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text
1099

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text
1100

Investigating the current literature comprising osteopathic manual therapy (OMT) as an intervention: A scoping review
Ryan, H.
Unpublished MSc thesis, 2021/01
Free full text
1101

Effects of Craniosacral Osteopathy in Patients with Peripheral Vestibular Pathology
Atay, F., Bayramlar, K., Sarac, E. T.
ORL - Journal for Oto-Rhino-Laryngology and its Related Specialties, 2021/01
1102

A Class By Themselves: Texas' Newest Med Schools Adjust to COVID-19
Price, S.
Texas Medicine, 2021/01
1103

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text
1104

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text
1105

Effectiveness of osteopathic interventions in chronic non-specific low back pain: A systematic review and meta-analysis
Dal Farra, F., Risio, R. G., Vismara, L., Bergna, A.
Complementary Therapies in Medicine, 2021/01
Free full text
1106

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text
1107

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text
1108

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text
1109

Inanspruchnahme osteopathischer Medizin bei chronisch und Langzeit-Erkrankten
(Use of osteopathic medicine for chronic and long-term patients)
Beer, A.M., Kiseier, P., Weber, H.
Journal für Pharmakologie und Therapie, 2021
Free full text
1110

Veränderungen des Visus durch Therapie der Synchondrosis sphenooccipitalis an Kurzsichtigen - eine doppelblindierte Studie
(Changes in visual acuity due to therapy of sphenooccipital synchondrosis in myopic patients - a double-blind study)
Angerer, S.
Unpublished MSc thesis, 2020/12
Free full text
1111

The short-form Orebro Musculoskeletal Pain Questionnaire (OMPQ-10): Associations with determinants of health and demographics in a musculoskeletal pain cohort
Vaughan, B., Fitzgerald, K., Flesichmann, M., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/12
1112

Osteopathic Manual Treatment for Pain Severity, Functional Improvement, and Return to Work in Patients With Chronic Pain
Rehman, Y., Ferguson, H., Bozek, A., Blair, J., Allison, A., Johnston, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1113

Das osteopathische Labor: Erfahrung ermöglichen
(The osteopathic laboratory: Enabling experience)
Levin, P., Strebel, W.
Osteopathische Medizin, 2020/12
1114

The Effect of Osteopathic Manipulative Treatment (OMT) on Proprioception in Adults: A Pilot Study
Hoevemeyer, K., Teng, K. Y., Mehner, T., McMunn, R., Figueroa, J., Jie, C.
The AAO Journal, 2020/12
Free full text
1115

Professionnalisation des formateurs en ostéopathie à travers l'analyse de leur activité
(Professionalization of osteopathic teachers through analysis of their activity)
Garnier, F.
Unpublished PhD thesis, 2020/12
Free full text
1116

La prise en charge des grands syndromes cranio-maxillo-faciaux en ostéopathie pédiatrique : Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy
(Treatment of major cranio-maxillo-facial syndromes in pediatric osteopathy)
Lalauze-Pol, R.
Unpublished PhD thesis, 2020/12
1117

Knowledge of Nutritional Issues among Osteopaths in Austria: A Cross-Sectional Study
Putschögl, J., Woisetschläger, G.
European Journal of Osteopathic Research, 2020/12
Free full text
1118

The influence of an osteopathic treatment on pregnant women on expected date of delivery on the course of parturition and the subjective well-being: A Pilot Study
Tauch, A.
European Journal of Osteopathic Research, 2020/12
Free full text
1119

Psychosomatische Osteopathie bei Trauma am Beispiel der bifokalen Integration
(Psychosomatic osteopathy in trauma using the example of bifocal integration)
Liem, T., Neuhuber, W.
Osteopathische Medizin, 2020/12
1120

Characteristics and Management of Pregnant Patients From a Neuromusculoskeletal Medicine/Osteopathic Manipulative Medicine Clinic
Frank, L. D., Bhatia, S., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1121

Osteopathic Approach to the Treatment of a Patient With Idiopathic Iliohypogastric Neuralgia
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1122

CRI over MRI: A Cranial Approach to Dizziness
Qureshi, Y., Patel, U., Mercer, A.
The AAO Journal, 2020/12
Free full text
1123

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1124

Osteopatia in Italia. Passato, presente e prospettive future: parte I
(Osteopathy in Italy. Past, present and future perspectives. Part 1)
Civitillo, C., Marasco, M. L., D&rsquo, Onofrio, R.
GIOSBE Journal, 2020/12
Free full text
1125

Wissenschaftlich fundiert oder fragwürdiger Mythos?: Osteopathische Behandlungserfolge im Vergleich zur Schulmedizin während der Spanischen Grippe in den USA
(Scientifically substantiated or questionable myth?: Comparison between osteopathic treatment successes and conventional medicine during the Spanish flu in the USA)
Schwerla, F., Franke, H.
Osteopathische Medizin, 2020/12
1126

Der Milchglasblick oder das Lächeln der Mona Lisa
(The frosted glass look or the smile of Mona Lisa)
Sibbing, D.
Osteopathische Medizin, 2020/12
1127

20 Jahre „Osteopathische Medizin”: Ein Blick in die Vergangenheit und in die Zukunft
(20 years of “Osteopathische Medizin“: A look into the past and into the future)
Tempelhof, Siegbert
Osteopathische Medizin, 2020/12
1128

The Use of Osteopathic Manipulative Medicine in the Management of Recurrent Mastitis
Jackson, C., Loveless, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1129

Crying Unsettled and disTressed Infants Effectiveness Study of osteopathic care (CUTIES trial): Pragmatic randomised superiority trial protocol
Carnes, D., Bright, P., Brownhill, K., Carroll, K., Engel, R., Grace, S., Vogel, S., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/12
1130

Upper airway stabilization by osteopathic manipulation of the sphenopalatine ganglion versus sham manipulation in OSAS patients: a proof-of-concept, randomized, crossover, double-blind, controlled study
Jacq, O., Arnulf, I., Similowski, T., Attali, V.
BMC Complementary and Alternative Medicine, 2020/12
Free full text
1131

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1132

Brain Connectivity Changes after Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tramontano, M., Cerritelli, F., Piras, F., Spanò, B., Tamburella, F., Piras, F., Caltagirone, C., Gili, T.
Brain Sciences, 2020/12
Free full text
1133

Результаты комплексного лечения с включением остеопатической коррекции соматических дисфункций при перинатальном поражении ЦНС у детей первого года жизни
(Results of complex treatment with the inclusion of osteopathic correction of somatic dysfunctions in perinatal CNS lesions in children of the first year of life)
Abramova, E. V., Aptekar, I. A., Aptekar, V. I., Yudina, A. A.
Russian Osteopathic Journal, 2020/12
Free full text
1134

Сравнительное исследование эффективности стандартной и комплексной, включающей остеопатическую коррекцию, терапии пациентов с дискогенной SI радикулопатией
(Comparative study of the effectiveness of standard therapy and the complex therapy with inclusion of osteopathic correction, in patients with discogenic SI radiculopathy)
Adrianova, S. M., Akhmetov, B. H.
Russian Osteopathic Journal, 2020/12
Free full text
1135

Рефлексотерапия в лечении пациентов с дорсопатией
(Reflexology in the treatment of patients with dorsopathy)
Belash, V. O., Agasarov, L. G.
Russian Osteopathic Journal, 2020/12
Free full text
1136

Остеопатическая коррекция в комплексной терапии пациентов с гемиспазмом
(Osteopathic correction in the complex therapy of patients with hemispasm)
Belash, V. O., Guzhina, E. Y.
Russian Osteopathic Journal, 2020/12
Free full text
1137

Osteopathic Manipulative Treatment Versus Exercise Program in Runners With Patellofemoral Pain Syndrome: A Randomized Controlled Trial
Zago, J., Amatuzzi, F., Rondinel, T., Matheus, J. P.
Journal of Sport Rehabilitation, 2020/12
1138

The effect of osteopathic medicine on pain in musicians with nonspecific chronic neck pain: a randomized controlled trial
Rotter, G., Fernholz, I., Binting, S., Keller, T., Roll, S., Kass, B., Reinhold, T., Willich, S. N., Schmidt, A., Brinkhaus, B.
Therapeutic Advances in Musculoskeletal Disease, 2020/12
Free full text
1139

2020 AOA Research Abstracts and Poster Competition
listed, No authors
The Journal of the American Osteopathic Association, 2020/12
Free full text
1140

Сравнение влияния миотензивной техники Митчелла и так называемой техники укорочения с сопротивлением на пассивную осевую ротацию шейного отдела позвоночника
(Comparison of the effects of a Mitchell’s myotensive technique and the strain-shortening technique on passive axial rotation of the cervical spine)
Dehiles, R., Salem, W., Klein, P.
Russian Osteopathic Journal, 2020/12
Free full text
1141

Utilizing Osteopathic Manipulative Treatment as a Non-Surgical Approach to Severs Disease in a Growing Adolescent
Madhu, B., Goldenhart, A.
Southern Medical Journal, 2020/12
1142

Сравнение эффективности мануальной терапии и фармакотерапии в лечении и реабилитации пациентов с синдромом грушевидной мышцы
(Comparison of manual therapy and pharmacotherapy effectiveness in the treatment and rehabilitation of patients with piriformis syndrome)
Frolov, V. A., Akopyan, M. S., Berezin, V. V.
Russian Osteopathic Journal, 2020/12
Free full text
1143

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
1144

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12
1145

Особенности остеопатического статуса у недоношенных детей с внутрижелудочковым кровоизлиянием
(Osteopathic status of preterm infants with intraventricular hemorrhage)
Karimova, L. K., Kuzmina, J. O., Zinnurova, Z. N., Vasilevskaja, E. M.
Russian Osteopathic Journal, 2020/12
Free full text
1146

Влияние остеопатической коррекции на уровень стресса у пациенток с цервикокраниалгией
(The influence of osteopathic correction to the level of stress in patients with cervicobrachialgia)
Korman, D. V., Yushmanov, I. G.
Russian Osteopathic Journal, 2020/12
Free full text
1147

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
1148

Остеопатическая коррекция в составе комплексного лечения первичного билиарного холангита
(Osteopathic correction as part of the complex treatment of primary biliary cholangitis)
Lebedev, D. S., Nizamova, A. H.
Russian Osteopathic Journal, 2020/12
Free full text
1149

Возможности и организационные проблемы диагностики и лечения пациентов с синдромом болевой дисфункции височно-нижнечелюстного сустава
(Possibilities and organizational problems of diagnostics and treatment of patients with the syndrome of temporomandibular joint pain dysfunction)
Milutka, Y. A., Fortin, A. E.
Russian Osteopathic Journal, 2020/12
Free full text
1150

The Effect of Osteopathic Manipulative Treatment on Lower Limb Muscle Rigidity in a Parkinson's Patient
Vemuri, A., Xu, E., Downing, M., Widboom, N.
Southern Medical Journal, 2020/12
1151

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text
1152

Die Brustdrüse aus osteopathischer Sicht: Teil 2: Praktische Anwendung
(The mammary gland from an osteopathic point of view - Part 2: Practical application)
Frühwein, J.
Osteopathische Medizin, 2020/12
1153

Einzelfallstudie über den Einfluss einer osteopathischen Behandlung eines Mannes mit unerfülltem Kinderwunsch
(Single Case Study on the Influence of an Osteopathic Treatment of One Man with the Unfulfilled Desire To Have a Child)
Mayrhofer, M.
Unpublished MSc thesis, 2020/12
Free full text
1154

[PREPRINT] “Somebody Who Does Something Other Than Osteopathy“
Sajjadi, N. B., Shepard, S.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1155

An Osteopathic Modular Approach to Asthma: A Narrative Review
Schend, J., Rowane, M., Sanan, N., Hostoffer, S. R.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1156

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1157

The clinical management of neck pain of novice and experienced Australian osteopaths: a secondary analysis of a nationally representative sample
Fleischmann, M., McLaughlin, P., Hayes, A., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2020/11
1158

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1159

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11
1160

Neurophysiologische Aspekte der osteopathischen Palpation gemessen mit der Herzratenvariabilitätsmessung
(Neurophysiological aspects of osteopathic palpation measured with the heart rate variability measurement)
Strohmaier, B.
Unpublished MSc thesis, 2020/11
Free full text
1161

Osteopathische Anwendung bei Aufmrksamkeits - Defizit - Syndrom
(Osteopathic application in case of lack of concentration)
Werth, B.
Unpublished MSc thesis, 2020/11
1162

Die Verwendung von Komplementärmedizin im Leistungssport: Ergebnisse einer Querschnittsstudie.
Use of Complementary Medicine in Competitive Sports: Results of a Cross-Sectional Study
Rotter, G., Schollbach, L., Binting, S., Dornquast, C., Scherr, J., Pfab, F., Brinkhaus, B.
Complementary medicine research, 2020/11
Free full text
1163

Osteopathic manipulative treatment in a general pediatric setting: An account of reflective practice
Mills, M. V.
Complementary Therapies in Clinical Practice, 2020/11
1164

Osteopathic Approach to Treatment of Carpal Dysfunction: The Carpal Mobilization Technique
Mehner, T. R., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/11
Free full text
1165

Die Sicherheit von Osteopathie bei Schwangeren anhand der Auswirkung auf das mögliche Risiko von Komplikationen vor, während und nach der Geburt
(The safety of osteopathy in pregnant women based on its impact on the risk of complications before, during, and after childbirth)
Kleindessner, A.
Unpublished MSc thesis, 2020/11
Free full text
1166

Auswirkungen des CV4 bei PflegerInnen in der stationären Altenpflege, gemessen anhand der psychischen Belastung und Beanspruchung
(Effects of CV4 on nurses in elderly residential care, measured on the basis of mental workload and strain)
Falkensteiner, S.
Unpublished MSc thesis, 2020/11
Free full text
1167

Chronisch-funktionelle Obstipation bei Kindern – Eine fallkontrollierte Studie Ist Osteopathie effektiver als die medizinische Standardbehandlung?
(Functional Constipation in Childhood – A Case Controlled Study Is osteopathic treatment more effective than medicinal standard treatment?)
Eisenschenk, R.
Unpublished MSc thesis, 2020/11
Free full text
1168

Einfluss einer osteopathischen Behandlung der Halswirbelsäule bei Schulterschmerzen
(Influence of an osteopathic treatment on shoulder pain)
Albrecht, J. M.
Unpublished MSc thesis, 2020/10
Free full text
1169

Situation, Chancen und Herausforderungen der Osteopathie in der Schweiz
(Characteristics, Opportunities and Challenges of Osteopathy in Switzerland)
Meier, M. D., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1170

Evaluating the quality of clinical teaching in osteopathy
Vaughan, B.
Unpublished PhD thesis, 2020/10
Free full text
1171

Anwendung des Viszeroletic-Konzeptes beim Reizdarmsyndrom
(Applying the Visceroletic-Concept to the Irritable Bowel Syndrome)
Ryback, S.
Unpublished MSc thesis, 2020/10
Free full text
1172

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text
1173

Cranial osteopathic treatment and stress-related effects on autonomic nervous system measured by salivary markers: A pilot study
Abenavoli, A., Badi, F., Barbieri, M., Bianchi, M., Biglione, G., Dealessi, C., Grandini, M., Lavazza, C., Mapelli, L., Milano, V., Monti, L., Seppia, S., Tresoldi, M., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2020/10
1174

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text
1175

Clinical characteristics of osteopaths treating work-related injuries in Australia: a cross-sectional study
Adams, J., Peng, W., Steel, A., Vaughan, B., Fleischmann, M., Fitzgerald, K., Sibbritt, D.
International Journal of Osteopathic Medicine, 2020/10
1176

New investigator editorial: the osteopathic medical student perspective on research
Persand, D., Maddie, N.
American Journal of Physiology. Heart and Circulatory Physiology, 2020/10
Free full text
1177

Effektivität von Osteopathie bei Patient/en/innen mit gastrointestinalen Erkrankungen; Eine systematische Übersichtsarbeit
(Effectiveness of Osteopathy in Patients with Gastrointestinal Diseases - A Systematic Review)
Schönberger, B.
Unpublished MSc thesis, 2020/10
Free full text
1178

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1179

Osteopathic Medical Licensing Compliance With the Americans With Disabilities Act of 1990
Lincoln, K. A., Wagner, B. E.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1180

Attitudes, skills, and use of evidence-based practice: a cross-sectional survey of Swedish osteopaths
Leach, M. J., Shaw, R., Austin, P., Fryer, G., Thomson, O. P., Adams, J., Skillgate, E., Sundberg, T.
International Journal of Osteopathic Medicine, 2020/10
1181

Osteopathie bei PatientInnen mit Knochenmarködemen im Kniegelenksbereich - Eine nicht kontrollierte Interventionsstudie
(Osteopathy related to patients with bone marrow edema – A non-controlled intervention study)
Taferner, W.
Unpublished MSc thesis, 2020/10
Free full text
1182

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10
1183

The Role of Musculoskeletal Disorders in Chronic Disease: A Narrative Review
Asahi, M. G., Briganti, D., Cam, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1184

Osteopathic Manipulative Treatments for Pediatric Conditions
Raines, S. G. M., Ramey, A. L.
Osteopathic Family Physician, 2020/10
Free full text
1185

A Case of Resolved Vincristine-Induced Constipation Following Osteopathic Medicine in a Patient With Infantile Fibrosarcoma
Belsky, J. A., Wolf, K., Setty, B. A.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1186

Osteopathic Manipulative Treatment for a Recognizable Pattern of Somatic Dysfunction Following Laparoscopic Cholecystectomy
Mills, M., Sevensma, K., Serrano, J.
The Journal of the American Osteopathic Association, 2020/10
Free full text
1187

La fascia desde la medicina osteopática
(Fascia from the perspective of osteopathic medicine)
Stambulie Padilla, E. A.
Unpublished MSc thesis, 2020/10
Free full text
1188

Treating Complex Regional Pain Syndrome Using Counterstrain: A Novel Approach
Schranz, K., Meitz, D., Powers, B., Ables, A.
Cureus, 2020/10
Free full text
1189

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text
1190

Osteopathie in Norwegen
(Osteopathy in Norway)
Becher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1191

Im Gespräch mit … Diana Stöckl
(In dialog with … Diana Stöckl)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1192

Osteopathie bei umschriebenen Entwicklungsstörungen
(Osteopathy for specific developmental disorder)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1193

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10
1194

Auswirkungen von osteopathischen Behandlungen im Vergleich zur Anwendung eines Entspannungsverfahrens auf die Lebensqualität von Endometriose-Patientinnen
(Effects of Osteopathic Treatments in Comparison to a Relaxation-Method on the Quality of Life of Endometriosis Patients)
Kremen-Pilz, I.
Unpublished MSc thesis, 2020/10
Free full text
1195

Osteopathie bei epileptischen Anfällen
(Osteopathy for epileptic disorder)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10
1196

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht Teil 2: Was wirkt im Wirk-Bündnis der Osteopathie?
(Who and what constitutes connection within osteopathic treatment? A medical-philosophical contribution from the osteopathic point of view. Part 2: What works in the active alliance of osteopathy?)
Kaiser, A. K.
Osteopathische Medizin, 2020/09
1197

Die kranio-kaudale Bewegung im Articulatio tibiofibulare proximalis bei einer Dorsalextension und Plantarflexion im Articulatio talocruralis
(The cranial and caudal movement of the Art. Tibiofibularis proximalis during dorsalextension and plantarflexion)
Bernhardt, M.
Unpublished MSc thesis, 2020/09
Free full text
1198

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text
1199

Continuing debates about models of practice
Vogel, S.
International Journal of Osteopathic Medicine, 2020/09
1200

The Immediate, Intermediate, and Long-Term Effects of Osteopathic Manipulative Treatment on Pulmonary Function in Adults with Asthma
Kasten, K. M., Tyler, S. K., Johnson, A. R., Kolakowski, E. R., Pickos, J., Heineman, K., Jie, C.
The AAO Journal, 2020/09
Free full text
1201

Osteopathische Behandlung des Larynx
(Osteopathic treatment of the larynx)
Liem, T.
Osteopathische Medizin, 2020/09
1202

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09
1203

Severe Viscerosomatic Neck Pain from Refractory Gastroesophageal Reflux
Uhrig, J., Rettos, J.
The AAO Journal, 2020/09
Free full text
1204

Die osteopathische Behandlung von intraossären Läsionen: Eine qualitative Inhaltsanalyse von Experteninterviews – Teil 1: Theorie und Forschungsstand
(The osteopathic treatment of interosseous lesions. A qualitative content analysis of experts' opinion - Part 1: Theory and state of research)
Stecker, D.
Osteopathische Medizin, 2020/09
1205

Erweiterung des biopsychosozialen Modells für die muskuloskelettale Praxis: Teil 2: Klinische Bedeutung für die muskuloskelettale Behandlung (German translation)
(Extension of the biopsychosocial model for musculoskeletal practice. Part 2: Clinical significance for musculoskeletal treatment)
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
Osteopathische Medizin, 2020/09
1206

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text
1207

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09
1208

EEG-Fokus: osteopathisch-manualmedizinische Therapie?
Paul, Heike, Heller, Rainer
Manuelle Medizin, 2020/09
1209

What Makes an Osteopathic Treatment Effective From a Patient's Perspective: A Descriptive Phenomenological Study
Consorti, G., Marchetti, A., De Marinis, M. G.
Journal of Manipulative and Physiological Therapeutics, 2020/09
1210

Обоснование сочетанного применения остеопатических методов коррекции и рефлексотерапии в комплексной терапии пациентов с дорсопатией на шейно-грудном уровне
(The rationale for the combined use of osteopathic methods of correction and reflexology in the complex treatment of patients with dorsopathy at the cervico-thoracic level)
Belash, V. O., Urazgalieva, L. R., Fayzullina, R. I., Agasarov, L. G.
Russian Osteopathic Journal, 2020/09
Free full text
1211

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in women: a pilot study
Taylor, V. J.
Unpublished MSc thesis, 2020/09
Free full text
1212

Assessing the feasibility of a therapy package application on reducing psychological and physiological stress in men: a pilot study
Rahier, A.
Unpublished MSc thesis, 2020/09
Free full text
1213

“Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research”
Lunghi, C., Liem, T.
International Journal of Osteopathic Medicine, 2020/09
1214

Модель фасциальных дисторсий (FDM-терапия). Принципы диагностики и лечения (обзор литературы)
(Fascial distortion model (FDM-therapy). Principles of diagnosis and treatment (literature review))
Boldin, A. V., Sokolin, S. B., Tardov, M. V., Haimov, E. I.
Russian Osteopathic Journal, 2020/09
Free full text
1215

Структура соматических дисфункций у женщин с узловой формой миомы матки
(The structure of somatic dysfunctions in women with a nodular form of uterine myoma)
Chebotaeva, G. N., Lebedev, D. S.
Russian Osteopathic Journal, 2020/09
Free full text
1216

„Der Dampf des Lebens“: Das Blut im Kontext der (klassischen) Osteopathie
“The steam of life“: The blood in the context of (classical) osteopathy
Engel, M.
Osteopathische Medizin, 2020/09
1217

Влияние общего остеопатического лечения на функцию внешнего дыхания детей, страдающих астмой
(Effects of a General Osteopathic treatment on asthmatic children)
Ernoult, B., Job, H.
Russian Osteopathic Journal, 2020/09
Free full text
1218

Обоснование применения методов остеопатической коррекции у пациентов с синдромом Зудека
(Rationale for the use of osteopathic correction methods in patients with Sudeck syndrome)
Mikhnov, G. I., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/09
Free full text
1219

Возможности применения остеопатических методов коррекции в лечении болевого синдрома при нефроптозе
(Possibilities of applying of osteopathic correction methods in the treatment of pain syndrome in nephroptosis)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/09
Free full text
1220

Этиопатогенетические аспекты формирования соматических дисфункций во время беременности
(Etiopathogenetic aspects of somatic dysfunction formation during pregnancy)
Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2020/09
Free full text
1221

Применение физио- и бальнеотерапии у пациентов с неспецифической болью в нижней части спины (обзор литературы)
(The application of physical therapy and balneology of the patients with non-specific low back pain (literature review))
Novikov, A. Y., Shaiakhmetov, A. R., Novikov, Y. O.
Russian Osteopathic Journal, 2020/09
Free full text
1222

Особенности остеопатического статуса у практически здоровой группы мужского населения призывного возраста
(The osteopathic status specific of the practically healthy group of the military age male population)
Petrova, G. V., Pushkarev, I. M., Savel′yeva, N. V., Solovey, N. L., Shiryayeva, E. E., Yanushanets, O. I.
Russian Osteopathic Journal, 2020/09
Free full text
1223

Osteopathie für Neugeborene in der Klinik?: Eine qualitative Studie
Osteopathy for newborns in hospitals?: A qualitative study
Brintrup, V., Hartmann, M., Herrmann, H., Belz, S., Esch, S.
Osteopathische Medizin, 2020/09
1224

Response to: Models and theoretical frameworks for osteopathic care - A critical view and call for updates and research
Santiago, R., Campos, B., Moita, J., Nunes, A. C. L.
International Journal of Osteopathic Medicine, 2020/09
1225

Instrumentation used to assess pain in osteopathic interventions: A critical literature review
Santiago, R. J., Esteves, J., Baptista, J. S., Marques, A. T., Costa, J. T.
International Journal of Osteopathic Medicine, 2020/09
1226

What do UK osteopaths view as the safest lifting posture, and how are these views influenced by their back pain beliefs?
Smith, K., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/09
1227

Übersicht der osteopathischen Studien 2019: Der INIOST Studienreport 2019
(Overview of the osteopathic studies in 2019: The INIOST Study Report 2019)
Franke, H.
Osteopathische Medizin, 2020/09
1228

Die Brustdrüse aus osteopathischer Sicht: Teil 1: Grundlagen
(The mammary gland from an osteopathic point of view. Part 1: Fundamentals)
Frühwein, J.
Osteopathische Medizin, 2020/09
1229

Biomedical origins of the term 'osteopathic lesion' and its impact on people in pain
Noy, M., Macedo, L., Carlesso, L.
International Journal of Osteopathic Medicine, 2020/09
1230

The development and exploratory analysis of the Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ)
Thomson, O. P., Anstiss, V.
International Journal of Osteopathic Medicine, 2020/09
1231

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1232

Utilizing Health Professional Students’ Knowledge, Attitudes, and Beliefs to Inform the Development of a Contact-Based Educational Approach to Address the Opioid Epidemic
Mort, S. C.
Unpublished PhD thesis, 2020/08
Free full text
1233

Does Osteopathic Manipulative Treatment Induce Autonomic Changes in Healthy Participants? A Thermal Imaging Study
Cerritelli, F., Cardone, D., Pirino, A., Merla, A., Scoppa, F.
Frontiers in Neuroscience, 2020/08
Free full text
1234

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1235

Effectiveness of Osteopathic Manipulative Medicine vs Concussion Education in Treating Student Athletes With Acute Concussion Symptoms
Yao, S. C., Zwibel, H., Angelo, N., Leder, A., Mancini, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1236

Osteopathic Manipulative Treatment for Inhaled Rib Somatic Dysfunction
Koch, J., Tsui, C., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1237

Comparison between high-velocity low-amplitude manipulation and muscle energy technique on pain and trunk neuromuscular postural control in male workers with chronic low back pain: A randomised crossover trial
Sturion, L. A., Nowotny, A. H., Barillecb, F., Barette, G., Santosa, G. K., Teixeirac, F. A., Fernandes, K. P., Da Silva, R.
South African Journal of Physiotherapy, 2020/08
Free full text
1238

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1239

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1240

Osteopathic Medicine and the Osteoporosis Management Gap
Lowery, J. W., Baker, J., Gebhardt, G. P., Gorbis, S., Hoehn, A., Hum, J. M., Nelligan, L., Sefcik, D., Wacker, B., Wagner, A., Williams, D., Wright, A.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1241

Treatment Modalities for Notalgia Paresthetica Including OMT
Cooley, D., McAree, M., Joshi, N., Peerzada, W.
Osteopathic Family Physician, 2020/08
Free full text
1242

Telemedicine During a Pandemic with Osteopathic Considerations
Rhoads, A.
Osteopathic Family Physician, 2020/08
Free full text
1243

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1244

Rib Somatic Dysfunction Among General Surgical Patients
Baltazar, G. A., Kolwitz, C. E., Florek, M. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1245

Clinical Efficacy of Mesenteric Lift to Relieve Constipation in Traumatic Brain Injury Patients
Berry, J. A. D., Ogunlade, J., Kashyap, S., Berry, D. K., Wacker, M., Miulli, D. E., Saini, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text
1246

Use of Osteopathic Manipulation for Treatment of Chronic Shoulder Injury Related to Vaccine Administration
Veera, S., Chin, J., Kleyn, L., Spinelli, S., Tafler, L.
Cureus, 2020/08
Free full text
1247

Positional plagiocephaly from structure to function: Clinical experience of the service of pediatric osteopathy in Italy
Filisetti, M., Cattarelli, D., Bonomi, S.
Early Human Development, 2020/07
1248

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07
1249

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1250

Perspectives on tissue adaptation related to allostatic load: scoping review and integrative hypothesis with a focus on osteopathic palpation
Lunghi, C., Consorti, G., Tramontano, M., Esteves, J. E., Cerritelli, F.
Journal of Bodywork and Movement Therapies, 2020/07
1251

Vestibular failure managed with osteopathic manipulative treatment: A report of two cases
Origo, D., Tarantino, A. G., Romagnoli, M.
Journal of Bodywork and Movement Therapies, 2020/07
1252

Osteopathic Treatment leads to significantly greater reductions in chronic thoracic pain after CABG surgery: a randomised controlled trial
Roncada, Gert
Journal of Bodywork and Movement Therapies, 2020/07
1253

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07
1254

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text
1255

Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Cicchitti, L., Di Lelio, A., Barlafante, G., Cozzolino, V., Di Valerio, S., Fusilli, P., Lucisano, G., Renzetti, C., Verzella, M., Rossi, M. C.
Medical sciences, 2020/07
Free full text
1256

Osteopathic Manipulation in the Management of Chronic Pain: Current Perspectives
Licciardone, J. C., Schultz, M. J., Amen, B.
Journal of Pain Research, 2020/07
Free full text
1257

Auswirkungen osteopathischer Techniken an der Pleura parietalis auf das Atemvolumen: Eine Pilotstudie mit gesunden Erwachsenen
(Effects of osteopathic techniques applied to the Pleura parietalis on the respiratory volume: a pilot study with healthy adults)
Strnad, V.
Unpublished MSc thesis, 2020/07
Free full text
1258

Osteopathic Response to the COVID-19 Pandemic
Martinez, E., Redding, D.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1259

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text
1260

Wer und was wirkt im therapeutischen Wirk-Bündnis der Osteopathie?: Ein medizinphilosophischer Beitrag aus osteopathischer Sicht, Teil 1: Was ist ein Osteopath?
(Who and what work in the effective therapeutic alliance of osteopathy? - A medical-philosophical contribution from the point of view of osteopathy. Part 1: What is an osteopath?)
Kaiser, A. K.
Osteopathische Medizin, 2020/06
1261

Regulationsstörung bei Säuglingen: neue An- und Aussichten
(Regulation disorder in infants: new approaches and prospects)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1262

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1263

Die visuelle Vorstellung in der osteopathischen Palpation
(Visual Imagination in Osteopathic Palpation)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1264

Self-management behaviour and knowledge of patients with musculoskeletal complaints attending an Australian osteopathy clinic: A consecutive sampling design
Vaughan, B., Grant, M., Moroz, J., Ngawaka, C., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/06
1265

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text
1266

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1267

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text
1268

OMT bei der Behandlung von Infektionskrankheiten zu Beginn des 20. Jahrhunderts: Mit Anmerkungen aus aktuellen Forschungen und Behandlungsmodalitäten
(OMT in the treatment of infectious diseases at the beginning of the 20th century: With comments from current research and treatment modalities)
Liem, T.
Osteopathische Medizin, 2020/06
1269

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06
1270

Integrating Osteopathic Manipulative Treatment and Injections in the Diagnosis and Management of a Hip Labral Tear
Snyder, L. L., Knox, S. C., Smutny, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1271

Das Konzept „Hotelzimmer Uterus” möchte als anschauliche Allegorie dem Osteopathen und der (werdenden) Mutter aufzeigen, dass potenzielle Schockenergien, insbesondere in den Uteruswänden, einen negativen Effekt auf ein Ungeborenes haben oder sogar eine erfolgreiche Schwangerschaft verhindern kann. Es werden insbesondere Themen wie Kindsverlust und sexuelle Übergriffe angesprochen, da sie erfahrungsgemäß am ehesten gespeicherte (potenzielle) Schockenergien im gynäkologischen System hinterlassen. Das Phänomen Schockenergie wie auch die therapeutischen Ansätze zu deren Ausleitung werden kurz erläutert, insbesondere auch eventuelle Risiken bei der Behandlung in der Schwangerschaft.
(Shock in the uterus: The “hotel room“ phenomenon)
Muntinga, E.
Osteopathische Medizin, 2020/06
1272

Choosing Primary Care: Factors Influencing Graduating Osteopathic Medical Students
Stefani, K. M., Richards, J. R., Newman, J., Poole, K. G., Scott, S. C., Scheckel, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1273

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1274

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06
1275

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text
1276

Pain knowledge, attitudes and beliefs of Australian osteopaths drawn from a nationally representative sample of the profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Austin, P.
Journal of Bodywork and Movement Therapies, 2020/06
1277

Professional identity in the evolution of osteopathic models: Response to Esteves et al
Alvarez, G., Van Biesen, T., Roura, S.
International Journal of Osteopathic Medicine, 2020/06
1278

Kleine Geburten – und wie wir sie begleiten können
(Miscarriages - and how we can attend to them)
Wikus, P., Ossberger, C.
Osteopathische Medizin, 2020/06
1279

Chiropractic and osteopathic students' perceptions of readiness for transition to practice: The educational value of university clinic vs community and private clinics
Haworth, N. G., Horstmanshof, L., Moore, K. M.
The Journal of Chiropractic Education, 2020/06
Free full text
1280

Skoliose und Osteopathie: Teil 2: Osteopathische Behandlung
(Scoliosis and osteopathy. Part 2: Osteopathic treatment)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/06
1281

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text
1282

Osteopathic medicine: A judicial section for one specific profession
Beaume, S.
Medecine et Droit, 2020/06
1283

Effects of Osteopathic Manipulative Treatment on Musicians: A Systematic Review
Kiepe, M. S., Fernholz, I., Schmidt, T., Brinkhaus, B., Schmidt, A., Weikert, C., Rotter, G.
Medical problems of performing artists, 2020/06
1284

Use of manual therapy applied to the viscera: Secondary analysis of a nationally representative sample of Australian osteopaths
Fleischmann, M., Vaughan, B., Fitzgerald, K., Grace, S.
International Journal of Osteopathic Medicine, 2020/06
1285

Short-term effect of osteopathic manual techniques (OMT) on respiratory function in healthy individuals
Stepnik, J., Kedra, A., Czaprowski, D.
PLoS ONE, 2020/06
Free full text
1286

Влияние остеопатической коррекции на спортивные достижения спортсменов-автогонщиков
(Influence of osteopathic correction on sports achievements of racing athletes)
Azarenkova, A. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1287

The Role of Sphenobasilar Synchondrosis in Disease and Health
Liem, T.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1288

Общее остеопатическое лечение в терапии пациентов с хронической головной болью напряжения
(Global osteopathic treatment in the therapy of patients with chronic tension headache)
Belash, V. O., Bruk, I. I.
Russian Osteopathic Journal, 2020/06
Free full text
1289

Остеопатическая коррекция при лечении боли в нижней части спины
(Osteopathic correction in the treatment of pain in the lower back)
Belash, V. O., Novikov, Y. O.
Russian Osteopathic Journal, 2020/06
Free full text
1290

PROMIS® General Life Satisfaction scale: construct validity in musculoskeletal pain patients
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/06
Free full text
1291

Efficacy of osteopathic manipulative treatment on postural control in Parkinsonian patients with Pisa syndrome: A pilot randomized placebo-controlled trial
Zarucchi, A., Vismara, L., Frazzitta, G., Mauro, A., Priano, L., Maestri, R., Bergna, A., Tarantino, A. G.
NeuroRehabilitation, 2020/06
1292

Влияние остеопатической коррекции на функциональное состояние спортсменов при занятиях восточными единоборствами (кендо)
(Influence of osteopathic correction on the functional state of the athletes′ organism during the training process of martial arts practicing (Kendo))
Fasikov, R. M., Safin, R. F.
Russian Osteopathic Journal, 2020/06
Free full text
1293

A subjective and objective analysis of the immediate effect of osteopathic manual treatment OMT on the golf swing
Maass, Z, Buffington, A, Miner, M, Hall, M
Clinical journal of sport medicine, 2020/06
1294

Practice Locations of Michigan Ophthalmologists as a Model to Compare Practice Patterns of DO and MD Surgical Subspecialists
Ahmed, H., Price, M. J., Robbins, W., Braich, P. S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1295

Influence of Research on Osteopathic Medical Student Residency Match Success
Lowery, J. W., Hum, J. M., Obeime, I., Zahl, S., Parr, C. P., Larsen, B., King, T., Kisby, G.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1296

Возможность применения остеопатической коррекции в комплексной терапии пациентов после стернотомии, выполненной в связи с хирургическим лечением приобретенного порока сердца
(Possibility of osteopathic correction in the complex therapy of patients after sternotomy performed in connection with the surgical treatment of acquired heart defects)
Glushkov, A. A., Salakhov, R. G., Yunusova, A. D., Lebedev, D. A.
Russian Osteopathic Journal, 2020/06
Free full text
1297

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität bei einem Patienten mit einem idiopathischen zentralen Diabetes insipidus
(Potential success of an individualised osteopathic therapy for the quality of life of a patient suffering from an idiopathic central diabetes insipidus)
Zenner, C.
Unpublished MSc thesis, 2020/06
Free full text
1298

Обоснование совместного применения остеопатической коррекции и метода кинезиотейпирования при лечении синдрома плечелопаточного периартроза (плечелопаточной периартропатии)
(The rationale for the joint use of osteopathic correction and kinesiotherapy in the humeroscapular periarthrosis syndrome (humeroscapular periarthropathy) treatment)
Lebedev, E. B., Miroshnichenko, D. B.
Russian Osteopathic Journal, 2020/06
Free full text
1299

Влияние остеопатической коррекции на психоэмоциональное состояние и качество жизни беременных с сопутствующей патологией мочевыводящей системы
(Influence of osteopathic correction on the psychoemotional state and quality of life of pregnant women with concomitant pathology of the urinary system)
Nenashkina, E. N.
Russian Osteopathic Journal, 2020/06
Free full text
1300

Исследование частоты совпадений результатов остеопатической диагностики
(The study of the osteopathic diagnostics results′ coincidence frequency)
Potekhina, Y. P., Milutka, Y. A., Tregubova, E. S., Yanushanets, O. I.
Russian Osteopathic Journal, 2020/06
Free full text
1301

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 2
Bordoni, B.
Cureus, 2020/06
Free full text
1302

Обоснование применения остеопатической коррекции при лечении пациенток с хроническим заболеванием вен нижних конечностей
(Rationale for the use of osteopathic correction in the treatment of patients with chronic lower limb vein disease)
Shmeleva, A. S., Mizonova, I. B.
Russian Osteopathic Journal, 2020/06
Free full text
1303

Моноцентровое проспективное исследование влияния остеопатического лечения на здоровье пациентов, страдающих невралгией полового нерва
(Effects of Osteopathic Care on patients suffering with pudendal neuralgia: a prospective monocentric study)
Tessier, A., Morin, M.P.
Russian Osteopathic Journal, 2020/06
Free full text
1304

Применение остеопатической коррекции совместно с радоновыми ваннами на санаторно-курортном этапе реабилитации пациентов с дорсопатией
(The use of osteopathic correction in conjunction with radon baths at the sanatorium-resort stage of rehabilitation of patients with dorsopathy)
Ul′ikhina, N. V., Shiryayeva, E. E.
Russian Osteopathic Journal, 2020/06
Free full text
1305

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1306

Person-centred care and traditional philosophies in the evolution of osteopathic models and theoretical frameworks: Response to Esteves et al
Steel, A., Foley, H., Redmond, R.
International Journal of Osteopathic Medicine, 2020/06
1307

Manualtherapeutische Behandlung des Zwerchfells bei Asthma bronchiale: Studien geben Hoffnung
(Manual therapy treatment of the diaphragm in bronchial asthma: studies give hope)
Funke, P., Grasmück, J., Merkt, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1308

Beliefs about chronic low back pain amongst osteopaths registered in Spain: A cross-sectional survey
Van Biesen, T., Alvarez, G.
International Journal of Osteopathic Medicine, 2020/06
1309

Behandlung einer stauungsbedingten Trigeminusneuralgie
(Treatment of trigeminal neuralgia as a result of congestion)
Hartmann, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06
1310

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text
1311

Weekly Osteopathic Manipulative Treatment to Improve Measures of Sympathetic Tone in Women With Polycystic Ovary Syndrome: A Randomized, Controlled Pilot Study
Davis, S. E., Hendryx, J., Menezes, C., Bouwer, S., Menezes, H., Patel, V., Bostick Smith, C. A., Speelman, D. L.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1312

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text
1313

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text
1314

Evaluation of the stomatognathic system before and after osteopathic manipulative treatment in 120 healthy people by using surface electromyography
Manzotti, A., Viganoni, C., Lauritano, D., Bernasconi, S., Paparo, A., Risso, R., Nanussi, A.
International Journal of Environmental Research and Public Health, 2020/05
Free full text
1315

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text
1316

Osteopathie auf dem Prüfstand
[Osteopathy under scrutiny]
Dräger, K., Heller, R.
Bundesgesundheitsblatt Gesundheitsforschung Gesundheitsschutz, 2020/05
1317

Doctors Wanted: Women Encouraged to Apply. A Historical Analysis of Women in Osteopathic Medical Education
Karacay, K. C.
Unpublished PhD thesis, 2020/05
1318

Revisión sistemática del tratamiento de la fibromialgia con osteopatía
(Systematic review of the treatment of fibromyalgia with osteopathy)
Giraldo Cardona, S.
Unpublished MSc thesis, 2020/05
Free full text
1319

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05
1320

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05
1321

The Five Diaphragms in Osteopathic Manipulative Medicine: Myofascial Relationships, Part 1
Bordoni, B.
Cureus, 2020/05
Free full text
1322

Visceral Mobilization and Functional Constipation in Stroke Survivors: A Randomized, Controlled, Double-Blind, Clinical Trial
Pasin Neto, H., Borges, R. A.
Cureus, 2020/05
Free full text
1323

Osteopathische Intervention bei Mydriasis nach Contusio bulbi
(Osteopathic Intervention for Mydriasis after Contusio bulbi)
Lehnen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1324

Der Subarachnoidalraum – ein Zwischenraum mit unterschätzter Bedeutung
(The subarachnoid space - an interspace with underestimated importance)
Muntinga, E.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1325

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04
1326

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04
1327

Understanding the professional identity development of undergraduate osteopathic students in the UK
McKenna, B.
Unpublished PhD thesis, 2020/04
Free full text
1328

Effect of Abdominal Lymphatic Pump Treatment on Disease Activity in a Rat Model of Inflammatory Bowel Disease
Schander, A., Castillo, R., Paredes, D., Hodge, L. M.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1329

More Information on Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Fuller, D. B.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1330

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1331

Osteopathic manipulative treatment combined with exercise improves pain and disability in individuals with non-specific chronic neck pain: A pragmatic randomized controlled trial
Groisman, S, Malysz, T, de Souza da Silva, L., Rocha Ribeiro Sanches, T., Camargo Bragante, K., Locatelli, F., Pontel Vigolo, C., Vaccari, S., Homercher Rosa Francisco, C., Monteiro Steigleder, S., Jotz, G. P.
Journal of Bodywork and Movement Therapies, 2020/04
1332

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1333

Severe Postoperative Chronic Constipation Related to Anorectal Malformation Managed with Osteopathic Manipulative Treatment
Vismara, L., Cozzolino, V., Pradotto, L. G., Gentile, R., Tarantino, A. G.
Case Reports in Gastroenterology, 2020/04
Free full text
1334

Osteopathic Manipulative Treatment Relieves Post-concussion Symptoms in a Case of Polytrauma
Baltazar, G. A., Kolwitz, C., Petrone, P., Stright, A., Joseph, D'A.
Cureus, 2020/04
Free full text
1335

Inhibitory Tests as Assessment Tools for Somatic Dysfunctions: Mechanisms and Practical Applications
Bicalho, E., Vieira, L., Makita, D. K., Rivas, L.
Cureus, 2020/04
Free full text
1336

The Effect of High Velocity Low Amplitude Cervical Manipulations on the Musculoskeletal System: Literature Review
Giacalone, A., Febbi, M., Magnifica, F., Ruberti, E.
Cureus, 2020/04
Free full text
1337

Empathy in MedicineCultivating an Empathetic Professional Identity in Osteopathic Medical Students Through Service Learning: A Qualitative Analysis of Reflective Essays
Chrisman-Khawam, L. M., Manzi, J. A.
The Journal of the American Osteopathic Association, 2020/04
Free full text
1338

Überaktive Blase bei Frauen - der Zusatznutzen von Osteopathie zur Standardtherapie Blasentraining
(Overactive Bladder in Women - Benefit of osteopathy in addition to standard bladder-training)
Cecon, S.
Unpublished MSc thesis, 2020/03
Free full text
1339

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1340

Osteopathic Manipulative Medicine in the Era of the Single Accreditation System: Can the Past Guide the Way to the Future of OMM?
Kanze, D.M.
The AAO Journal, 2020/03
Free full text
1341

Educating Leaders 2019: Abstracts From AACOM's Annual Conference
listed, No authors
The Journal of the American Osteopathic Association, 2020/03
Free full text
1342

Transitions: Our Own, Our Patients’, Our Profession’s
Newman, D.B.
The AAO Journal, 2020/03
Free full text
1343

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text
1344

A new perspective for Somatic Dysfunction in Osteopathy: the Variability Model
Bergna, A., Vismara, L., Parravicini, G., Farra, F.
Journal of Bodywork and Movement Therapies, 2020/03
1345

Assessment and Management of Somatic Dysfunctions in Patients With Patellofemoral Pain Syndrome
Tramontano, M., Pagnotta, S., Lunghi, C., Manzo, C., Manzo, F., Consolo, S., Manzo, V.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1346

Effektivität osteopathischer Maßnahmen bei Dysgnathie-Patienten post operationem: Eine Pilotstudie
(Effectiveness of osteopathic measures in postoperative dysgnathia patients: A pilot study)
Rost, H., Makuch, A.
Osteopathische Medizin, 2020/03
1347

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1348

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1349

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1350

Models and theoretical frameworks for osteopathic care – A critical view and call for updates and research
Esteves, J. E., Zegarra-Parodi, R., van Dun, P., Cerritelli, F., Vaucher, P.
International Journal of Osteopathic Medicine, 2020/03
1351

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03
1352

La prise en charge de la douleur testiculaire chronique due a un syndrome de charniere thoraco-lombaire : étude pilote
(Management of chronic testicular pain due to thoracolumbar junction syndrome: A pilot study)
Aoun, F., Malek, E., Kazan, D., Albisinni, S., Peltier, A., Bollens, R., Roumeguère, T.
Progres en urologie : journal de l'Association francaise d'urologie et de la Societe francaise d'urologie, 2020/03
1353

Barriers and facilitators experienced by osteopaths in implementing a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain – A mixed methods systematic review protocol
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Hanses, M., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/03
Free full text
1354

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text
1355

Life satisfaction and musculoskeletal complaints in a population seeking osteopathy care: consecutive sample of 611 patients
Vaughan, B., Mulcahy, J., Allen, T., Coupe, E., Gobbo, D., Nasser, L., Pain, K., Fitzgerald, K.
Chiropractic & Manual Therapies, 2020/03
1356

Can referrals to a pediatric Osteopathic Manipulative Medicine (OMM) clinic be increased through provider education?
Sinha, A., Jimenez, E. Y.
UNMs Digital Repository, 2020/03
1357

An osteopathic approach to Graves’ ophthalmopathy: A case report
McDermott, G., Qureshi, Y., Foster-Moumoutjis, G., Espejo, A.
International Journal of Osteopathic Medicine, 2020/03
Free full text
1358

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03
1359

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text
1360

A duty of candour: Implications for Australian osteopaths
Moore, K.
International Journal of Osteopathic Medicine, 2020/03
1361

Combining psychotherapy with craniosacral therapy for severe traumatized patients: A qualitative study from an outpatient clinic in Norway
Stub, T., Kiil, M., Lie, B., Kristoffersen, A., Weiss, T., Hervik, J., Musial, F.
Complementary Therapies in Medicine, 2020/03
1362

The Intraosseous Dysfunction in the Osteopathic Perspective: Mechanisms Implicating the Bone Tissue
Bicalho, E.
Cureus, 2020/03
Free full text
1363

Psychological context effects of participant expectation on pain pressure thresholds as an adjunct to cervicothoracic HVLA thrust manipulation: A randomised controlled trial
Shackleton, E., Toutt, C., Edwards, D. J.
International Journal of Osteopathic Medicine, 2020/03
1364

A study of the factors impacting on workforce distribution of Australian osteopaths: The perspectives of osteopathic students, academics and clinicians
Steel, A., Dingle, T., Wardle, J., Adams, J.
International Journal of Osteopathic Medicine, 2020/03
1365

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03
1366

‘We need one more hour solely based on anatomy… Give us anatomy!’: Early-year learner perceptions of anatomy within an integrated & case-based learning osteopathy curriculum
Johnston, S. L., Vaughan, B.
International Journal of Osteopathic Medicine, 2020/03
1367

Comparative study of muscle energy technique, craniosacral therapy, and sensorimotor training effects on postural control in patients with nonspecific chronic low back pain
Ghasemi, C., Amiri, A., Sarrafzadeh, J., Dadgoo, M., Jafari, H.
Journal of Family Medicine and Primary Care, 2020/02
Free full text
1368

Osteopathic Manipulative Medical Assistant: A Proposed Allied Profession
Lennon, J. L.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1369

Etude exploratoire de la sante musculo-squelettique du rachis d'etudiants en osteopathie.
[Exploratory study on spinal musculoskeletal health of osteopathy students]
Javerliat, P., Pizon, F., Gerbaud, L.
Revue d'epidemiologie et de sante publique, 2020/02
1370

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1371

Effect of manual approaches with osteopathic modality on brain correlates of interoception: an fMRI study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Perrucci, M. G., Barassi, G., Visciano, C., Bellomo, R. G., Saggini, R., Ferretti, A.
Scientific Reports, 2020/02
Free full text
1372

Osteopathic Medical Care With and Without Osteopathic Manipulative Treatment in Patients With Chronic Low Back Pain: A Pain Registry-Based Study
Licciardone, J. C., Gatchel, R. J.
The Journal of the American Osteopathic Association, 2020/02
Free full text
1373

Eine systematische Übersichtsarbeit über osteopathische manuelle Therapie bei Pneumonie
(Osteopathic Manual Treatment in Pneumonia: A systematic review)
Kafader, J. C.
Unpublished MSc thesis, 2020/02
Free full text
1374

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1375

Die akute Sprunggelenksverletzung in der osteopathischen Praxis
(The acute ankle injury in osteopathic practice)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1376

Attitudes Toward Osteopathic Recognition Under the Single GME Accreditation System: A Survey of Deans at Colleges of Osteopathic Medicine and Chairs of Osteopathic Manipulative Medicine Departments
Dougherty, J. J., Bray, N. N., Vanier, C. H.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1377

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text
1378

U.S. Physician Recommendations to Their Patients About the Use of Complementary Health Approaches
Stussman, B. J., Nahin, R. R., Barnes, P. M., Ward, B. W.
The Journal of Alternative and Complementary Medicine, 2020/01
Free full text
1379

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1380

The architecture and spatial organization of the living human body as revealed by intratissular endoscopy – An osteopathic perspective
Armstrong, C.
Journal of Bodywork and Movement Therapies, 2020/01
Free full text
1381

High-velocity, low-amplitude manipulation (HVLA) does not alter three-dimensional position of sacroiliac joint in healthy men: A quasi-experimental study
de Toledo, D., Kochem, F. B., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2020/01
1382

The labor study: Labor length and birth outcomes osteopathic research
Martingano, D., Mitrofanova, A., Kim, A. F., Ulfers, A., Mersch, M., Stevenson, R., Singh, S.
American Journal of Obstetrics & Gynecology, 2020/01
1383

Preserving osteopathic antiquity through historical pamphlets and postcards
Fitterling, L. A., Oro, R.
Journal of the Medical Library Association, 2020/01
1384

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01
1385

Tratamento manipulativo osteopático em Unidade de Terapia Intensiva Neonatal / Osteopathic manipulative treatment in a neonatal intensive care unit
(Osteopathic manipulative treatment in a neonatal intensive care unit)
dos Santos Varela, A. P. A., Yasojima, E. Y., Gonçalves, H. M. T., Silvestre, L. C., Tannus, L. O.
Brazilian Journals Publicações de Periódicos e Editora Ltda, 2020/01
1386

Introducing national osteopathy practice-based research networks in Australia and New Zealand: an overview to inform future osteopathic research
Steel, A., Peng, W., Sibbritt, D., Adams, J.
Scientific Reports, 2020/01
Free full text
1387

The use of complementary medicine in palliative care in France: an observational cross-sectional study
Filbet, M., Schloss, J., Maret, J.-B., Diezel, H., Palmgren, P. J., Steel, A.
Supportive care in cancer, 2020/01
1388

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text
1389

Isometric osteopathic manipulation influences on cervical ranges of motion and correlation with osteopathic palpatory diagnosis: A randomized trial
Niewiadomski, C., Bianco, R. J., Arnoux, P. J., Evin, M.
Complementary Therapies in Medicine, 2020/01
1390

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1391

Lateral Strain Patterns at the Sphenobasilar Synchondrosis
Burruano, M. P.
The Journal of the American Osteopathic Association, 2020/01
Free full text
1392

Im Gespräch mit … Professor Karl-Ludwig Resch
(In dialog with...Professor Karl-Ludwig Resch)
Engemann, K. Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1393

Forschung und Osteopathie – ein Widerspruch? Ein Versuch der Auflösung am Beispiel des DO-Touch.Net
(Research and Osteopathy - a contradiction? An approach to solution using the example of DO-Touch.Net)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01
1394

Das cerebrospinale venöse System: Anatomie, Physiologie und Pathologie diskutiert im Kontext der Osteopathie
(The cerebrospinal venous system: anatomy, physiology and pathology in the context of osteopathy)
Flenker, J.
Unpublished MSc thesis, 2020/01
Free full text
1395

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020
1396

A Comparative Study of the Heart as a Fulcrum in Relation to the Central Chain and the Ancient Wisdom of the Pervuvian Healers
Friesecke, D.
Unpublished D.O. thesis, 2019/5
Free full text
1397

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1398

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text
1399

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1400

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text
1401

Influence of postoperative adhesions after caesarean section on chronic lower back pain – A pilot study of osteopathic manipulative treatment
Liedler, M., Woisetschläger, G.
European Journal of Osteopathic Research, 2019/12
Free full text
1402

An Osteopathic Approach to Traumatically Induced Mechanical Dyspnea: A Case Report
Kanze, D. M.
The AAO Journal, 2019/12
Free full text
1403

Characteristics, Opportunities, and Challenges of Osteopathy (COCO) in the Perceptions of Osteopaths in Germany, Austria, and Switzerland: Protocol for a Comprehensive Mixed Methods Study
Porthun, J., Manschel, J.
JMIR Research Protocols, 2019/12
Free full text
1404

Applying Osteopathic Manipulative Treatment to Postconcussion Syndrome: A Case Report
Yao, S. C.
The AAO Journal, 2019/12
Free full text
1405

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text
1406

Self-directed learning and practice of Italian osteopathic students during summer break: a cross-sectional survey
D'Alessandro, G., Consorti, G., Cerritelli, F.
BMC Complementary and Alternative Medicine, 2019/12
Free full text
1407

Craniosacral therapy for chronic pain: a systematic review and meta-analysis of randomized controlled trials
Haller, H., Lauche, R., Sundberg, T., Dobos, G., Cramer, H.
BMC Musculoskeletal Disorders, 2019/12
Free full text
1408

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text
1409

Остеопатическая коррекция соматических дисфункций у детей дошкольного возраста с задержкой речевого развития
(Osteopathic correction of somatic dysfunctions in preschool children with delayed speech development)
Abramova, E. V., Aptekar, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1410

Обоснование применения остеопатической коррекции в комплексной реабилитации больных с консолидированными переломами большого бугорка плечевой кости
(Justification of the use of osteopathic correction in the complex rehabilitation of patients with consolidated fractures of the large tubercle of the humerus)
Bogachev, A. A., Kutuzov, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1411

Роль генерализованной мышечной гиперфасилитации в патогенезе и клинической картине миофасциального болевого синдрома. Возможный вариант её коррекции
(The role of generalized muscule hyperfacilitation in pathogenesis and clinical picture of myofascial pain syndrome. Possible option of its correction)
Boldin, A. V., Agasarov, L. G., Tardov, M. V., Bokova, I. A.
Russian Osteopathic Journal, 2019/12
Free full text
1412

Возможности остеопатической коррекции соматических дисфункций у детей с хроническим аденоидитом
(Possibilities of osteopathic correction of somatic dysfunctions in children with chronic adenoiditis)
Chaiko, E. V., Kurbatov, O. I.
Russian Osteopathic Journal, 2019/12
Free full text
1413

Корреляционные связи между некоторыми ритмами организма у пациентов врача-остеопата
(Correlation between certain rhythms of the body in osteopathic patients)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/12
Free full text
1414

Efeitos da manipulação osteopática em trabalhadores feirantes com dor lombar crônica inespecífica: ensaio clínico randomizado
(Effects of osteopathic manipulation in fairground workers with chronic nonspecific low back pain: randomized clinical trial)
Estrázulas, J. A.
Unpublished MSc thesis, 2019/12
Free full text
1415

Побочные эффекты и качество жизни пациентов при химиотерапии: оценка влияния остеопатической коррекции (многоцентровое рандомизированное клиническое исследование)
(Secondary effects and quality of life with chemotherapy: assessing the impact of an osteopathic treatment (multicentric randomized clinical trial)
Favier, N., Guinet, A. G., Nageleisen, M., Ceccaldi, B., Pujade-Lauraine, E., LeFoll, C., Soudain-Pineau, M., Turlin, C., Stubbe, L.
Russian Osteopathic Journal, 2019/12
Free full text
1416

Возможности применения остеопатической коррекции в лечении сочетанной формы бесплодия
(Possibilities of using osteopathic correction in treatment of combined forms of infertility)
Nenashkina, E. N.
Russian Osteopathic Journal, 2019/12
Free full text
1417

Osteopathy In The Cranial Field As A Method To Enhance Injury Recovery: A Preliminary Study
Brolinson, P. G., Hyppolite, N. A., Dickerson, M. R., Murphy, S. F., VandeVord, P. J.
Journal of Osteopathic Medicine, 2019/12
1418

Developing “Migraneous” Rat Models to Evaluate the Efficacy of OMT on Various Migraine Biomarkers
Byrd, K. E., Gregory, C., Krishna, S., Xie, J. Y., Fleming, R. K.
Journal of Osteopathic Medicine, 2019/12
1419

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
Journal of Osteopathic Medicine, 2019/12
1420

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
Journal of Osteopathic Medicine, 2019/12
1421

Эпидемиологические и клинические аспекты хронического пиелонефрита у беременных и остеопатическое сопровождение беременных, страдающих хроническим пиелонефритом
(Epidemiological and clinical aspects of chronic pyelonephritis in pregnant women and osteopathic follow-up of pregnant women with chronic pyelonephritis)
Nenashkina, E. N., Tregubova, E. S., Belash, V. O.
Russian Osteopathic Journal, 2019/12
Free full text
1422

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
Journal of Osteopathic Medicine, 2019/12
1423

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
Journal of Osteopathic Medicine, 2019/12
1424

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2019/12
1425

Головная боль напряжения у пациентов с сопутствующей скелетно-мышечной патологией
(Tension-type headache in patients with concomitant musculoskeletal disorders)
Novikov, Y. O., Salakhov, I. E.
Russian Osteopathic Journal, 2019/12
Free full text
1426

The Effect of OMM on Opioid Users with Chronic Low Back Pain
Patel, K. C., Cooley, D. L., Bailey, J. W., Janora, D. M., Fusco, C.
Journal of Osteopathic Medicine, 2019/12
1427

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
Journal of Osteopathic Medicine, 2019/12
1428

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
Journal of Osteopathic Medicine, 2019/12
1429

Constipation in Parkinson’s Disease Improved by an Osteopathic Manipulative Medicine Sequence in a Repeated Measures Study
Valasareddi, S., Mathai, M., Li, T. S., Yao, S. C., Mancini, J.
Journal of Osteopathic Medicine, 2019/12
1430

Клиническая эффективность остеопатической коррекции в комплексном лечении больных с неоперированной открытоугольной глаукомой
(Clinical efficacy of osteopathic correction in the complex treatment of patients with unoperated open-angle glaucoma)
Simakova, E. N., Stenkova, O. V.
Russian Osteopathic Journal, 2019/12
Free full text
1431

Остеопатическое сопровождение спортсменов в годовом тренировочном процессе
(Osteopathic support of sportsmen during the annual training process)
Yakupov, R. A., Safiullina, G. I., Safiullina, A. A., Burganov, E. R.
Russian Osteopathic Journal, 2019/12
Free full text
1432

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1433

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1434

The Role of Mental Imagery in Osteopathic Palpation: a qualitative study
Kraml, M. M., Besse, J.P.
European Journal of Osteopathic Research, 2019/11
Free full text
1435

Effect of Osteopathic Cranial Manipulative Medicine on an Aged Rat Model of Alzheimer Disease
Tobey, H., Lucas, T., Bledsoe, D., Mykins, M., Campbell, C., Berr, S. S., Sasser, T., Helm, R., Brolinson, P. G., Klein, B. G., Costa, B. M.
The Journal of the American Osteopathic Association, 2019/11
Free full text
1436

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text
1437

Experience with and perception of research among first year osteopathic medical students
Jackson, K., Ogunbekun, O., Zahl, S., Lowery, J.
Poster presentation, 2019/11
1438

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11
1439

Osteopathic manipulative medicine to improve balance and quality of life in parkinson disease
Yao, S., Docherty, J., Mancini, J., Leder, A., DiFrancisco-Donoghue, J.
Movement Disorders, 2019/11
1440

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text
1441

The Benefits and Limitations of Evidence-based Practice in Osteopathy
Bordoni, B.
Cureus, 2019/11
Free full text
1442

Einfluss von Osteopathie auf die gesundheitsbezogene Lebensqualität von Frauen nach Sectio caesarea
(Influence of osteopathy on the health-related quality of life of women after caesarean section)
Rehak, M.
Unpublished MSc thesis, 2019/10
1443

Auswirkung der Osteopathie bei Postcholezystektomiebeschwerden auf Schmerz und gesundheitsbezogener Lebensqualität
(The impact of osteopathy on post-cholecystectomy complaints assessed by the parameters of pain and the health-related quality of life)
Noppinger, M. E.
Unpublished MSc thesis, 2019/10
Free full text
1444

Führt eine viszerale Pumptechnik der Leber an gesunden Probanden zu einer verbesserten Gleitfähigkeit der nervalen Strukturen, überprüft durch den passiven SLR-Test?
(Does a visceral pumping technique of the liver lead to an improved gliding of the neural structures, field-tested by the passive SLR Test on healthy probands?)
Nagenkögl, P.
Unpublished MSc thesis, 2019/10
Free full text
1445

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1446

Die Anwendung osteopathischer Techniken zur Behandlung bei chronisch obstruktiver Lungenerkrankung (COPD)
(The use of osteopathic techniques in the management of the chronic obstructive pulmonary disease (COPD))
Lebersorger, P.
Unpublished MSc thesis, 2019/10
Free full text
1447

Herzratenvariabilitätsanalyse in der Osteopathie und Manualmedizin
(Heart rate variability in manual medicine)
Klumpp, M.
Unpublished MSc thesis, 2019/10
Free full text
1448

Osteopathie zur Behandlung von Schlafstörungen bei Kindern: Eine klinische Studie mit Drei- bis Sechsjährigen
(Osteopathy for the Treatment of Sleep Disturbances of Children: A Clinical Study Among 3-6 Year Olds)
Ellersdorfer, A.
Unpublished MSc thesis, 2019/10
Free full text
1449

Effectiveness of an osteopathic treatment on the autonomic nervous system: a systematic review of the literature
Rechberger, V., Biberschick, M., Porthun, J.
European Journal of Medical Research, 2019/10
Free full text
1450

Einfluss einer osteopathischen Behandlung der vier Diaphragmen des Rumpfes nach Zink auf die Bewegungen des Center of pressure von Personen mit Rückenbeschwerden
(The impact of an osteopathic treatment of the four diaphragms after Zink on the movement of the center of pressure of individuals with back pain)
Arztmann, A.
Unpublished MSc thesis, 2019/10
Free full text
1451

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10
1452

A.T. Still und der Methodismus. Einfluss des Methodismus auf A.T. Stills Entwicklung der osteopathischen Lehre und Praxis im Amerika des 19. Jahrhunderts
(A.T. Still and the Methodism)
Liem, T.
Osteopathische Medizin, 2019/10
1453

Osteopathic manipulation treatment versus therapeutic exercises in patients with chronic nonspecific low back pain: A randomized, controlled and double-blind study
de Oliveira Meirelles, F., de Oliveira Muniz Cunha, J. C., da Silva, E. B.
Journal of Back and Musculoskeletal Rehabilitation, 2019/10
1454

Medical Students' Knowledge About Children With Disabilities, Special Education Laws, and Social Services: A Preliminary Scale Development and Pilot Study
Vitalone-Raccaro, N., Sheppard, M. E., Kaari, J. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1455

Understanding the role of osteopathic manipulative medicine in the management of gastrointestinal disorders and symptoms: a survey study
Shah, R. N., Diehl, D. L., Graham, J., Kim, A. H., Loughlin, M. T.
The American Journal of Gastroenterology, 2019/10
Free full text
1456

Effects of Osteopathic Visceral Treatment in Patients with Gastroesophageal Reflux: A Randomized Controlled Trial
Eguaras, N., Rodriguez-Lopez, E. S., Lopez-Dicastillo, O., Franco-Sierra, M. A., Ricard, F., Oliva-Pascual-Vaca, A.
Journal of Clinical Medicine, 2019/10
1457

Osteopathie bei Spondylitis ankylosans (Morbus Bechterew)
(Osteopathy in ankylosing spondylitis (Bechterew's disease))
Gugganig, K.
Unpublished MSc thesis, 2019/10
Free full text
1458

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text
1459

Postoperative Osteopathic Manipulative Treatment in Bariatric Surgery: A Prospective Randomized, Group Controlled Study
Kim, D. S., Welch, B., Gandhi, M., Shah, D., louis, M.
Surgery for Obesity and Related Diseases, 2019/10
1460

Einfluss der osteopathischen Behandlung im Rahmen der stationären Anschlussheilbehandlung bei Patienten mit Zustand nach Hüft-TEP-Implantation. Randomisierte kontrollierte Studie.
(Influence of osteopathic treatment during post-hospital curative treatment in patients after total hip arthroplasty. A randomized controlled trial)
Behm, B., Mattern, E. R.
Unpublished D.O. thesis, 2019/10
1461

Exploring the lived experience of osteopathy students making the transition from working in student clinic (8 hours per week) to working full-time (40 hours per week) during the summer holiday break
Garelja, D.
Unpublished MSc thesis, 2019/10
Free full text
1462

Wechselbeziehung von Mittelohrpathologien und Mobilität des Os temporale bei Säuglingen mit Lippen-Kiefer-Gaumenspalten - ein Pilotprojekt
(Middle Ear Pathologies and the Mobility of the Temporal Bone in Children with Cleft Lip and Palate - A Pilot Study)
Wedenig, K.
Unpublished MSc thesis, 2019/10
1463

Können osteopathische Behandlungen Einfluss auf die Intensität und Dauer der Schmerzen bei Frauen mit primärer Dysmenorrhoe nehmen? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with primary dysmenorrhea. A randomized controlled trial)
Plathner, M., Wolf, L.
Unpublished D.O. thesis, 2019/10
1464

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1465

Einfluss osteopathischer Behandlung der Fascia thoracolumbalis bei chronisch unspezifischen Rückenschmerzen
(The influence of osteopathic treatment on the thoracolumbar fascia in case of chronic non-specific low back pain)
Putz, F.
Unpublished MSc thesis, 2019/10
Free full text
1466

Does Compression of the Fourth Ventricle Cause Preterm Labor? Analysis of Data From the PROMOTE Study
Hensel, K. L., Roane, B. M.
The Journal of the American Osteopathic Association, 2019/10
Free full text
1467

Rezidivierende Harnwegsinfekte und Reizblase
(Recurrent urinary tract infections and irritable bladder)
Kilian-von Hofe, K.
Osteopathische Medizin, 2019/09
1468

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09
1469

Effektivität einer osteopathischen Therapie auf das autonome Nervensystem: Eine systematische Übersichtsarbeit
(Effectiveness of an osteopathic treatment on the autonomic nervous system A systematic review of the literature)
Rechberger, V.
Unpublished MSc thesis, 2019/09
Free full text
1470

Developing teamwork skills in pre-registration osteopathy education: A qualitative pilot investigation
Vaughan, B., Grace, S., Yoxall, J.
International Journal of Osteopathic Medicine, 2019/09
1471

Das Restless-Legs-Syndrom und die Nierenregion - Können osteopathische Behandlungen die Symptome verbessern?
(The Restless Legs Syndrome and Kidney Region - Can Osteopathic Treatment Influence the Symptoms?)
Lotz, S.
Unpublished MSc thesis, 2019/09
Free full text
1472

Counterstrain as a Diagnostic and Treatment Tool for Rectus Femoris Origin Injuries: A Case Report
Goering, E. K., Qiu, L.
The AAO Journal, 2019/09
Free full text
1473

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text
1474

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text
1475

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text
1476

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09
1477

Osteopathic Approach for Lateral Knee Pain Caused by Iliotibial Band Friction Syndrome: A Case Report
Kostanjevec, J., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1478

Im Gespräch mit … dem Wissenschaftsteam der Wiener Schule für Osteopathie
(In dialog with ... the science team of the Vienna School of Osteopathy)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1479

Student Perceived Value of Reading Assignments During Mandatory Clerkship-Years OMM Course
Lewis, D. D., Pickos, J. J.
The AAO Journal, 2019/09
Free full text
1480

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text
1481

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy in somatoform disorders - Systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
Free full text
1482

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text
1483

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1484

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1485

Welches Gesundheitsmodell hat die Osteopathische Medizin? Teil 2: Eine osteopathische Sichtweise zur Gesundheit und zum Gesundsein
(What health model does osteopathic medicine have? Part 2)
Mayer, J.
Osteopathische Medizin, 2019/09
1486

Effektivität der osteopathischen Behandlung eines Maldescensus testis bei Kindern im Alter von neun Monaten bis sechs Jahren
(Effectiveness of the osteopathic treatment of maldescensus testis in children from 9 months to 6 years of age)
Roch, U.
Unpublished MSc thesis, 2019/09
Free full text
1487

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text
1488

Integrating Osteopathic Evaluation and Treatment in a Case Report of Acute Chest Pain
Yao, S. C.
The AAO Journal, 2019/09
Free full text
1489

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatric, 2019/09
1490

Effects of Osteopathic Manual Therapy on Hyperinflation in Patients with Chronic Obstructive Pulmonary Disease: A Randomized Cross-Over Study
Maskey-Warzechowska, M., Mierzejewski, M., Gorska, K., Golowicz, R., Jesien, L., Krenke, R.
Advances in Experimental Medicine and Biology, 2019/09
1491

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects: A randomized control trial
Abdelfattah, A. S. I.
Annals of Clinical and Analytical Medicine, 2019/09
1492

Temporomandibuläre Dysfunktion (TMD) mit Diskusprolaps
(Temporomandibular dysfunction (TMD) with discus prolapse: Case study on the efficacy of osteopathic treatment)
Vathrakokoilis, K., Liem, T., Aetopoulos, I., Antoniadis, K., Triantafyllidou, E.
Osteopathische Medizin, 2019/09
1493

Enhancing Culturally Sensitive Curriculum in an Osteopathic Medical School
Lopez-Hernandez, G. Y.
Missouri Medicine, 2019/09
Free full text
1494

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text
1495

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text
1496

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text
1497

Expanding options: Supporting skills transfer from a post-graduate osteopathy program to clinical practice
Macfarlane, C., Cornall, D.
International Journal of Osteopathic Medicine, 2019/09
1498

A Literature Review of Osteopathic Manipulative Techniques for Otalgia
Lindsey, T., Lawson, R., Hiffernan, F.
Osteopathic Family Physician, 2019/09
1499

Beschleunigungstrauma der Halswirbelsäule
(Whiplash injury in the cervical spine)
Belz, S., Baum, N.
Osteopathische Medizin, 2019/09
1500

The effects of a 4-week barefoot exercise intervention on plantar pressure, impact, balance and pain in injured recreational runners: A pilot study
Rowlands, C., Plumb, M. S.
International Journal of Osteopathic Medicine, 2019/09
1501

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text
1502

Introduction to Clerkship: Bridging the Gap Between Preclinical and Clinical Medical Education
Butts, C. A., Speer, J. J., Brady, J. J., Stephenson, R. J., Langenau, E., DiTomasso, R., Fresa, K., Becker, M., Sesso, A.
The Journal of the American Osteopathic Association, 2019/09
1503

Is visceral manipulation beneficial for patients with low back pain? A systematic review of the literature
Switters, Jacob Marten, Podar, Stefan, Perraton, Luke, Machotka, Zuzana
International Journal of Osteopathic Medicine, 2019/09
1504

Osteopathie bei somatoformen Störungen – Systematisches Review
(Osteopathy for somatoform disorders - a systematic review)
Diekmann, E. A., Porthun, J., Dietz, F.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09
1505

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1506

Ergojump evaluation of the explosive strength in volleyball athletes pre- and post-fascial treatment
Buscemi, A., Petralia, M. C., Ramaci, T., Rapisarda, A., Provazza, C., Di Corrado, D., Perciavalle, V., Perciavalle, V., Coco, M.
Experimental and Therapeutic Medicine, 2019/08
Free full text
1507

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1508

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1509

Efficacy of osteopathic treatment in patients with stable moderate-to-severe chronic obstructive pulmonary disease: a randomized controlled pilot study
Buscemi, A., Pennisi, V., Rapisarda, A., Pennisi, A., Coco, M.
Journal of Complementary and Integrative Medicine, 2019/08
1510

Muscle energy technique for chronic obstructive pulmonary disease: a systematic review
Baxter, D. A., Shergis, J. L., Fazalbhoy, A., Coyle, M. E.
Chiropractic & Manual Therapies, 2019/08
1511

Empathy in Medicine Osteopathic and Allopathic Physician Interpersonal Manner, Empathy, and Communication Style and Clinical Status of Their Patients: A Pain Registry-Based Study
Licciardone, J. C., Schmitt, M. E., Aryal, S.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1512

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text
1513

Osteopathic Manipulative Therapy in Patients With Chronic Tension-Type Headache: A Pilot Study
Deodato, M., Guolo, F., Monticco, A., Fornari, M., Manganotti, P., Granato, A.
The Journal of the American Osteopathic Association, 2019/08
1514

Stretch Receptor and Somatic Dysfunction: A Narrative Review
Andrews, M. A. W.
The Journal of the American Osteopathic Association, 2019/08
1515

Revisión sistemática de la terapia osteopática en el tratamiento del Síndrome del túnel del carpo
(Efficacy of osteopathic therapy in the management of carpal tunnel syndrome)
Mesa Palacio, A. M.
Unpublished MSc thesis, 2019/08
Free full text
1516

Effectiveness of craniosacral therapy in the treatment of infantile colic. A randomized controlled trial
Castejón-Castejón, M., Murcia-González, M. A., Martínez Gil, J. L., Todri, J., Suárez Rancel, M., Lena, O., Chillón-Martínez, R.
Complementary Therapies in Medicine, 2019/08
1517

Mecanismo mediante el cual la osteopatía libera las emociones
(The Mechanism by which osteopathy releases emotions)
Ospina Guisao, M. C.
Unpublished MSc thesis, 2019/08
Free full text
1518

Effects of Post-Isometric Relaxation on Ankle Plantarflexion and Timed Flutter Kick in Pediatric Competitive Swimmers
Noto-Bell, L., Vogel, B. N., Senn, D. E.
The Journal of the American Osteopathic Association, 2019/08
1519

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1520

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text
1521

Understanding Myalgic Encephalomyelitis/Chronic Fatigue Syndrome and the Emerging Osteopathic Approach: A Narrative Review
Larrimore, C., Ramnot, A., Jaghab, A., Sarduy, S., Guerrero, G., Troccoli, P., Hilton, K., Bested, A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1522

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1523

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1524

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07
1525

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text
1526

An investigation of Australian osteopaths’ attitudes, skills and utilisation of evidence-based practice: a national cross-sectional survey
Leach, M. J., Sundberg, T., Fryer, G., Austin, P., Thomson, O. P., Adams, J.
BMC Health Services Research, 2019/07
Free full text
1527

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text
1528

Differences in Function and Comorbidities Between Older Adult Users and Nonusers of Chiropractic and Osteopathic Manipulation: A Cross-sectional Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2019/07
1529

Влияние остеопатической коррекции на восстановление функций голеностопного сустава при частичном повреждении его связок
(The influence of osteopathic correction on the restoration of the functions of the ankle joint with partial damage of its ligaments)
Alekseev, V. N., Naumenko, E. Y.
Russian Osteopathic Journal, 2019/07
1530

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text
1531

Результаты остеопатической коррекции у пациентов с посттравматической кокцигодинией
(Results of osteopathic correction of patients with post-traumatic coccygodynia)
Antonova, Y. V., Iskandarov, A. M., Mizonova, I. B.
Russian Osteopathic Journal, 2019/07
1532

La lumbalgia: La visión desde la osteopatía y medicina tradicional del Palenque San Basilio
(Low back pain: The vision of osteopathy and traditional medicine of Palenque San Basilio)
Ayala Ardila, D. P.
Unpublished MSc thesis, 2019/07
Free full text
1533

Изменение функциональной активности фибробластов в процессе моделирования компрессии, гиперкапнии и гипоксии
(Сhange in the functional activity of fibroblasts in the process of modelling of compression, hypercapnia and hypoxia)
Aptekar, A. I., Kostolomova, E. G., Sukhovey, Y. G.
Russian Osteopathic Journal, 2019/07
1534

Primary care patients’ use of conventional and complementary medicine for chronic low back pain
Rodondi, P.-Y., Bill, A.-S., Danon, N., Dubois, J., Pasquier, J., Endroit, F. M., Herzig, L., Burnand, B.
Journal of Pain Research, 2019/07
Free full text
1535

Влияние остеопатической коррекции на частоту различных ритмов организма
(The influence of osteopathic correction on the rate of various rhythms of the body)
Chernikova, A. E., Potekhina, Y. P.
Russian Osteopathic Journal, 2019/07
1536

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07
1537

Verbesserte Neudefinition des Fasziensystems.
Improving the New Definition of Fascial System
Bordoni, B.
Complementary Medicine Research, 2019/07
1538

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07
1539

Эффективность дополнительных методов лечения постинсультной периартропатии плечевого сустава
(The effectiveness of additional treatment methods for post-stroke periarthropathy of the shoulder joint)
Kozlova, N. S., Amelin, A. V.
Russian Osteopathic Journal, 2019/07
1540

Возможности остеопатической коррекции в комплексной терапии дисфункции височно-нижнечелюстного сустава
(Possibilities of osteopathic correction in complex therapy of temporomandibular joint dysfunction)
Milutka, Y. A., Yushmanov, I. G., Badmaeva, A. N.
Russian Osteopathic Journal, 2019/07
1541

Рандоминизированное контролируемое исследование эффективности остеопатической манипуляционной коррекции при мышечной кривошее вследствие родовой травмы
(Randomized controlled study of the effectiveness of osteopathic manipulative correction for muscular torticollis due to birth injury)
Novikov, Y. O., Mokhov, D. E., Amigues, J.P., Musina, G. M., Shaiakhmetov, A. R.
Russian Osteopathic Journal, 2019/07
1542

Изменение электрической активности кожи во время остеопатического воздействия с применением биодинамического подхода
(Change of skin electrical activity during osteopathic correction with the use of biodynamical approach)
Novikov, Y. O., Shaiakhmetov, A. R., Musina, G. M.
Russian Osteopathic Journal, 2019/07
1543

Остеопатическая коррекция в комплексном лечении синдрома карпального канала при закрытых осложненных переломах предплечья
(Osteopathic correction in complex treatment of carpal tunnel syndrome with complicated closed forearm fractures)
Sebaykin, Y. V., Mokhov, D. E., Tarusova, K. S., Nechoroshev, S. N.
Russian Osteopathic Journal, 2019/07
1544

Влияние остеопатической коррекции на вязкоупругие характеристики мышц голени
(The influence of osteopathic correction on the viscoelastic characteristics of the lower leg muscles)
Timanin, E. M., Sydneva, N. S., Zakharova, A. A.
Russian Osteopathic Journal, 2019/07
1545

Effect of Osteopathic Obstetrical Management on the Duration of Labor in the Inpatient Setting: A Prospective Study and Literature Review
Martingano, D., Ho, S., Rogoff, S., Chang, G., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1546

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1547

The Combined Shoulder Technique: A Novel Approach in the Treatment of Scapular Dysfunction—A Case Report
Kanze, D. M.
The AAO Journal, 2019/06
Free full text
1548

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06
1549

Osteopathische Behandlung bei Pertussis im 19. und 20. Jahrhundert
Osteopathic treatment of pertussis in the 19th and 20th centuries: A structured historical literature review
Liem, T.
Osteopathische Medizin, 2019/06
1550

Restoring Full Squat Range of Motion by Applying OMT to Superior Innominate Shear: A Case Report
Lewis, D. D., Pickos, J.
The AAO Journal, 2019/06
Free full text
1551

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06
1552

Welches Gesundheitsmodell hat die Osteopathische Medizin?
(What health model does osteopathic medicine have? Part 1: The topic of disease in the biomedical model of standard care)
Mayer, J.
Osteopathische Medizin, 2019/06
1553

Osteopathische Medizin: Versuch einer zeitgemäßen Definition
(Osteopathic medicine: Attempt at a contemporary definition)
Mayer, J., Pelz, H., Riedel, M.
Osteopathische Medizin, 2019/06
1554

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06
1555

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06
1556

A Study to Investigate the Effect of ‘Frontal Lift’ Osteopathic Manipulative Technique (OMT) in Patients with Chronic Sinusitis
Lintonbon, David
American Journal of Biomedical Science & Research, 2019/06
1557

Do empathic osteopaths achieve better clinical results? An observational feasibility study
Acquati, A., Uberti, S., Aquino, A., Cerasetti, E., Castagna, C., Rovere-Querini, P., Pisa, V.
International Journal of Osteopathic Medicine, 2019/06
1558

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1559

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06
1560

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood and Cancer, 2019/06
1561

¿La Manipulación Osteopática Mejora la Función Mecánica y Física y la Simetría Espinal en Golfistas?
(Does Osteopathic Manipulation Lead to Improvements in Physical and Muscle Mechanical Function and Spinal Symmetries in Golfers?)
Rojas-Valverde, D., Sánchez García, A., Sáez Ulloa, D., Gutiérrez-Vargas, R.
Kronos, 2019/06
Free full text
1562

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06
1563

Étude randomisée monocentrique évaluant l’efficacité de l’ostéopathie dans la prise en charge des douleurs chroniques après chirurgie mammaire en oncologie
(Osteopathy for chronic pain after breast cancer surgery: a monocentric randomised study)
Chvetzoff, G., Berthier, A., Blanc, E., Bourne Branchu, V., Millaret, A., Cropet, C., Pérol, D.
Bulletin du Cancer, 2019/06
1564

Patient experience, satisfaction, perception and expectation of osteopathic manipulative treatment: A systematic review
Lam, M. T., Banihashem, M., Lam, H. R., Wan, A. B., Chow, E.
International Journal of Osteopathic Medicine, 2019/06
1565

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06
1566

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1567

The New Zealand Osteopathic Profession’s Understanding of Continuing Professional Development
Fairs, E. J.
Unpublished MSc thesis, 2019/06
Free full text
1568

A systematic review of non-invasive manual therapies in the management of irritable bowel syndrome
Badenhorst, N.
Unpublished MSc thesis, 2019/06
1569

Learning and teaching of patient-centred communication skills in allied healthcare manual therapy students: A systematic review
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2019/06
1570

OSLO – Effets d’un traitement ostéopathique manuel sur la lombalgie non spécifique aiguë dans un service d’accueil des urgences : un protocole d’essai randomisé contrôlé monocentrique
(OSLO – Effects of osteopathic manipulative therapy for acute nonspecific low back pain in emergency room: design of a randomised monocentric controlled trial)
Ginier-Gillet, M.
Unpublished MSc thesis, 2019/06
1571

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06
1572

Osteopathic Approach to the Treatment of a Patient With an Atypical Presentation of Coccydynia
Alexandre, K., Channell, M. K.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1573

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text
1574

A Case of Venous Thoracic Outlet Syndrome: Primary Care Review of Physical Exam Provocative Tests and Osteopathic Manipulative Technique Considerations
Yuschak, E., Haq, F., Chase, S.
Cureus, 2019/06
Free full text
1575

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1576

Einfluss von Osteopathie auf die Symptomatik, Häufigkeit und die Medikamenteneinnahme von PatientInnen mit episodisch-häufigem Spannungskopfschmerz
(Impact of Osteopathic Treatment on Frequent Tension-type Headache)
Huemer, D.
Unpublished MSc thesis, 2019/05
Free full text
1577

Unterschiede in der viszeralen Dysfunktion bei Frauen mit Nullipara in Abhängigkeit vom Trendelenburg-Zeichen
(Differences in the visceral dysfunction in nullipara women as a function of the Trendelenburg sign)
Brösenhuber, S.
Unpublished MSc thesis, 2019/05
Free full text
1578

Der Einfluss einer viszeralen osteopathischen Behandlung auf das Bewegungsausmaß des straight leg raising tests am rechten und linken Bein beim akuten lateralen Bandscheibenvorfall
(The influence of visceral osteopathic treatment on the level of movement of the „straight leg raising tests“ on the left and right leg in case of an acute lateral herniated disc)
Akkoc, Ö.
Unpublished MSc thesis, 2019/05
Free full text
1579

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text
1580

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text
1581

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05
1582

Cynefin Framework for Evidence-Informed Clinical Reasoning and Decision-Making
Lunghi, C., Baroni, F.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1583

Desenvolvimento de técnicas manipulativas osteopáticas para tratamento da síndrome do impacto do ombro baseado na biomecânica
(Development of osteopathic manipulative technique for impingement syndrome of shoulder treatment based on the biomechanics)
Louro, S. M.
Unpublished MSc thesis, 2019/05
Free full text
1584

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05
1585

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
1586

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text
1587

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05
1588

Systematische Übersichtsarbeit über die physiologischen Vorgänge bei verschiedenen Abwehrreaktionen mit Schwerpunkt auf das viszerale System
(Systematic review of the physiological responses to various defense reactions with a focuson the visceral system.)
Wyvekens, J.
unpublished D.O. thesis, 2019/05
Free full text
1589

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text
1590

Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative pilot study of osteopathy and electrostimulation /biofeedback for pelvic floor
Bogner, D.
European Journal of Osteopathic Research, 2019/04
Free full text
1591

Role of Debt and Loan Forgiveness/Repayment Programs in Osteopathic Medical Graduates' Plans to Enter Primary Care
Scheckel, C. J., Richards, J., Newman, J. R., Kunz, M., Fangman, B., Mi, L., Poole, K. G.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1592

Manual therapy for musculoskeletal pain in cystic fibrosis: Review of the literature
Graziano, L., Giordani, B., Nico, D., Colella, E., Savi, D., Cimino, G., Di Vito, A., Valente, D., Palange, P.
Italian Journal of Pediatrics, 2019/04
1593

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1594

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1595

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text
1596

Osteopathic Manipulative Treatment in a Paediatric Patient with Oesophageal Atresia and Tracheo-Oesophageal Fistula
Barni, A., Zecchillo, D., Uberti, S., Ratti, S.
Gastroenterology, 2019/04
1597

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text
1598

Analyse comparative entre la thérapie manuelle orthopédique et l'ostéopathie une mise au point sur la situation en Belgique
(Comparative analysis between orthopaedic manual therapy and osteopathy: Focus on the Belgian situation)
Hidalgo, B., Demoulin, C.
Revue Medicale de Liege, 2019/04
Free full text
1599

Manipulasjonsteknikker ved nakkeasymmetri hos spedbarn
(Manipulation techniques for infant torticollis)
Brurberg, K. G., Dahm, K. T., Kirkehei, I.
Tidsskrift for den Norske Laegeforening, 2019/04
Free full text
1600

Allopathic supervision of osteopathic education: What support is needed?
James, S. J., Zakletskaia, L:
Osteopathic Family Physician, 2019/04
1601

Empathy, Religious Affiliation, and the Growth of Osteopathic Medicine
Cunningham, B.
Unpublished PhD thesis, 2019/04
Free full text
1602

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04
1603

Prevalence and profile of Australian osteopaths treating older people
Steel, A., Vaughan, B., Orrock, P., Peng, W., Fleischmann, M., Grace, S., Engel, R. M., Sibbritt, D., Adams, J.
Complementary Therapies in Medicine, 2019/04
1604

Timing of oral feeding changes in premature infants who underwent osteopathic manipulative treatment
Vismara, L., Manzotti, A., Tarantino, A. G., Bianchi, G., Nonis, A., La Rocca, S., Lombardi, E., Lista, G., Agosti, M.
Complementary Therapies in Medicine, 2019/04
1605

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1606

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04
1607

Von der Biomechanik zur Bioinformatik
(From Biomechanic to Bioinformatics)
Eckardt, P.
Osteopathische Medizin, 2019/04
1608

Osteopathic Manipulative Treatment as a Novel Way to Manage Postvasectomy Pain Syndrome
Gray, R. E., Kasper, K.
The Journal of the American Osteopathic Association, 2019/04
Free full text
1609

Evaluation of teaching in a student-led clinic environment: Assessing the reliability of a questionnaire
Vaughan, B.
International Journal of Osteopathic Medicine, 2019/03
1610

Patient satisfaction and perception of treatment in a student-led osteopathy teaching clinic: Evaluating questionnaire dimensionality and internal structure, and outcomes
Vaughan, B., Burns, C., Burridge, L., Wigger, J., Blair, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2019/03
1611

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text
1612

Ernährungswissen von Osteopathinnen und Osteopathen
(Knowledge of Nutrition Issues among Osteopaths)
Putschögl, J.
Unpublished MSc thesis, 2019/03
Free full text
1613

Die Rolle der mentalen Vorstellung in der Palpation von Osteopathen
(The role of mental imagery in osteopathic palpation)
Kraml, M.
Unpublished MSc thesis, 2019/03
Free full text
1614

Rescued Root Canal: A Case Report on OMT for Jaw Pain Following Repeat Root Canal Procedure
Fong, K. F., Rummel, T. B.
The AAO Journal, 2019/03
Free full text
1615

Effektivität von Osteopathie bei Patientinnen mit lumbalen Rückenschmerzen und/oder Beckengürtelschmerzen in der Schwangerschaft und Post Partum - systematic review
(The effectiveness of osteopathy for low back pain and pelvic girdle pain during and after pregnancy - a systematic review)
König, M.
Unpublished MSc thesis, 2019/03
Free full text
1616

Der Effekt von osteopathischen Behandlungen auf das Tagesprofil des Speichelcortisols
(The effect of osteopathic treatments on the diurnal profile of salivary cortisol)
Hämmerli, U.
Unpublished MSc thesis, 2019/03
Free full text
1617

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text
1618

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1619

Osteopathie bei Bone Bruise
(Osteopathy for bone bruise)
Bick, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1620

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1621

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03
1622

Die Kinderosteopathie aus Sicht der Kinderärzte. Eine qualitative Interview-Studie
(Pediatric osteopathy: What registered pediatricians think about it - A qualitative interview study)
Seidner, K., Belz, S.
Osteopathische Medizin, 2019/03
1623

Manual therapy for the pediatric population: a systematic review
Parnell Prevost, C., Gleberzon, B., Carleo, B., Anderson, K., Cark, M., Pohlman, K. A.
BMC Complementary and Alternative Medicine, 2019/03
Free full text
1624

Benefits and harms of spinal manipulative therapy for the treatment of chronic low back pain: systematic review and meta-analysis of randomised controlled trials
Rubinstein, S. M., de Zoete, A., van Middelkoop, M., Assendelft, W. J. J., de Boer, M. R., van Tulder, M. W.
The BMJ, 2019/03
Free full text
1625

Klinische und osteopathische Bedeutung der beidseitigen Blutdruckmessung. Nützlich bei “Thoracic outlet Syndrome“?
(Clinical and osteopathic significance of bilateral blood pressure measurement. Useful with “Thoracic outlet syndrome“?)
Stattin, E.
Unpublished MSc thesis, 2019/03
Free full text
1626

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text
1627

Dancers’ experience of osteopathy and their attitudes towards dance injuries
Maddren, K.
Unpublished MSc thesis, 2019/03
Free full text
1628

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text
1629

Does somatic dysfunction lead to lower extremity injuries in the high school soccer player?
Wisinski, J., Lipp, T., Dougherty, J. J.
Clinical Journal of Sport Medicine, 2019/03
1630

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03
1631

Short-term effectiveness of the flexion-distraction technique in comparison with high-velocity vertebral manipulation in patients suffering from low-back pain
Carrasco-Martínez, F., Ibáñez-Vera, A. J., Martínez-Amat, A., Hita-Contreras, F., Lomas-Vega, R.
Complementary Therapies in Medicine, 2019/03
1632

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03
1633

Effects of Practicing Osteopathic Manipulative Treatment (OMT) on Hand Function
Barnum, I. F. O., Chang, M. E., Patterson, R. M., Surve, S.
UNTHSC Scholarly Repository, 2019/03
1634

Reliabilitätsstudie des Befunds nach dem Mechanical Link
(Reliability study of the findings according to the mechanical link: Methodological study on the assessment of findings of the bones and joints of the extremities by the mechanical link method)
Hafen, G. I.
Osteopathische Medizin, 2019/03
1635

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1636

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1637

Osteopathic Manipulative Treatment: A Primary Care Approach
Bodine, W. A.
American Family Physician, 2019/02
1638

Assessment of the Efficacy of An Osteopathic Treatment in Infants with Biomechanical Impairments to Suckling
Herzhaft-LeRoy, J., Xhignesse, M., Gaboury, I.
Journal of Visualized Experiments, 2019/02
1639

Osteopathic Manipulative Treatment for Pertussis in the 19th and 20th Centuries: A Structured Historical Literature Review
Liem, T.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1640

To what extent do New Zealand osteopathic students meet the national requirements for clinical record keeping: an audit
Dyer, B. D.
Unpublished MSc thesis, 2019/02
Free full text
1641

Evaluating Patient's Understanding of Pain Neurophysiology: Rasch Analysis of the Neurophysiology of Pain Questionnaire
Vaughan, B., Mulcahy, J., Fitzgerald, K., Austin, P.
The Clinical Journal of Pain, 2019/02
1642

Making sense of cranial osteopathy : an interpretative phenomenological analysis.
Banton, A
Unpublished PhD thesis, 2019/02
1643

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text
1644

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1645

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1646

Exploration of the characteristics of German osteopaths and osteopathic physicians: survey development and implementation
Dornieden, R.
Unpublished PhD thesis, 2019/01
Free full text
1647

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1648

Zentralbahnhof Thorax
(Central station: thorax)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1649

Osteopathische Behandlung bei akut traumatischen Zuständen: die Kraft der Flüssigkeiten
(Osteopathic treatment for acute traumatic conditions: the power of fluids)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01
1650

Nonpharmacologic Management of Symptoms in Females With Polycystic Ovary Syndrome: A Narrative Review
Speelman, D. L.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1651

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1652

The Italian Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross sectional survey
Cerritelli, F., van Dun, P. L. S., Esteves, J. E., Consorti, G., Sciomachen, P., Lacorte, E., Vanacore, N.
PLoS One, 2019/01
Free full text
1653

Ultrasound Evaluation of Diaphragmatic Mobility and Contractility After Osteopathic Manipulative Techniques in Healthy Volunteers: A Prospective, Randomized, Double-Blinded Clinical Trial
Mancini, D., Cesari, M., Lunghi, C., Benigni, A. M., Antonelli Incalzi, R., Scarlata, S.
Journal of Manipulative and Physiological Therapeutics, 2019/01
1654

Women’s experiences of osteopathic care whilst living with endometriosis
Waugh, M. D.
Unpublished MSc thesis, 2019/01
Free full text
1655

Investigating interpretation of ACC claims in an osteopathy teaching clinic
Urgert, C.
Unpublished MSc thesis, 2019/01
Free full text
1656

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01
1657

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text
1658

Osteopathic Physical Exam Findings in Chronic Hepatitis C: A Case Study
Chin, J., Francis, M., Lavalliere, J. M., Lomiguen, C. M.
Cureus, 2019/01
Free full text
1659

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text
1660

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text
1661

Die Zukunft der Osteopathie liegt in der Aktivität
(The future of osteopathy belongs to activity)
Levin, P.
Osteopathische Medizin, 2018/12
1662

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12
1663

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text
1664

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12
1665

Challenges and opportunities for Australian osteopathy: A qualitative study of the perceptions of registered osteopaths
Blaich, R., Steel, A., Clark, D., Adams, J.
International Journal of Osteopathic Medicine, 2018/12
1666

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1667

An overview of osteopathy graduates' perceived preparedness at transition from educational environment to clinic environment one year after graduation: a cross sectional study
Luciani, E., Consorti, G., van Dun, P. L. S., Merdy, O., Lunghi, C., Petracca, M., Esteves, J. E., Cerritelli, F.
BMC Medical Education, 2018/12
Free full text
1668

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text
1669

Effect of the soft-tissue techniques in the quality of life in patients with Crohn's disease: A randomized controlled trial
Espi-Lopez, G. V., Ingles, M., Soliva-Cazaban, I., Serra-Ano, P.
Medicine (Baltimore), 2018/12
Free full text
1670

Medical Humanities Teaching in North American Allopathic and Osteopathic Medical Schools
Klugman, C. M.
Journal of Medical Humanities, 2018/12
1671

The beliefs and attitudes of UK registered osteopaths towards chronic pain and the management of chronic pain sufferers - A cross-sectional questionnaire based survey
Macdonald, R. J. D., Vaucher, P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/12
Free full text
1672

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text
1673

Immediate effect of T2, T5, T11 thoracic spine manipulation of asymptomatic patient on autonomic nervous system response: Single-blind, parallel-arm controlled-group experiment
Minarini, G., Ford, M., Esteves, J.
International Journal of Osteopathic Medicine, 2018/12
1674

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text
1675

Osteopaticheskaia korrektsiia v kompleksnoi terapii i reabilitatsii patsientov s sindromom pozvonochnoi arterii.
[The use of the osteopathic correction for the combined treatment and rehabilitation of the patients presenting with the vertebral artery syndrome]
Belash, V. O., Mokhov, D. E., Tregubova, E. S.
Voprosy Kurortologii, Fizioterapii, i Lechebnoi Fizicheskoi Kultury, 2018/12
1676

Die Identität der Osteopathie in Deutschland – Spurensuche nach einem beruflichen Selbstverständnis
(The identity of osteopathy in Germany - Search for traces of a professional self-conception)
Ehmke, B.
Osteopathische Medizin, 2018/12
1677

Die Osteopathie nimmt noch nicht den ihr gebührenden Platz in der Welt der Medizin ein
(Osteopathy is not yet taking its appropriate place in the world of medicine. Interview with Renzo Molinari)
Engel-Schulmeyer, A.
Osteopathische Medizin, 2018/12
1678

First-year osteopathic students' use and perceptions of complementary video-based learning
Tripodi, N.
International Journal of Osteopathic Medicine, 2018/12
1679

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1680

Effect of Osteopathic Visceral Manipulation on Pain, Cervical Range of Motion, and Upper Trapezius Muscle Activity in Patients with Chronic Nonspecific Neck Pain and Functional Dyspepsia: A Randomized, Double-Blind, Placebo-Controlled Pilot Study
Silva, A. C. O., Biasotto-Gonzalez, D. A., Oliveira, F. H. M., Andrade, A. O., Gomes, Cafp, Lanza, F. C., Amorim, C. F., Politti, F.
Evidence-based Complementary and Alternative Medicine, 2018/11
Free full text
1681

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1682

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text
1683

Osteopathic care for spinal complaints: A systematic literature review
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
PLoS One, 2018/11
Free full text
1684

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text
1685

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
Journal of Osteopathic Medicine, 2018/11
1686

The Effect of Osteopathic Manipulative Medicine on Oxidative Stress Following Mild Traumatic Brain Injury: A Pilot Study
Angelo, N., Mazzeo, S., Oommen, T., Zwibel, H., Mancini, J., Leheste, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1687

Osteopathy and patients who have experienced sexual violence: management, treatment and self-care
Michael-Anna, E.
Unpublished MSc thesis, 2018/11
Free full text
1688

The Émigré Physicians’ Experiences Before, While, and After Attending an American Osteopathic Medical School: A Cross-Sectional, Mixed Methods Study, Convergent Design
Burg, B. J., Goldstein, L., Sheflin, K., Jeger, A.
Journal of Osteopathic Medicine, 2018/11
1689

Clinically Based OMM Competency Standards for Physicians in Residencies Designated With Osteopathic Recognition in the Single Accreditation System for GME
Cooper Rau Jr., D., Merritt, M.
Journal of Osteopathic Medicine, 2018/11
1690

The Effect of Osteopathic Manipulative Treatment on Reactive Oxygen Species in Parkinson Disease
Docherty, J., Chu, K., Orshan, D., Kulason, K., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1691

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
Journal of Osteopathic Medicine, 2018/11
1692

Regulatory and practice issues related to the acquisition of practical osteopathic skills for paediatric care
Evans, B.
Unpublished MSc thesis, 2018/11
Free full text
1693

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1694

Using Team-Based Learning in Osteopathic Medical Education to Improve Understanding and Communication Regarding Chronic Diseases
Harp, E., Rutledge, A.
Journal of Osteopathic Medicine, 2018/11
1695

Effects of Cranial Osteopathic Manipulative Medicine on Children With Plagiocephaly: Case Studies and Proposed Clinical Trial
King, H. H., Mai, J., Morelli, M. A., Centers, S., Sweeney, M.
Journal of Osteopathic Medicine, 2018/11
1696

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1697

Patient Perceptions of Osteopathic and Allopathic Physician Communication Style and Empathy and Reported Satisfaction with Low Back Care
Licciardone, J. C., Schmitt, M. E.
Journal of Osteopathic Medicine, 2018/11
1698

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
Journal of Osteopathic Medicine, 2018/11
1699

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1700

Using Wearable Technology to Measure the Effectiveness of Osteopathic Manipulative Treatment on Parkinson Disease Motor Symptoms
Poon, J., Docherty, J., Mancini, J., DiFrancisco-Donoghue, J., Cheriyan, G., Leder, A., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11
1701

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
Journal of Osteopathic Medicine, 2018/11
1702

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
Journal of Osteopathic Medicine, 2018/11
1703

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
Journal of Osteopathic Medicine, 2018/11
1704

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1705

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1706

Eficácia da manipulação visceral osteopática em pacientes com constipação funcional e dor lombar crônica inespecífica: ensaio clínico placebo-controlado aleatorizado
(Effectiveness of osteopathic visceral manipulation in patients with functional constipation and non-specific chronic low back pain: randomized placebo-controlled clinical trial)
Fernandes, W. V. B.
Unpublished PhD thesis, 2018/10
Free full text
1707

Professional trust in osteopathy: a theory for educational practice
Mackay Tumber, L.
Unpublished Dissertation, 2018/10
Free full text
1708

Kann die Schwangerschaftsrate nach technisch assistierter Reproduktion durch osteopathische Behandlungen erhöht werden?
(Can the pregnancy rate after assisted reproductive technology be increased through osteopathic treatments?)
Samouh, S.
Unpublished MSc thesis, 2018/10
Free full text
1709

An Osteopathic Approach to Diagnosis and Management of Sacroiliac Joint Dysfunction
Glover, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1710

Outpatient satisfaction with osteopathic manipulative treatment in a hospital center: A survey
Tramontano, M., Cinnera, A. M., Petracca, M., Gaeta, A., Tamburella, F., Audouard, M., Caltagirone, C.
Alternative Therapies in Health and Medicine, 2018/10
1711

Visceral manipulation to treat functional constipation in stroke survivors: A randomized, controlled, double-blind, clinical trial
Neto, H. P., Borges, R. A., Bicalho, E. S., Oliveira, C. S.
Journal of Bodywork and Movement Therapies, 2018/10
1712

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1713

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10
1714

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text
1715

Die osteopathische Behandlung aus PatientInnensicht – Interviews mit PatientInnen über ihre subjektive Befindlichkeit während osteopathischen Behandlungen
(The osteopathic treatment from the patient's point of view - Interviews with patients about their subjective well-being during osteopathic treatments)
Hocher, J.
Unpublished MSc thesis, 2018/10
Free full text
1716

Die Rolle der Eltern in der osteopathischen Säuglingsbehandlung innerhalb der ersten drei Lebensmonate aus Sicht von Eltern und OsteopathInnen
(The Role of the Parents in Osteopathic Care of Infants within the First Three Months of Life from the Parents’ and Practitioners’ Perspectives)
Bechinie, C.
Unpublished MSc thesis, 2018/10
Free full text
1717

Health literacy across all year levels of a cohort of Australian osteopathy students
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10
1718

Partners in Health (PIH) scale responses of musculoskeletal patients in a student clinic
Mulcahy, J., Vaughan, B.
Quality of Life Research, 2018/10
1719

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text
1720

(Effectiveness of osteopathic treatment in patients with chronic knee pain. A randomized controlled trial)
Weitendorff, A.
Unpublished D.O. thesis, 2018/10
1721

Osteopathic Evaluation of Urinary Retention Caused by Atypical Presentation of Invasive Cervical Cancer Mimicking Primary Urothelial Tumor
Martingano, D., Ramirez, L. C., Bjurlin, M. A.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1722

Meralgia paresthetica: A 5 model osteopathic approach
Torrents, M., Malik, R.
Osteopathic Family Physician, 2018/10
Free full text
1723

Osteopathic care for low back pain and neck pain: A cost-utility analysis
Verhaeghe, N., Schepers, J., van Dun, P., Annemans, L.
Complementary Therapies in Medicine, 2018/10
1724

Möglicher Erfolg einer individualisierten osteopathischen Behandlung für die Lebensqualität und das Angstbefinden bei einer Patientin mit einer chronischen Lungensarkoidose.
(Possible success of an individualized osteopathic treatment regarding the quality of life and the state of anxiety of a patient with a chronic lung sarcoidosis)
Origer, S.
Unpublished MSc thesis, 2018/10
Free full text
1725

Validity of the Rule of Threes and Anatomical Relationships in the Thoracic Spine
Oakley, C. K., Janssen, S. A. K., Pankratz, J. P., McCumber, T. L., Treffer, K. D., Olinger, A. B.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1726

Messung des Effekts einer Midline-Behandlung. Eine randomisierte kontrollierte Studie mit gesunden Erwachsenen.
(Measuring the effect of a midline treatment: randomized controlled trial in healthy adults)
Galoppi, M.
Unpublished MSc thesis, 2018/10
Free full text
1727

A Short Review of the Treatment of Headaches Using Osteopathic Manipulative Treatment
Whalen, J., Yao, S., Leder, A.
Current Pain and Headache Reports, 2018/10
1728

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text
1729

An Osteopathic Approach to Rib Somatic Dysfunction in Respiratory Disorders
Pierce-Talsma, S., Talsma, J., Ferrill, H.
The Journal of the American Osteopathic Association, 2018/10
Free full text
1730

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1731

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1732

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
1733

It depends on how things are to you
Vogel, S.
International Journal of Osteopathic Medicine, 2018/09
Free full text
1734

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
1735

Von A.T. Stills Theorie der osteopathischen Läsion zur somatischen Dysfunktion
(From A.T. Still's theory of the osteopathic lesion based on somatic dysfunction: Historical development and evidence-based models that support the current concept of somatic dysfunction)
Liem, T.
Osteopathische Medizin, 2018/09
1736

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09
1737

Behandlung einer Patientin mit Schulter-Arm-Syndrom nach proximaler Radiusfraktur infolge eines Sturzes
(Treatment of a patient with shoulder-arm syndrome after proximal radius fracture as a result of a fall: Commented case study on the article “Resonance and dialogue: On the methodology of a neuroregulative treatment model“)
Metcalfe-Wiegand, D.
Osteopathische Medizin, 2018/09
1738

The Immediate Effect of Therapeutic Touch and Deep Touch Pressure on Range of Motion, Interoceptive Accuracy and Heart Rate Variability: A Randomized Controlled Trial With Moderation Analysis
Edwards, D. J., Young, H., Johnston, R.
Frontiers in Integrative Neuroscience, 2018/09
Free full text
1739

Investigating practitioners' perceptions of the role of spirituality in osteopathic practice using Interpretative Phenomenological Analysis
Bacon, S. W., Roe, C. A.
International Journal of Osteopathic Medicine, 2018/09
1740

In welchem Ausmaß kann die Osteopathie bei Kindern mit Zerebralparese die Bewegung mit funktionellen Konsequenzen und die Lebensqualität positiv beeinflussen
(To what extend can osteopathy have a positive influence on movement with functional consequences and quality of life by children with cerebral palsy)
Schneider, D.
Unpublished MSc thesis, 2018/09
1741

Osteopathic Manipulative Treatment Including Specific Diaphragm Techniques Improves Pain and Disability in Chronic Nonspecific Low Back Pain: A Randomized Trial
Marti-Salvador, M., Hidalgo-Moreno, L., Domenech-Fernandez, J., Lison, J. F., Arguisuelas, M. D.
Archives of Physical Medicine and Rehabilitation, 2018/09
1742

Learning through multiple lenses: analysis of self, peer, near-peer and faculty assessment of a clinical history taking task in Australia
Fitzgerald, K., Vaughan, B.
Journal of Educational Evaluation for Health Professions, 2018/09
Free full text
1743

Primary care physicians' attitude and reported prescribing behavior for chronic low back pain: An exploratory cross-sectional study
Rodondi, P. Y., Dubois, J., Bill, A. S., Koutaissoff, D., Ros, J., Aveni, E., Pasquier, J., Herzig, L., Decosterd, I., Burnand, B.
PLoS One, 2018/09
Free full text
1744

The role of osteopathy in the Swiss primary health care system: a practice review
Vaucher, P., Macdonald, R. J. D., Carnes, D.
BMJ Open, 2018/09
Free full text
1745

Impact of the workforce distribution on the viability of the osteopathic profession in Australia: results from a national survey of registered osteopaths
Steel, A., Jackson, N., Blaich, R., Kirk, M., Wardle, J.
Chiropractic & Manual Therapies, 2018/09
Free full text
1746

Preparing Osteopathic Students for the Single Graduate Medical Education Accreditation System: Evaluating Factors for Match Success in Emergency Medicine
Stobart-Gallagher, M., O', Connell, A.
Western Journal of Emergency Medicine, 2018/09
Free full text
1747

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09
1748

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1749

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1750

Ernährungswissen: Integrativer Bestandteil der Osteopathie in Deutschland?
(Nutritional Knowledge: An integrative part of osteopathy in Germany?)
Nier, R.
Unpublished MSc thesis, 2018/09
Free full text
1751

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text
1752

Investigating practitioners' perceptions of the role of spirituality in osteopathic practice using Interpretative Phenomenological Analysis
Bacon, S. W., Roe, C. A.
International Journal of Osteopathic Medicine, 2018/09
1753

Die Ausübung der Gesundheitsfürsorge aus Patienten- und Therapeutensicht – eine Grounded-Theory-Analyse
(The health care practice from a patient's and practitioner's perspective - A grounded theory analysis)
Günther, F., Belz, S.
Osteopathische Medizin, 2018/09
1754

Der Osteopath – lebenslanges Lernen und Entwicklung
(The osteopath - lifelong learning and development)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
1755

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1756

Effectiveness of an Osteopathic Abdominal Manual Intervention in Pain Thresholds, Lumbopelvic Mobility, and Posture in Women with Chronic Functional Constipation
Martinez-Ochoa, M. J., Fernandez-Dominguez, J. C., Morales-Asencio, J. M., Gonzalez-Iglesias, J., Ricard, F., Oliva-Pascual-Vaca, A.
The Journal of Alternative and Complementary Medicine, 2018/08
1757

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1758

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text
1759

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1760

Evaluating the effectiveness of teaching osteopathy in a combined didactics setting
Eilerman, A., Keller, M. E., Hixson, D., II, Gupta
Osteopathic Family Physician, 2018/08
1761

Medical Infrared Thermography in back pain osteopathic management
Polidori, G., Kinne, M., Mereu, T., Beaumont, F., Kinne, M.
Complementary Therapies in Medicine, 2018/08
1762

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1763

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text
1764

Quantitative Description of Osteopathic Physician Authorship in Prominent Neurosurgery Journals Since 1944: Coming of Age?
Cuoco, J. A., Busch, C. M., Rogers, C. M., Guilliams, E. L., Klein, B. J., Howes, G. A., Marvin, E. A.
Cureus, 2018/08
Free full text
1765

Progressive Infantile Scoliosis Managed With Osteopathic Manipulative Treatment Response
Feely, R. A., Kapraun, H. E.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1766

Treatment of bilateral dyshidrotic eczema with drugs versus nutritional and osteopathic treatment
Aceranti, A., Vernocchi, S.
Italian Journal of Medicine, 2018/07
Free full text
1767

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1768

Osteopathic Lymphatic Pump Techniques
Franzini, D., Cuny, L. A., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1769

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1770

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07
1771

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07
1772

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1773

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07
1774

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07
1775

Enablers and barriers to the development of interprofessional collaboration between physicians and osteopaths: A mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
Journal of Interprofessional Care, 2018/07
1776

Burnout Rates in Oklahoma State University - College of Osteopathic Medicine Alumni
Chaffin, J.
Unpublished MSc thesis, 2018/07
Free full text
1777

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07
1778

Lymphatic Pump Treatment Mobilizes Bioactive Lymph That Suppresses Macrophage Activity In Vitro
Castillo, R., Schander, A., Hodge, L. M.
The Journal of the American Osteopathic Association, 2018/07
Free full text
1779

Osteopathic Manipulative Therapy Potentiates Motor Cortical Plasticity
Ponzo, V., Cinnera, A. M., Mommo, F., Caltagirone, C., Koch, G., Tramontano, M.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1780

Blood pressure screening in an Australian osteopathy student-led clinic
Vaughan, B., Cannon, N., Davies, D., Kourtis, N., Neophitou, S., Mulcahy, J.
International Journal of Osteopathic Medicine, 2018/06
1781

Osteopathic Evaluation and Post-Surgical Rehabilitation Approach in a Patient With Myelopathy and Tetraparesis Related to Cervical Ependymoma: A Case Report
Lewis, D. D.
The AAO Journal, 2018/06
Free full text
1782

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text
1783

The immediate effects of two manual therapy techniques on ankle musculoarticular stiffness and dorsiflexion range of motion in people with chronic ankle rigidity: A randomized clinical trial
Hidalgo, B., Hall, T., Berwart, M., Biernaux, E., Detrembleur, C.
Journal of Back and Musculoskeletal Rehabilitation, 2018/06
1784

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text
1785

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1786

Osteopathic Cranial Manipulative Medicine in the Setting of Concussion
Warren, C., Keys, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1787

The attitudes and beliefs of UK osteopaths towards the management of low back pain: A cross-sectional study
Bar-Zaccay, A., Bailey, D.
International Journal of Osteopathic Medicine, 2018/06
1788

Osteopathic manipulative treatment for post mastectomy pain: A case report
Downey, H. F.
International Journal of Osteopathic Medicine, 2018/06
1789

The Lancet Low Back pain series: A call to action for osteopathy?
Fitzgerald, K., Vaughan, B., Austin, P., Grace, S., Orchard, D., Orrock, P.l, Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/06
1790

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06
1791

The use of osteopathic manipulative medicine in the treatment of headaches for a patient with subdural hematomas in the setting of traumatic brain injury
Bonthala, S., Falco, C.
The Journal of Head Trauma Rehabilitation, 2018/06
1792

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06
1793

Barriers to identifying mood disorders in clients by New Zealand osteopaths: Findings of a thematic analysis
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2018/06
1794

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text
1795

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06
1796

Anastamosis
Ackert, K.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1797

Attitudes and self-reported practices of New Zealand osteopaths to exercise consultation
Mistry, R. A., Bacon, C. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2018/06
1798

Letter to the editor on Holism in Osteopathy - Bridging the gap between concept and practice: A grounded theory study
Morelli, R.
International Journal of Osteopathic Medicine, 2018/06
1799

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1800

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text
1801

An exploration of osteopaths' views and experiences regarding the identification of, and provision of advice for, urinary incontinence in women: A qualitative study using framework analysis
Robinson, M. E., Ford, S. L., Goodman, L. B.
International Journal of Osteopathic Medicine, 2018/06
1802

Evidence, alternative facts and narrative: A personal reflection on person-centred care and the role of stories in healthcare
Tyreman, S.
International Journal of Osteopathic Medicine, 2018/06
Free full text
1803

Palpation - Eine Fähigkeit des Gehirns?
(Palpation: An ability of the brain?)
Krause, R.
Osteopathische Medizin, 2018/05
1804

Leistenschmerzen aus Sicht des Hernienchirurgen
(Inguinal pain from the point of view of the hernia surgeon)
Kuthe, A.
Osteopathische Medizin, 2018/05
1805

Review zur Bedeutung der Schädelbasis in der Osteopathie
(Review on the importance of the cranial base in osteopathy)
Liem, T.
Osteopathische Medizin, 2018/05
1806

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05
1807

Effect of selected osteopathic lymphatic techniques on immune system in healthy subjects
Abdelfattah, A., Abdelraoof, N., Nasef, S.
Internal Medicine Journal, 2018/05
Free full text
1808

Immediate Effects of Osteopathic Treatment Versus Therapeutic Exercise on Patients With Chronic Cervical Pain
Galindez-Ibarbengoetxea, X., Setuain, I., Ramírez-Velez, R., Andersen, L., González-Izal, M., Jauregi, A., Izquierdo, M.
Alternative Therapies in Health and Medicine, 2018/05
1809

Efficacy of Osteopathic Manipulative Treatment in the Patient of Chronic Rhinosinusitis: A Case Report
Baisakhiya, N.
An International Journal Clinical Rhinology, 2018/05
1810

Myofascial Release Therapy Beneficial for Patients With Chronic Low Back Pain
Jazayeri, S., Seffinger, M.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1811

A workforce survey of Australian osteopathy: analysis of a nationally-representative sample of osteopaths from the Osteopathy Research and Innovation Network (ORION) project
Adams, J., Sibbritt, D., Steel, A., Peng, W.
BMC Health Services Research, 2018/05
Free full text
1812

Fibromyalgia Symptoms Reduced by Osteopathic Manipulative Medicine and Gabapentin
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1813

Osteopathic Manipulation Shown to Improve Upper Airway Stabilization
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1814

Cervical Osteopathic Manipulation Shown to Affect Median Nerve Function
King, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1815

Manipulation and mobilization for treating chronic low back pain: a systematic review and meta-analysis
Coulter, I. D., Crawford, C., Hurwitz, E. L., Vernon, H., Khorsan, R., Suttorp Booth, M., Herman, P. M.
The Spine Journal, 2018/05
Free full text
1816

The perceptions and experiences of osteopathic treatment among cancer patients in palliative care: a qualitative study
Steel, A., Tricou, C., Monsarrat, T., Ruer, M., Deslandes, C., Sisoix, C., Filbet, M.
Supportive Care in Cancer, 2018/05
1817

Exploring the measurement properties of the osteopathy clinical teaching questionnaire using Rasch analysis
Vaughan, B.
Chiropractic & Manual Therapies, 2018/05
Free full text
1818

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1819

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1820

Restoration of Full Shoulder Range of Motion After Application of the Fascial Distortion Model
Boucher, J. D., Figueroa, J.
The Journal of the American Osteopathic Association, 2018/05
Free full text
1821

Osteopathie zur Therapie bei unspezifischen Rückenschmerzen
(IGeL-Monitor. Osteopathy for non specific low back pain)
Buchberger, B., Krabbe, L., Lüpfert, K., Janatzek, S., Eikermann, M.
, 2018/04
Free full text
1822

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1823

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1824

Neck-stomach syndrome in the cervical spondylosis: An update on preliminary 2017 data
Ramieri, A., Miscusi, M., Costanzo, G.
European Spine Journal, 2018/04
1825

Fibromyalgia with Gabapentin and Osteopathic Manipulative Medicine: A Pilot Study
Marske, C., Bernard, N., Palacios, A., Wheeler, C., Preiss, B., Brown, M., Bhattacharya, S., Klapstein, G.
The Journal of Alternative and Complementary Medicine, 2018/04
1826

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1827

How type and number of training sessions influence the reliability of palpation
Lavazza, C., Milano, V., Abenavoli, A., Maggiani, A.
Journal of Bodywork and Movement Therapies, 2018/04
1828

Osteopathic manipulative treatment in chronic coccydynia: A case series
Origo, D., Tarantino, A. G., Nonis, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2018/04
1829

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04
1830

The immediate effect of osteopathic cervical spine mobilization on median nerve mechanosensitivity: A triple-blind, randomized, placebo-controlled trial
Whelan, G., Johnston, R., Millward, C., Edwards, D. J.
Journal of Bodywork and Movement Therapies, 2018/04
1831

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text
1832

Complaints about chiropractors, osteopaths, and physiotherapists: A retrospective cohort study of health, performance, and conduct concerns
Ryan, A. T., Too, L. S., Bismark, M. M.
Chiropractic & Manual Therapies, 2018/04
Free full text
1833

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1834

An investigation of attitudes and underlying beliefs toward low back pain among osteopathy students using the Back Pain Attitudes Questionnaire (Back-PAQ)
Hilbink, H.
Unpublished MSc thesis, 2018/04
Free full text
1835

Effectiveness of 2 Osteopathic Treatment Approaches on Pain, Pressure-Pain Threshold, and Disease Severity in Patients with Fibromyalgia: A Randomized Controlled Trial
Albers, J., Jäkel, A., Wellmann, K., von Hehn, U., Schmidt, T.
Complementary medicine research, 2018/04
1836

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1837

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1838

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text
1839

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1840

Behandlung der kranialen Abflüsse bei HWS-Problematik
(Treatment of cranial drains in cervical spine problems)
Hanke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1841

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1842

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03
1843

Einfluss der osteopathischen Therapie auf funktionelle Sehstörungen beim Schulkind
(Influence of osteopathic therapy on functional visual disorders in schoolchildren)
Nestel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
Free full text
1844

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text
1845

Wann braucht ein Kind Physiotherapie und wann Osteopathie?
(When does a child need physiotherapy and when do they need osteopathy?)
Schwahn, N., Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03
1846

Osteopathic Manipulative Treatment in the Management of Pediatric Headache and Orthodontic Intervention: A Case Report
Heineman, K.
The AAO Journal, 2018/03
Free full text
1847

Characterizing Adverse Events Reported After Osteopathic Manipulative Treatment
Degenhardt, B. F., Johnson, J. C., Brooks, W. J., Norman, L.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1848

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1849

Shaping conservative spinal services with the Spine Tango Registry
Morris, S., Booth, J.
European spine journal, 2018/03
1850

The Safety of Osteopathic Manipulative Treatment (OMT)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1851

Einfluss der craniosacralen Behandlung CV-4 bei Schwangeren in der 41. Schwangerschafts-woche.
(The influence of craniosacral CV-4-treatment on pregnancies in the 41st week of pregnancy)
Samonigg-Lackner, D.
Unpublished MSc thesis, 2018/03
Free full text
1852

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1853

Ultrasonographic Evaluation of the Effect of Osteopathic Manipulative Treatment on Sacral Base Asymmetry
Snider, K. T., Redman, C. L., Edwards, C. R., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1854

OMT for Patients With Sacral Somatic Dysfunction
Yu, K., Pfotenhauer, K., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1855

Der achtsame A.T. Still
(The mindful A.T. Still)
Schötta, M.
Unpublished MSc thesis, 2018/03
Free full text
1856

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1857

‘I just don't have the tools’ - Italian osteopaths' attitudes and beliefs about the management of patients with chronic pain: A qualitative study
Formica, A., Thomson, O. P., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/03
Free full text
1858

“Der schiefe Kopf“ Befundungs- und Behandlungsprozess bei Säuglingen mit Plagiozephalie mittels Experteninterviews
(“The Oblique Head“ Follow-Up and Treatment Process for Infants with Orthesis by Interview of Experts)
Michaelis, C.
Unpublished MSc thesis, 2018/03
Free full text
1859

The effect of a six-week osteopathic visceral manipulation in patients with non-specific chronic low back pain and functional constipation: study protocol for a randomized controlled trial
Fernandes, W. V. B., Blanco, C. R., Politti, F., de Cordoba Lanza, F., Lucareli, P. R. G., Correa, J. C. F.
Trials, 2018/03
Free full text
1860

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text
1861

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text
1862

Assessment of cervical stiffness in axial rotation among chronic neck pain patients: A trial in the framework of a non-manipulative osteopathic management
Dugailly, P. M., Coucke, A., Salem, W., Feipel, V.
Clinical Biomechanics, 2018/03
1863

Work-related musculoskeletal injuries among Australian osteopaths: A preliminary investigation
McLeod, G. A., Murphy, M., Henare, T. M., Dlabik, B.
International Journal of Osteopathic Medicine, 2018/03
1864

Effektivität der osteopathischen Behandlung bei Patienten mit chronischem Knieschmerz, eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with chronic knee pain, a randomized controlled study)
Weitendorff, A.
Unpublished MSc thesis, 2018/03
1865

Pre-entry qualifications as predictors of success in first year osteopathic education
Palfreyman, S., Mercier, J., Friedlander, T.
International Journal of Osteopathic Medicine, 2018/03
1866

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03
1867

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text
1868

Kann durch eine Serie von osteopathischen Behandlungen die Lebensqualität von Bewohnern eines Altenheims, die an Osteoporose erkrankt sind, mehr verbessert werden als mit einer alternativen Behandlung in Form von Bewegungstherapie?
(Can the quality of life of an elderly who is affected by osteoporosis be improved through a series of osteopathic treatments, rather than with an alternative treatment in the form of movement therapy?)
Preis, G.
Unpublished MSc thesis, 2018/03
Free full text
1869

Pilotstudie über den Einfluss der osteopathischen Behandlung des Mesenteriums auf das Atemvolumen
(Pilot study on the influence of the treatment of the mesentery on the respiratory volume)
Muigg, E.
Unpublished MSc thesis, 2018/03
Free full text
1870

The effects of osteopathic treatment on psychosocial factors in people with persistent pain: A systematic review
Saracutu, M., Rance, J., Davies, H., Edwards, D. J.
International Journal of Osteopathic Medicine, 2018/03
1871

Morphogenese
(Morphogenesis)
Leitner, M.
Unpublished MSc thesis, 2018/03
Free full text
1872

Core competencies in osteopathy: Italian register of osteopaths proposal
Sciomachen, P., Arienti, C., Bergna, A., Castagna, C., Consorti, G., Lotti, A., Lunghi, C., Tramontano, M., Longobardi, M.
International Journal of Osteopathic Medicine, 2018/03
Free full text
1873

Einfluss osteopathischer Behandlung bei Subacromialem Impingement-Syndrom (SAIS)
(Influence of Osteopathic Treatment on Subacromial Impingement Syndrome (SAIS))
Grill, H.
Unpublished MSc thesis, 2018/03
Free full text
1874

Osteopathie bei Rücken- und Beckengürtelschmerzen während und nach der Schwangerschaft
(Osteopathy in low back pain and pelvic girdle pain during and after pregnancy: Systematic review and meta-analysis)
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Osteopathische Medizin, 2018/03
1875

Mechanical Link – Protokoll für eine individuelle Diagnostik und Therapie
(Mechanical link - Protocol for an individual diagnostics and therapy)
Hafen-Bardella, C.
Osteopathische Medizin, 2018/03
1876

OMT to Address the Physiologic Effects of Stress
Emmet, D., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/02
Free full text
1877

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text
1878

Osteopathic Manipulative Treatment in Surgical Care: Short Review of Research Publications in Osteopathic Journals During the Period 1990 to 2017
Sposato, N. S., Bjersa, K.
Journal of Evidence-Based Integrative Medicine, 2018/02
Free full text
1879

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text
1880

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text
1881

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text
1882

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text
1883

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text
1884

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text
1885

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text
1886

Einfluss postoperativer Adhäsionen nach Sektio auf chronischen Low Back Pain - eine Pilotstudie
(Influence of postoperative adhesion after caesarean section on chronic lower back pain - a pilot study)
Liedler, M.
Unpublished MSc thesis, 2018/02
Free full text
1887

Erhöht eine interne myofasciale osteopathische Technik am Beckenboden die Effektivität des Beckenbodentrainings bei Frauen mit Belastungsinkontinenz?
(Does an internal myofascial osteopathic technique applied on the pelvic floor muscles increase the efficiency of the pelvic floor muscle training on women with stress urinary incontinence?)
Hie-Wiederstein, M.
Unpublished MSc thesis, 2018/02
Free full text
1888

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1889

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1890

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1891

Osteopathische intrauterine Behandlung einer kongenitalen Lungenzyste
(Osteopathic intrauterine treatment of a congenital lung cyst)
Urbanek, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01
1892

Themes underlying Australian general practitioner views towards chiropractic and osteopathy: An assessment of free text data from a cross-sectional survey
Grace, S., Engel, R., Jalsion, I.
Evidence-based Complementary and Alternative Medicine, 2018/01
Free full text
1893

Chronic Pain Management: Perspective of an Osteopathic Medical Student in New Mexico
Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1894

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1895

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1896

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1897

Effects of spinal manipulation and myofascial techniques on heart rate variability: A systematic review
Amoroso Borges, B. L., Bortolazzo, G. L., Neto, H. P.
Journal of Bodywork and Movement Therapies, 2018/01
1898

OMT May Be Helpful in the Management of Benign Paroxysmal Positional Vertigo
Tegeler, L., Blumer, J.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1899

An evaluation of osteopathic treatment on psychological outcomes with patients suffering from chronic pain: A prospective observational cohort study collected through a health and well-being academy
Edwards, D. J., Toutt, C.
Health Psychology Open, 2018/01
Free full text
1900

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text
1901

Lymphatic Vessels Found in the Brain-Osteopathic Considerations, Part 2: Now in Humans and Monkeys
King, H. H.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1902

OSTMED.DR(R), an Osteopathic Medicine Digital Library
Fitterling, L., Powers, E., Vardell, E.
Medical reference services quarterly, 2018/01
1903

Manual therapy for unsettled, distressed and excessively crying infants: a systematic review and meta-analyses
Carnes, D., Plunkett, A., Ellwood, J., Miles, C.
BMJ Open, 2018/01
Free full text
1904

How effective are health professional students in coping with stress?
Tsai, W., Park, S.
Journal of Investigative Medicine, 2018/01
1905

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text
1906

Combined osteopathy and exercise management of Achilles tendinopathy in an athlete
Ross, G., Macfarlane, C., Vaughan, B.
The Journal of Sports Medicine and Physical Fitness, 2018/01
1907

Analysis of Factors that Influence Pre-med Undergraduate Selection of Osteopathic or Allopathic Medical School
Kuizin, L. A.
Unpublished Dissertation, 2018/01
1908

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1909

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1910

Osteopathy as an Aid to Treatment
Riedel, M.
Deutsches Ärzteblatt International, 2018/01
Free full text
1911

Safety of Osteopathic Cranial Manipulative Medicine as an Adjunct to Conventional Postconcussion Symptom Management: A Pilot Study
Patel, K. G., Sabini, R. C.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1912

OMT for Cancer Patients After Bowel Resection
Pena, N., Prieto, H., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/01
Free full text
1913

Level of evidence and quality of reports of cranial and visceral osteopathic treatment trials
Morin, C., Gaboury, I.
Global Advances in Health and Medicine, 2018
1914

Die Wirklichkeit der Osteopathie. Studie zu einer am Leib orientierten Anthropologie
(The reality of osteopathy. Study of an anthropology oriented to the lived body)
Kaiser, A.K.
Dissertation, 2018
1915

Neurobiology of Sexual Assault and Osteopathic Considerations for Trauma-Informed Care and Practice
Cuevas, K. M., Balbo, J., Duval, K., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1916

Tools zum Erlernen der Palpation
(Tools for learning palpation)
Krause, R.
Osteopathische Medizin, 2017/12
1917

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text
1918

A road to somewhere - endless debate about the nature of practice, the profession and how we should help patients
Vogel, S.
International Journal of Osteopathic Medicine, 2017/12
1919

Osteopathische Läsion – Teil 2: Definitionen und Terminologien
(Osteopathic lesion - Part 2: Definitions and terminologies)
Liem, T.
Osteopathische Medizin, 2017/12
1920

Kommentar des Autors
Author's comment
Liem, T.
Osteopathische Medizin, 2017/12
1921

Advancing the Understanding and Treatment of the Thoracic Inlet and Incorporation of a New Still Technique—Part 1
Lewis, D. D.
The AAO Journal, 2017/12
Free full text
1922

Compression of the Fourth Ventricle Using a Craniosacral Osteopathic Technique: A Systematic Review of the Clinical Evidence
Zurowska, A., Malak, R., Kolcz-Trzesicka, A., Samborski, W., Paprocka-Borowicz, M.
Evidence-based Complementary and Alternative Medicine, 2017/12
Free full text
1923

MRI Assessment of Changes in Swelling of Wrist Structures Following OMT in Patients With Carpal Tunnel Syndrome
Ramey, K. A., Kappler, R. E., Chimata, M., Hohner, J., Mizera, A. C.
The AAO Journal, 2017/12
Free full text
1924

OMT for Patients With Multiple Sclerosis
Wolf, K., Krinard, T., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1925

Braucht es einen Paradigmenwechsel in der osteopathischen Diagnostik und Therapie im kraniozervikalen Bereich?
(Is a paradigm shift required in osteopathic diagnosis and treatment in the craniocervical junction?)
Moser, U.
Osteopathische Medizin, 2017/12
1926

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12
1927

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1928

Use of pressure dynamometer in the assessment of the pressure pain threshold in trigger points in the craniocervical muscles in women with unilateral migraine and tension-type headache: An observational study
Pires, R., da Rocha, N. S., Esteves, J. E., Rodrigues, M. E.
International Journal of Osteopathic Medicine, 2017/12
1929

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12
1930

Let's get physical!
Hickner, J.
The Journal of Family Practice, 2017/12
1931

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text
1932

Osteopathic manipulative treatment for post mastectomy lymphedema: A case report
Goyal, M, Goyal, K, Narkeesh, K., Samuel, A. J., Arumugam, N.
International Journal of Osteopathic Medicine, 2017/12
1933

Osteopathic Manipulative Treatment for the Management of Adjacent Segment Pathology
Lewis, D. D., Summers, G. K.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1934

OSTEHOM, recurso educativo digital para la enseñanza y aprendizaje de la cintura escapular (Hombro) en Osteopatía Estructural
(OSTEHOM: Digital educational resource for teaching and learning about the shoulder girdle in Structural Osteopathy)
Arenas Romero, M. V.
Unpublished MSc thesis, 2017/12
Free full text
1935

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text
1936

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text
1937

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text
1938

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1939

Osteopathy and troublesome regurgitation in babies. The influence of a set of osteopathic techniques on the symptoms of troublesome regurgitation in babies. A randomized controlled clinical trial
Schepers, V.
Unpublished D.O. thesis, 2017/12
1940

When, why, and how osteopaths and physicians communicate: Lessons learned from the results of a mixed methods study
Morin, C., Desrosiers, J., Gaboury, I.
International Journal of Osteopathic Medicine, 2017/12
1941

Developing a new approach to persistent pain management in osteopathic practice. Stage 1: A feasibility study for a group course
Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/12
1942

Complementary and alternative therapies in dentistry and characteristics of dentists who recommend them
Baatsch, B., Zimmer, S., Rodrigues Recchia, D., Bussing, A.
Complementary Therapies in Medicine, 2017/12
1943

Median Arcuate Ligament Syndrome (MALS): Fallserie über die osteopathische Behandlung von sieben Patienten: Evidenzlevel IV gemäß CARE-Guideline
(Median arcuate ligament syndrome (MALS): Case series on the osteopathic treatment of seven patients. Evidence level IV according to CARE guidelines)
Beck, M.
Osteopathische Medizin, 2017/12
1944

‘Sometimes I don't feel like an osteopath at all’- a qualitative study of final year osteopathy students' professional identities
Clarkson, H. J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2017/12
1945

Challenging Case of Parotitis: A Comprehensive Approach
Patel, P., Scott, S., Cunningham, S.
The Journal of the American Osteopathic Association, 2017/12
Free full text
1946

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1947

Current Clinical Status of Osteopathy: Study Based on Retrospective Evidences of Six Years, A Systemic Review
Ahmad, R.
Annual Research & Review in Biology, 2017/11
Free full text
1948

Descriptive study of interprofessional collaboration between physicians and osteopaths for the pediatric population in Quebec, Canada
Morin, C., Desrosiers, J., Gaboury, I.
BMC Health Services Research, 2017/11
Free full text
1949

Correction: Does Visceral Osteopathic Treatment Accelerate Meconium Passage in Very Low Birth Weight Infants?- A Prospective Randomized Controlled Trial
Haiden, N., Pimpel, B., Kreissl, A., Jilma, B., Berger, A.
PLoS One, 2017/11
Free full text
1950

Functional Limitations in Adults Who Utilize Chiropractic or Osteopathic Manipulation in the United States: Analysis of the 2012 National Health Interview Survey
Forte, M. L., Maiers, M.
Journal of Manipulative and Physiological Therapeutics, 2017/11
1951

Comparing the Effect of Osteopathic Manipulative Medicine Versus Concussion Education for the Acute Treatment of Mild Concussion Symptoms
Angelo, N., Zwibel, H., Leder, A., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2017/11
1952

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
Journal of Osteopathic Medicine, 2017/11
1953

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
Journal of Osteopathic Medicine, 2017/11
1954

Engaging in “Mind, Body, Spirit”—A Student Perspective on Incorporating Mindfulness in Osteopathic Medical Education Through the Wellness, Academic, Resilience and Mindfulness (WARM) Curriculum
Hu, H., Khorsand, M., Anand, R., Hendriksz, T., Velasco, H. E.
Journal of Osteopathic Medicine, 2017/11
1955

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
Journal of Osteopathic Medicine, 2017/11
1956

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
Journal of Osteopathic Medicine, 2017/11
1957

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
Journal of Osteopathic Medicine, 2017/11
1958

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
Journal of Osteopathic Medicine, 2017/11
1959

Osteopathic Manipulative Treatment Reduces Oxidative Stress Levels and Improves Relative Stiffness and Quality of Life in Parkinson Disease
Moriarty, S. A., Lu, V., Oommen, C., Bellavia, L. M., Lee, J. M., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Leheste, J., Yao, S. C.
Journal of Osteopathic Medicine, 2017/11
1960

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1961

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text
1962

Evaluation of New Zealand osteopathy patients experiences of their treatment
Judkins, R., Vaughan, B., Mulcahy, J.
Complementary Therapies in Clinical Practice, 2017/11
1963

Effect of Osteopathic Cranial Manipulative Medicine on Visual Function
Bach, A., Bach, M., Frankel, S.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1964

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1965

Condylar Decompression Technique for Infants
Pierce-Talsma, S., Pena, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text
1966

Vital Signs of U.S. Osteopathic Medical Residency Programs Pivoting to Single Accreditation Standards
Novak, T. S.
Unpublished PhD thesis, 2017/10
Free full text
1967

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1968

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
1969

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text
1970

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1971

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10
1972

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1973

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text
1974

Manipulative scar treatment and ostheopatic manipulative treatment for pain, shoulder motion and quality of life in post-mastectomy pain syndrome (PMPS). A randomized clinical trial
Figini, D., Seghini, P., Bidin, L.
Annals of Oncology, 2017/10
1975

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10
1976

Work related musculoskeletal injuries sustained by Australian osteopaths: qualitative analysis of effects on practitioner health, clinical practice, and patient care
McLeod, G. A., Annels, K., Cohen, J., Edwards, S., Hodgins, D., Vaughan, B.
Chiropractic & Manual Therapies, 2017/10
Free full text
1977

Besteht ein Zusammenhang zwischen dem Modus der Geburt und dem Auftreten osteopathischer Dysfunktionen? Prädiktorenstudie.
(Investigation of correlations between mode of delivery and present osteopathic dysfunctions. Predictor-Study)
Armann, J.
Unpublished D.O. thesis, 2017/10
1978

Kann die osteopathische Behandlung die Krankheitsaktivität bei Patienten mit rheumatoider Arthritis (RA) beeinflussen? Randomisierte kontrollierte Studie.
(The influence of osteopathic treatment in addition to the standard therapy on disease activity in patients with rheumatoid arthritis (RA). A randomized controlled trial)
Franzen, K., Ramscheidt, B.
Unpublished D.O. thesis, 2017/10
1979

Wirksamkeit einer ganzheitlichen osteopathischen Behandlung bei Menschen mit Depression und damit einhergehenden Schlafstörungen. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with depression and associated sleep disturbance. A pre-post study)
Gruber, J.
Unpublished D.O. thesis, 2017/10
1980

Einfluss einer osteopathischen Behandlung am Tag des errechneten Geburtstermins auf das Einsetzen einer physiologischen Geburt innerhalb eines 48-Stunden Zeitraums. Randomisierte kontrollierte Studie.
(The influence of an osteopathic treatment at due date on the onset of labor within a 48-hour period. A randomized controlled trial)
Huss, S., Klose, M., Patanchon, P.
Unpublished D.O. thesis, 2017/10
1981

Postpartale Beschwerden von Müttern nach einem Kaiserschnitt
(Postpartal complaints of mothers after Caesarean section)
Weiss, A.
Unpublished MSc thesis, 2017/10
1982

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10
1983

Untersuchung der Effektivität von osteopathischen Behandlungen zusätzlich zur Standardtherapie bei Jugendlichen mit unspezifischen Kreuzschmerzen. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in addition to standard therapy in adolescents with unspecific low lack pain (LBP). A randomized controlled trial)
Ringeisen, P.
Unpublished D.O. thesis, 2017/10
1984

Osteopathie bei gastroosophagealem Reflux mit Hiatushernie: Ein Fallbericht gemass der CARE-Leitlinie
(Osteopathic Treatment of Gastroesophageal Reflux Disease and Hiatal Hernia: A Case Report Following the CARE Guideline)
Rotter, G., Brinkhaus, B.
Complementary Medicine Research, 2017/10
Free full text
1985

Osteopathische Behandlung von Patienten mit Impingement-Syndrom der Schulter. Prä-Post-Studie.
(Effectiveness of individual osteopathic treatment in patients with shoulder outlet impingement. A pre-post study)
Tallo, F.
Unpublished D.O. thesis, 2017/10
1986

Developing an evidence base for osteopathic healthcare: an exploration of osteopathic healthcare to inform the design of an appropriate methodology to investigate its effectiveness
Orrock, P. J.
Unpublished PhD thesis, 2017/10
Free full text
1987

Diabetes mellitus in der Osteopathie- beachten, behandeln, betreuen. Ein systematisierter Review
(Diabetes mellitus in Osteopathy-consider,treat, care. A systematized review)
Bertl, D.
Unpublished MSc thesis, 2017/10
Free full text
1988

Die Pathophysiologie von postoperativen peritonealen Adhäsionen - Osteopathie als Behandlungsmöglichkeit?
(The pathophysiology of postoperative peritoneal adhesions - Osteopathy as a treatment option?)
Lackner, I.
Unpublished MSc thesis, 2017/10
Free full text
1989

Osteopathie und die Auswirkung auf den Trainingslevel der MFT Challenge Disc. Eine kontrollierte randomisierte klinische Pilotstudie an gesunden Personen.
(Osteopathy and its effect on the Training Level of the MFT Challenge Disc. A randomised controlled pilot study of healthy adults)
Moser-Dobaj, A.
Unpublished MSc thesis, 2017/10
Free full text
1990

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text
1991

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/
1992

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
1993

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text
1994

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09
1995

Prozessorientierung in der Osteopathie: ein Ansatz jenseits des Strukturmodells
(Process orientation in osteopathy: An approach beyond the structural model)
Lederman, E.
Osteopathische Medizin, 2017/09
1996

Die biodynamische Behandlung bei einem Patienten mit Makuladegeneration
(Biodynamic treatment of a patient suffering from macular degeneration)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
1997

Update zur Drainage des Gehirns und osteopathische Behandlungsansätze
Update on brain drainage and osteopathic treatment approaches
Liem, T.
Osteopathische Medizin, 2017/09
1998

Osteopathic Manipulative Treatment for Chronic Neck Pain, Headaches, and Referred Pain in a Patient With Myofascial Pain Syndrome: A Case Report
Lewis, D. D.
The AAO Journal, 2017/09
Free full text
1999

The Use of Osteopathic Manual Therapy and Rehabilitation for Subacromial Impingement Syndrome: A Case Report
Bennett, S., Macfarlane, C., Vaughan, B.
Explore (NY), 2017/09
2000

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2001

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2002

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2003

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2004

Acupuncture Meridian-Based Myofascial Release to Treat Knee Pain in Sinding-Larsen–Johansson Syndrome: A Case Report
Valvano, K. D., Sina, R. E.
The AAO Journal, 2017/09
Free full text
2005

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2006

Interet clinique du traitement osteopathique chez les patientes ayant une endometriose colorectale : classification fondee sur les symptomes et la qualite de vie.
(Impact of osteopathic manipulative therapy in patient with deep colorectal endometriosis: A classification based on symptoms and quality of life)
Darai, C., Bendifallah, S., Foulot, H., Ballester, M., Chabbert-Buffet, N., Darai, E.
Gynecologie, Obstetrique, Fertilite & Senologie, 2017/09
2007

Osteopathic approach to treating a patient with congenital infantile torticollis reveals unusual presentation of absence of concomitant cranial base strain pattern: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/09
2008

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2009

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 1: The mechanisms
Fryer, G.
International Journal of Osteopathic Medicine, 2017/09
2010

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text
2011

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text
2012

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text
2013

Osteopathische Behandlung bei Coxarthrose
(Osteopathic Treatment of Patients with Coxarthrosis: A Randomised Controlled Trial)
Vögele, T.
Unpublished MSc thesis, 2017/09
Free full text
2014

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2015

Aus welchen Gründen und mit welchen Beschwerden kommen Mütter innerhalb 18 Monate post partum zum/zur Osteopathen/in und welche somatischen Dysfunktionen weisen sie auf?
(What are the reasons and complaints of mothers who consult an osteopath within 18 months postpartum, and which somatic dysfunctions do they have?)
Woitzik, K.
Unpublished MSc thesis, 2017/09
Free full text
2016

Bewusstseinszustand von Osteopathen während einer kranialen Behandlung
(State of consciousness of osteopaths during cranial treatment)
Köppl-Hiptmair, K.
Unpublished MSc thesis, 2017/09
Free full text
2017

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
2018

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2019

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2020

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2021

Fundamentals for an Osteopathic Obesity Designed Study: The Effects of Education on Osteopathic Medical Students' Attitudes Regarding Obesity
Gayer, G. G., Weiss, J., Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2022

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text
2023

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text
2024

Diagnostic reliability of osteopathic tests: A systematic review
Basile, F., Scionti, R., Petracca, M.
International Journal of Osteopathic Medicine, 2017/08
2025

Corrigendum to “Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research“ [Musculoskelet. Sci. Pract. 27 165-175]
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/08
2026

Efficacité d'un traitement ostéopathique pour les problématiques biomécaniques de succion des nouveau-nés
(Efficacy of an osteopathic treatment for infants with biomechanical sucking dysfunctions)
Herzhaft-Le Roy, J.
Unpublished MSc thesis, 2017/08
Free full text
2027

Conservative management of a traumatic meniscal injury utilising osteopathy and exercise rehabilitation: A case report
Feehan, J., Macfarlane, C., Vaughan, B.
Complementary Therapies in Medicine, 2017/08
2028

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text
2029

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2030

Meeting ACGME Standards Under a Unified Accreditation System: Challenges for Osteopathic Graduate Medical Education Programs
Cummings, M.
Academic Medicine, 2017/07
Free full text
2031

Successful outcome of musculoskeletal injury leads to a reduction in chronic fatigue: A case report
Todd, C.
Journal of Bodywork and Movement Therapies, 2017/07
2032

Efficacy of Osteopathic Manipulative Treatment Approach in the Patient with Pulmonary Fibrosis in Critical Care Outpatient Department
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Arumugam, N., Chatterjee, S., Sharma, S.
Indian Journal of Critical Care Medicine, 2017/07
Free full text
2033

The effectiveness of osteopathic manipulative treatment in an abnormal uterine bleeding related pain and health related quality of life (HR-QoL) - A case report
Goyal, K., Goyal, M., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S., Arumugam, N.
Journal of Bodywork and Movement Therapies, 2017/07
2034

Hypnosis and Osteopathic Manipulative Treatment for Visual Disorders During Pregnancy: A Case Report
Russo, G., Remonato, A., Remonato, R., Zanier, E.
Advances in Mind-Body Medicine, 2017/07
2035

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07
2036

Osteopathic approach to treating a patient with new onset low back pain following injury reveals unusual presentation of bilateral and symmetric symptoms: A case report
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2017/07
2037

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text
2038

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2039

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2040

Osteopathic Approach to Anxiety
Blumer, T.., Blumer, J.
Osteopathic Family Physician, 2017/07
Free full text
2041

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text
2042

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text
2043

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2044

Effects of Osteopathic Manipulative Therapy on Pain and Mood Disorders in Patients With High-Frequency Migraine
D'Ippolito, M., Tramontano, M., Buzzi, M. G.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2045

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06
2046

Osteopathie als aktuelle Satzungsleistung gesetzlicher Krankenkassen
(Osteopathy as current optional benefit of statutory health insurance companies)
Newiger, C.
Osteopathische Medizin, 2017/06
2047

Balanced Fascial Tension (BFT) am Beispiel der faszialen Hüllen des Herzens
(Balanced Fascial Tension (BFT) using the fascial sheaths of the heart as an example)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2048

(Osteopathic approaches for endometriosis)
Ott, S.
Osteopathische Medizin, 2017/06
2049

Efficacy of an eccentric osteopathic manipulation treatment in somatic tinnitus
Goyal, M., Sharma, S., Baisakhiya, N., Goyal, K.
Indian Journal of Otology, 2017/06
2050

Wirkungen der Osteopathie im psychischen Bereich – eine systematische Literaturübersicht
(Effects of osteopathy in the psychological field - a systematic literature review)
Perstling, A., Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2051

Diaphragm postural function in injured subtalar joint
Urbaniak, M., Kisilewicz, A., Klich, S.
Physiotherapy Quarterly, 2017/06
2052

Schwindel bei Tubenkatarrh nach Otitis media
(Vertigo in tubal catarrh after otitis media)
Schneider, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
2053

Use of the Fascial Distortion Model to Evaluate a Limp in a Child
James, S. J., Hudnall, J.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2054

Mikrobiom: Worauf Sie bei Ihren Patienten achten sollten
(Microbiome: What you should pay particular attention to in your patients)
Zschocke, A. K.
Osteopathische Medizin, 2017/06
2055

Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment
Licciardone, J. C.
Musculoskeletal Science and Practice, 2017/06
2056

Reply to the letter to the editor: 'Systematic review of comparative effectiveness and health economics research relating to osteopathic manipulative treatment'
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/06
2057

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2058

Difference in R01 Grant Funding Among Osteopathic and Allopathic Emergency Physicians over the Last Decade
Antony, M., Savino, J., Ashurst, J.
Western Journal of Emergency Medicine, 2017/06
Free full text
2059

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06
2060

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text
2061

Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
2062

Osteopathische Behandlungen nach Karpaltunneloperation – eine randomisierte kontrollierte Studie
(Osteopathic treatments after carpal tunnel surgery - A randomized controlled trial)
Deutschmann, G., Porthun, J., Grabner, O., Leskowschek, H., Graff, W., Sammer, A., Safran, T.
Osteopathische Medizin, 2017/06
2063

‘Talking a different language’: a qualitative study of chronic low back pain patients' interpretation of the language used by student osteopaths
Thomson, O. P., Collyer, K.
International Journal of Osteopathic Medicine, 2017/06
2064

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text
2065

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06
2066

(Explanatory video for teaching and learning the basics of osteopathy - What is osteopathy?)
Video explicativo para la enseñanza y aprendizaje de los fundamentos de la osteopatía ¿ Qué es la osteopatía?
Moreno Rojas, E. M.
Unpublished MSc thesis, 2017/06
Free full text
2067

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text
2068

The effect of visceral osteopathic manual therapy applications on pain, quality of life and function in patients with chronic nonspecific low back pain
Tamer, S., Öz, M., Ülger, O.
Journal of Back and Musculoskeletal Rehabilitation, 2017/05
2069

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05
2070

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2071

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2072

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2073

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text
2074

Addition of Osteopathic Visceral Manipulation to OMT for Low Back Pain Decreases Pain and Increases Quality of Life
King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2075

Effects of Osteopathic Treatment on Postural Equilibrium Evaluated through a Stabilometric Platform: A Randomized and Controlled Study
Buscemi, A., Cannatella, M., Lutrario, P., Rapisarda, A., Di Gregorio, G., Coco, M.
Journal of Functional Morphology and Kinesiology, 2017/05
Free full text
2076

Integrating osteopathic approaches based on biopsychosocial therapeutic mechanisms. Part 2: Clinical approach
Fryer, G.
International Journal of Osteopathic Medicine, 2017/05
2077

Osteopathic Manipulative Treatment During the Third Trimester of Pregnancy
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2078

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text
2079

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text
2080

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text
2081

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2082

A efetividade do tratamento osteopático na constipação intestinal: uma revisão sistemática
(Effectiveness of the ostheopatic treatment in intestinal constipation: A systematic review)
Rocha Do Vale, J., De Carvalho, H. F. B., Andrade, V. L. Â, Almeida, L. C.
GED - Gastrenterologia Endoscopia Digestiva, 2017/04
2083

Autismus-Spektrum-Störung (ASS) und Osteopathie
(Autism spectrum disorder (ASD) and osteopathy)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2084

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2085

„Point of Balance“ in der osteopathischen Behandlung eines Kindes mit Handicap
(“Point of Balance“ in the osteopathic treatment of a child with handicap)
Müller, H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2086

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2087

Preliminary evidence of Regional Interdependent Inhibition, using a 'Diaphragm Release' to specifically induce an immediate hypoalgesic effect in the cervical spine
McCoss, C. A., Johnston, R., Edwards, D. J., Millward, C.
Journal of Bodywork and Movement Therapies, 2017/04
2088

Im Gespräch mit … Angela Schleupen und Karl Heinz Riedl
(In dialog Angela Schleupen and Karl Heinz Riedl)
Schleupen, A., Riedl, K. H.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2089

Biological effects of direct and indirect manipulation of the fascial system. Narrative review
Parravicini, G., Bergna, A.
Journal of Bodywork and Movement Therapies, 2017/04
2090

Ein Leben mit Arthrogryposis multiplex congenita (ACM)
(Living with arthrogryposis multiplex congenita (AMC))
Seger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2091

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2092

Eine osteopathische Herangehensweise an reflexives Schreiben
(An osteopathic approach to reflective writing)
Brown, A., Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2093

Osteopathie bei infantiler Zerebralparese (IZP) – eine Einzelfallstudie
(Osteopathy in infantile cerebral palsy (IZP) - a single case study)
Budroni, J.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2094

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2095

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2096

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text
2097

Das Fasziendistorsionsmodell: Ein medizinisches Konzept – Praxiswissen kompakt
(The fascial distortion model: A medical concept - Praxiswissen Kompakt)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2098

Das chronische Beckenschmerzsyndrom : Hilfe durch Osteopathie.
(Chronic pelvic pain syndrome : Treatment options using osteopathy)
Marx, S.
Der Urologe, 2017/04
2099

Osteopathie bei infantiler Zerebralparese (IZP) – eine Einzelfallstudie
(Osteopathic treatment for infantile cerebral palsy: a case report)
Budroni, Jutta
DO - Deutsche Zeitschrift für Osteopathie, 2017/04
2100

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2101

Use of the Spencer Technique on Collegiate Baseball Players: Effect on Physical Performance and Self-Report Measures
Curcio, J. E., Grana, M. J., England, S., Banyas, P. M., Palmer, B. D., Placke, A. E., Rieck, W. A., Jr., Eade
The Journal of the American Osteopathic Association, 2017/03
Free full text
2102

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text
2103

Collaboration interprofessionnelle entre médecins et ostéopathes impliqués auprès de la clientèle pédiatrique au Québec
(Interprofessional collaboration between physicians and osteopaths involved with pediatric population in Quebec)
Morin, C.
Unpublished PhD thesis, 2017/03
Free full text
2104

Osteopathic Manipulative Treatment for Nausea and Vomiting Following Fine Needle Aspiration of the Neck
Hess, N. J.
The AAO Journal, 2017/03
Free full text
2105

Dermascope Use by Osteopathic Primary Care Physicians
Morris, J. B., Alfonso, S. V., Hernandez, N., Fernández, M. I.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2106

Imaging Evidence Demonstrating Effectiveness of Osteopathic Visceral Manipulation Techniques in Treating Pseudo-Obstruction
Ignatowicz, A., Berkowitz, M. R.
The AAO Journal, 2017/03
Free full text
2107

Osteopathic Manipulative Treatment in the Management of Isaacs Syndrome
Shanahan, L. K. T., Raines, S. G., Coggins, R. L., Moore, T., Carnes, M., Griffin, L.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2108

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2109

Efficacy of Myofascial Unwinding and Myofascial Release Technique in a Patient with Somatic Symptoms - A Case Report
Goyal, M., Goyal, K., Bathla, M., Kanimozhi, D., Narkeesh, D.
Indian journal of Psychological Medicine, 2017/03
Free full text
2110

Impact of osteopathic therapy on proprioceptive balance and quality of life in patients with dizziness
Papa, L., Amodio, A., Biffi, F., Mandara, A.
Journal of Bodywork and Movement Therapies, 2017/03
2111

A mixed methods evaluation of a third wave cognitive behavioural therapy and osteopathic treatment programme for chronic pain in primary care (OsteoMAP)
Carnes, D., Mars, T., Plunkett, A., Nanke, L., Abbey, H.
International Journal of Osteopathic Medicine, 2017/03
2112

A critical review of manual therapy use for headache disorders: prevalence, profiles, motivations, communication and self-reported effectiveness
Moore, C. S., Sibbritt, D. W., Adams, J.
BMC Neurology, 2017/03
Free full text
2113

Osteopathic manipulative treatment showed reduction of length of stay and costs in preterm infants: A systematic review and meta-analysis
Lanaro, D., Ruffini, N., Manzotti, A., Lista, G.
Medicine (Baltimore), 2017/03
Free full text
2114

Rehabilitation treatment for chronic lower back pain: New evidence for old methods? A randomized, controlled experimental trial
Rigoni, S., Scapin, M.
Minerva Ortopedica e Traumatologica, 2017/03
2115

Osteopathy for primary headache patients: a systematic review
Cerritelli, F., Lacorte, E., Ruffini, N., Vanacore, N.
Journal of Pain Research, 2017/03
Free full text
2116

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03
2117

Osteopathic manipulation as a complementary approach to Parkinson's disease: A controlled pilot study
Difrancisco-Donoghue, J., Apoznanski, T., De Vries, K., Jung, M. K., Mancini, J., Yao, S.
NeuroRehabilitation, 2017/03
2118

Response to the Editorial “The enigmatic case of cranial osteopathy: Evidence vs clinical practice”
Monro, M., Farwell, S., Downes, W., Wilson, M., Carter, P. V.l, Douglas-Mort, D., Möckel, E., Zwierzchowska, Z., Apeztegia, J.
International Journal of Osteopathic Medicine, 2017/03
2119

Effects of a short-term osteopathic intervention on vertical jump and reach height in female recreational overhead athletes : a cross-over design
Green, T. C.
Unpublished MSc thesis, 2017/03
Free full text
2120

J Martin Littlejohn (1865–1947) and James Buchan Littlejohn (1868–1947): Two distinct directions – Osteopathy and the birth of osteopathic medicine
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2017/03
2121

Achtsamkeit und ihre Relevanz in der osteopathischen Praxis
(Mindfulness and its relevance to osteopathic practice)
Andrejcic, I.
Unpublished MSc thesis, 2017/03
Free full text
2122

Resilienz – Wie viel Stehaufmännchen steckt in den in Österreich arbeitenden OsteopathInnen?
(Resilience – How much stress can Austrian Osteopaths handle?)
Herz, K.
Unpublished MSc thesis, 2017/03
Free full text
2123

Osteopathie bei Schlafstörungen von Erwachsenen
(Osteopathic treatment on adults with sleep disturbances)
Litzlbauer, T.
Unpublished MSc thesis, 2017/03
Free full text
2124

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2125

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text
2126

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2127

Osteopathic treatment in a patient with left-ventricular assist device with left brachialgia: a case report
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Medical Case Reports Journal, 2017/02
Free full text
2128

Vom Aufhängeband zum Organ: neue Forschungsergebnisse zum Mesenterium
From the suspensory ligament to the organ: New findings on the mesentery
Plathner, M.
Osteopathische Medizin, 2017/02
2129

Motorische Entwicklung eines Säuglings: Idealbild und Abweichungen
(Motor development of an infant: Ideal and deviations)
Strunk, A.
Osteopathische Medizin, 2017/02
2130

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02
2131

Quiet dissent: The attitudes, beliefs and behaviours of UK osteopaths who reject low back pain guidance - A qualitative study
Figg-Latham, J., Rajendran, D.
Musculoskeletal Science and Practice, 2017/02
2132

Osteopathic manipulative treatment: A systematic review and critical appraisal of comparative effectiveness and health economics research
Steel, A., Sundberg, T., Reid, R., Ward, L., Bishop, F. L., Leach, M., Cramer, H., Wardle, J., Adams, J.
Musculoskeletal Science and Practice, 2017/02
2133

The strain - Counter strain technique in the management of anterior interosseous nerve syndrome: A case report
Goyal, M., Goyal, K., Narkeesh, K., Samuel, A. J., Sharma, S., Chatterjee, S.
Journal of Taibah University Medical Sciences, 2017/02
Free full text
2134

JAOA Peer Reviewers, 2016
listed, No authors
The Journal of the American Osteopathic Association, 2017/02
Free full text
2135

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2136

Do you hear me?: the caregivers' experience of osteopathy for their child’s otitis media
McCulloch, J.
Unpublished MSc thesis, 2017/02
Free full text
2137

Somatic Dysfunction in the Diagnosis of Uncommon Ectopic Pregnancies: Surgical Correlation and Comparison With Related Pathologic Findings
Martingano, D., Canepa, H., Fararooy, S., Rybitskiy, D., Shahem, S., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2017/02
Free full text
2138

Osteopathische Behandlung chronischer unspezifischer Nackenschmerzen
(Osteopathic treatment of chronic nonspecific neck pain)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2017/02
2139

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/
2140

Developing an integrated osteopathy and acceptance-informed pain management course for patients with persistent pain
Abbey, H. A.
Unpublished PhD thesis, 2017/01
Free full text
2141

Im Gespräch mit … Sandra Bartu
(In dialog with Sandra Bartu)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2142

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text
2143

Die venöse Sinustechnik – Drainage der venösen Blutleiter
(The venous sinus technique - drainage of venous blood vessels)
Percival, H., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2144

Évaluation de l’efficacité d’un traitement ostéopathique structurel chez des patients atteints de céphalées de tension
(Evaluation of the efficacy of structural osteopathic treatment in patients with tension-type headache)
Hug, A.
Unpublished MSc thesis, 2017/01
2145

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text
2146

CranioSacral Therapy and Visceral Manipulation: A New Treatment Intervention for Concussion Recovery
Wetzler, G., Roland, M., Fryer-Dietz, S., Dettmann-Ahern, D.
Medical Acupuncture, 2017/01
Free full text
2147

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text
2148

Osteopathic Manipulative Treatment Limits Chronic Constipation in a Child with Pitt-Hopkins Syndrome
Aquino, A., Perini, M., Cosmai, S., Zanon, S., Pisa, V., Castagna, C., Uberti, S.
Case Reports in Pediatrics, 2017/01
Free full text
2149

Integration of osteopathic manual treatments in management of cervical dystonia with tremor: A case series
Halimi, M., Leder, A., Mancini, J. D.
Tremor and Other Hyperkinetic Movements, 2017/01
Free full text
2150

Interprofessional Oral Health Education Improves Knowledge, Confidence, and Practice for Pediatric Healthcare Providers
Cooper, D.
Unpublished MSc thesis, 2017/01
Free full text
2151

Osteopathie und Psyche
(Osteopathy and Psyche)
Tschinkel, M.
Unpublished MSc thesis, 2017/01
Free full text
2152

The role of gentle touch in perinatal osteopathic manual therapy
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Neuroscience and Biobehavioral Reviews, 2017/01
2153

Knee Pain in Adults with an Osteopathic Component
Datta, R., Burina, L., Romanelli, F., Flaum, T. B.
Osteopathic Family Physician, 2017/01
Free full text
2154

The role of New Zealand osteopaths in the care of people who experience migraine: a qualitative exploration
Chaise, K.
Unpublished MSc thesis, 2017/01
Free full text
2155

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text
2156

Osteopathische Behandlung eines Descensus genitalis und dessen Begleitsymptome bei Frauen. Eine Vergleichsstudie von Osteopathie und Elektrostimulation/Biofeedback für den Beckenboden
(Osteopathic treatment of the genital descensus and its accompanying symptoms in women. A comparative study of osteopathy and electrostimulation / biofeedback for pelvic floor)
Bogner, D.
Unpublished MSc thesis, 2017/01
Free full text
2157

Der kurzfristige Effekt des General Osteopathic Treatment auf die Beweglichkeit bei jungen Frauen am Beispiel “Finger-Boden-Abstand“. Eine quasi randomisierte, einfach verblindete, experimentelle Studie
(The short-term effect of General Osteopathic Treatment (GOT) on the mobility of young women using the Finger-Floor-Distance test (FFD). A quasi-randomized, single blinded, experimental study)
Dutzler, R.
Unpublished MSc thesis, 2017/01
Free full text
2158

Effectiveness of Osteopathic Therapy in the Treatment of Oral Submucous Fibrosis
Goyal, M., Aggarwal, A., Goyal, K., Garg, P.
Contemporary Clinical Dentistry, 2017/01
Free full text
2159

Effektivität von Osteopathie bei Patienten mit Migräne - ein Systematic Review
(The Effectiveness of Osteopathy in Treating Patients Suffering from Migraine - a Systematic Review)
Michlits-Lichtenecker, D.
Unpublished MSc thesis, 2017/01
Free full text
2160

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2161

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2162

Der osteopathische Ansatz beim allergischen Patienten
(The osteopathic approach to allergic patients)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01
2163

Osteopathic Manipulative Treatment of Primary Dysmenorrhea and Related Factors: A Randomized Controlled Trial
Zecchillo, D., Acquati, A., Aquino, A., Pisa, V., Uberti, S., Ratti, S.
International Journal of Medical Research & Health Sciences, 2017
Free full text
2164

Osteopathische Behandlung des Reizdarmsyndroms – ein Review
(Osteopathic treatment of irritable bowel syndrome - A review)
Krüger, S.
Osteopathische Medizin, 2016/12
2165

A Review of Hypertension and Its Management by Osteopathic Manipulative Therapy
Miller, A. D.
The AAO Journal, 2016/12
2166

Assessment of Hospital Staff's Knowledge of Osteopathic Manipulative Medicine: A Survey-Based Study
Smith-Kelly, J. B., Cardenas, A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2167

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text
2168

What can osteopaths learn from concerns and complaints raised against them? A review of insurance and regulator reports
Carnes, D.
International Journal of Osteopathic Medicine, 2016/12
2169

Säuglinge mit frühkindlicher Regulationsstörung – eine Pilotstudie
(Infants with early childhood regulation disorder - A pilot study)
Wikus, P.
Osteopathische Medizin, 2016/12
2170

A snap-shot of attrition from the osteopathy profession in Australia
Fitzgerald, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/12
2171

Reliability of Diagnosis and Clinical Efficacy of Cranial Osteopathy: A Systematic Review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
PLoS One, 2016/12
Free full text
2172

Somatic dysfunction: An osteopathic conundrum
Fryer, G.
International Journal of Osteopathic Medicine, 2016/12
2173

A Survey of Disaster Medical Education in Osteopathic Medical School Curricula
Parrillo, S. J., Christensen, D., Teitelbaum, H. S., Glassman, E. S.
Prehospital and Disaster Medicine, 2016/12
Free full text
2174

Efficacy of an Osteopathic Treatment Coupled With Lactation Consultations for Infants' Biomechanical Sucking Difficulties
Herzhaft-Le Roy, J., Xhignesse, M., Gaboury, I.
Journal of Human Lactation, 2016/12
2175

Osteopathic Manipulative Treatment for Somatic Dysfunction After Acute Severe Traumatic Brain Injury
McCallister, A., Brown, C., Smith, M., Ettlinger, H., Baltazar, G. A.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2176

Effects of osteopathic manipulative treatment on hand function, disease symptoms and functional status in systemic sclerosis: a series of single-case studies in working women
O'Connor, S., Durand, M. J., Hudson, M., Baron, M., Gaudreault, N.
International Journal of Osteopathic Medicine, 2016/12
2177

Construção da Identidade profissional do osteopata
(Building the osteopath's professional identity)
Sousa, L. F. G.
Unpublished MSc thesis, 2016/12
Free full text
2178

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12
2179

Holism in Osteopathy – Bridging the gap between concept and practice: A grounded theory study
Turner, P. W. D., Holroyd, E.
International Journal of Osteopathic Medicine, 2016/12
2180

Alternative Scheduling Models: Improving Continuity of Care, Medical Outcomes, and Graduate Medical Education in Resident Ambulatory Training
Hussain, A. J.
The Journal of the American Osteopathic Association, 2016/12
Free full text
2181

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2182

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2183

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text
2184

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2185

The Predictive Validity of the National Board of Osteopathic Medical Examiners' COMLEX-USA Examinations With Regard to Outcomes on American Board of Family Medicine Examinations
O'Neill, T. R., Peabody, M. R., Song, H.
Academic Medicine, 2016/11
Free full text
2186

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: The PROMOTE Study Protocol
Hensel, K. L., Carnes, M. S., Stoll, S. T.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2187

PROMOTE Study: Safety of Osteopathic Manipulative Treatment During the Third Trimester by Labor and Delivery Outcomes
Hensel, K. L., Roane, B. M., Chaphekar, A. V., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2188

Effects of osteopathic treatment on pulmonary function and chronic thoracic pain after coronary artery bypass graft surgery (OstinCaRe): study protocol for a randomised controlled trial
Roncada, G.
BMC Complementary and Alternative Medicine, 2016/11
Free full text
2189

Vergleich der Effektivität einer osteopathischen mit einer ausschließlich craniosacralen Therapie bei Temporomandibulärer Dysfunktion – eine Pilotstudie
(Comparison of the effectiveness of osteopathic versus craniosacral treatment for temporomandibular dysfunction - a pilot study.)
Gesslbauer, C., Keilani, M., Nicolakis, P., Mickel, M., Vavti, N., Crevenna, R.
Physikalische Medizin, Rehabilitationsmedizin, Kurortmedizin, 2016/11
2190

Das Potential osteopathisch manipulativer Therapie Myofibroblastenaktivität zu beeinflussen
(The potential of osteopathic manipulative therapy in regulating myofibroblast activity)
Hofbauer, A.
Unpublished MSc thesis, 2016/11
Free full text
2191

How do the Number and the Duration Between Osteopathic Treatments Influence the Effect on Patients Suffering from Foot-Related Pain? A Dose-Response Study
Kaufmann, J., Larsen, S.
International Journal of Pharma and Bio Sciences, 2016/11
Free full text
2192

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text
2193

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2194

T4 syndrome – A distinct theoretical concept or elusive clinical entity? A case report
Hirai, P. M., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2016/10
2195

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2196

The biomechanical model in manual therapy: Is there an ongoing crisis or just the need to revise the underlying concept and application?
Lunghi, C., Tozzi, P., Fusco, G.
Journal of Bodywork and Movement Therapies, 2016/10
2197

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10
2198

Osteopathic manipulative treatment in neurological diseases: Systematic review of the literature
Cerritelli, F., Ruffini, N., Lacorte, E., Vanacore, N.
Journal of the Neurological Sciences, 2016/10
2199

Manual therapy and OMT may be of benefit in the management of somatosensory tinnitus
King, H. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2200

Osteopathie als zusätzliche Therapie bei Kindern mit akuten Lungenentzündungen in Kambodscha. - Eine randomisiert-kontrollierte Pilotstudie.
(Osteopathic Manipulative Therapy as Adjunctive Treatment on Hospitalized Children with Pneumonia in Cambodia. - A randomized-controlled Pilotstudy)
Orsini-Rosenberg, T.
Unpublished MSc thesis, 2016/10
Free full text
2201

A.T. Still’s osteopathic lesion theory and evidence-based models supporting the emerged concept of somatic dysfunction
Liem, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2202

Manual Therapy in the Treatment of Idiopathic Scoliosis. Analysis of Current Knowledge
Czaprowski, D.
Ortopedia, Traumatologia, Rehabilitacja, 2016/10
Free full text
2203

Die osteopathische Behandlung von Kindern mit idiopathischer Säuglingsasymmetrie im Vergleich zur physiotherapeutischen Behandlung. Randomisierte kontrollierte Studie.
(Osteopathic treatment compared to physiotherapy in infants with idiopathic postural asymmetry. A randomized controlled trial)
Lange, T., Kramer, U., Hasemann, B.
Unpublished D.O. thesis, 2016/10
2204

Untersuchung der Effektivität der osteopathischen Behandlung bei Patienten mit Hypercholesterinämie mit mäßig erhöhten Gesamtcholesterinwerten. Randomisierte kontrollierte Studie.
(Evaluation of effectiveness of osteopathic treatment in patients with moderate hypercholesterolemia. A randomized controlled trial)
Liedl, T., Pinter, K.
Unpublished D.O. thesis, 2016/10
2205

Osteopathische Behandlung von Patienten mit gastroösophagealer Refluxkrankheit (GÖR) additiv zur medikamentösen Standardtherapie. Randomisierte kontrollierte Studie.
(Osteopathic treatment in addition to usual care in patients with Gastroesophageal Reflux Disease (GERD). A randomized controlled trial)
Lynen, A., Schömitz, M., Vahle, M.
Unpublished D.O. thesis, 2016/10
2206

Die Entwicklung des Verständnisses von „Palpation“ in der historischen osteopathischen Literatur von A.T. Still, W.G. Sutherland und R. Becker. Literaturstudie.
(Development of understanding of “palpation” in historical osteopathic literature from A.T. Still, W.G. Sutherland and R. Becker. Literature review)
Sibbing, D.
Unpublished D.O. thesis, 2016/10
2207

Current clinical practices, experiences, and perspectives of healthcare practitioners who attend to dysfunctional breathing: A qualitative study
Shaw, J.
Unpublished MSc thesis, 2016/10
Free full text
2208

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2209

Correlation Between Standardize Patients' Perceptions of Osteopathic Medical Students and Students' Self-Rated Empathy
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2210

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text
2211

The use of critical reflection to foster reflective practice in student osteopaths
McLeod, G. A.
Unpublished PhD thesis, 2016/09
Free full text
2212

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09
2213

Osteopathische Imagination – ein Weg zur osteopathischen Selbstbehandlung
(Osteopathic Imagination - A way to osteopathic self-treatment)
Liedtke, H.
Osteopathische Medizin, 2016/09
2214

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text
2215

Die Regio inguinalis dextra aus osteopathischer Sicht
(The regio inguinalis dextra from an osteopathic point of view)
Kuschel, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2216

Spine Tango registry data collection in a conservative spinal service: a feasibility study
Morris, S., Booth, J., Hegarty, J.
European Spine Journal, 2016/09
2217

Nachruf auf Roger Seider
(Obituary for Roger Seider)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2218

The Attitudes of Physicians, Nurses, Physical Therapists, and Midwives Toward Complementary Medicine for Chronic Pain: A Survey at an Academic Hospital
Aveni, E., Bauer, B., Ramelet, A. S., Kottelat, Y., Decosterd, I., Finti, G., Ballabeni, P., Bonvin, E., Rodondi, P. Y.
Explore (NY), 2016/09
2219

Lumbalgie bei Uterusdeszensus
(Low back pain in uterine descent)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2220

Osteopathic Manipulative Therapy for Preterm Infants, Acupuncture for Menopausal Symptoms, Mindfulness-Based Stress Reduction for Chronic Low Back Pain, Chocolate for Ischemic Heart Disease, Berberine for Irritable Bowel Syndrome
Pettit, J., Glickman-Simon, R.
Explore (NY), 2016/09
2221

Die viszeralen Behandlungen des Andrew Taylor Still
(The visceral treatments of Andrew Taylor Still)
Marx, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2222

Osteopathie in Österreich – rechtliche Grundlage und Ausblick
(Osteopathy in Austria - Legal basis and outlook)
Mitschka, M., Wikus, P.
Osteopathische Medizin, 2016/09
2223

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2224

The Incidence of Somatic Dysfunction in Patients with Sudden Onset Atraumatic Neck Pain: A Retrospective Case Note Study
Snider, K. T., Ghouse, A., He, S. S., Pazdernik, V. K.
The AAO Journal, 2016/09
2225

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09
2226

Berufsgesetz Osteopathie
(Occupational law for osteopathy)
Newiger, C.
Osteopathische Medizin, 2016/09
2227

Integrative Behandlung der Nebennieren in der Osteopathie
(Integrative treatment of the adrenal glands in osteopathy)
Namer, V., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2228

Neurovaskuläre Mobilisation des Plexus hypogastricus inferior
(Neurovascular mobilization of the inferior hypogastric plexus)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2016/09
2229

Neue Ansätze für die Behandlung viszeraler Strukturen über den Schädel
(New approaches for the treatment of visceral structures via the skull)
Riedel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2230

Osteopathic Manipulative Treatment in Pediatric and Neonatal Patients and Disorders: Clinical Considerations and Updated Review of the Existing Literature
Bagagiolo, D., Didio, A., Sbarbaro, M., Priolo, C. G., Borro, T., Farina, D.
American Journal of Perinatology, 2016/09
2231

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09
2232

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09
2233

Einfluss osteopathischer Techniken auf das Lymph- und Immunsystem – eine systematische Übersichtsarbeit
(Influence of osteopathic techniques on the lymphatic and immune system - a systematic review)
Unger, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2234

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09
2235

Behandlung der viszeralen Gefäße aus osteopathischer Sicht
(Treatment of the visceral vessels from an osteopathic point of view)
Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09
2236

The effect of osteopathic intervention and corrective exercise on golf performance: a prospective case series
Miles, J. I. W.
Unpublished MSc thesis, 2016/09
Free full text
2237

Case report of osteopathic treatment of insomnia and traumatic anhidrosis
Nobles, T., Bach, A., Boesler, D.
International Journal of Osteopathic Medicine, 2016/09
2238

Factors affecting help-seeking behaviour of women with urinary incontinence; a commentary providing insights for osteopaths
Robinson, M., Humpage, C.
International Journal of Osteopathic Medicine, 2016/09
2239

The potential of osteopathic manipulative treatment in antimicrobial stewardship: A narrative review
Noll, D. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2240

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2241

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text
2242

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text
2243

Benefits of Craniosacral Therapy in Patients with Chronic Low Back Pain: A Randomized Controlled Trial
Castro-Sánchez, A. M., Lara-Palomo, I. C., Matarán-Peñarrocha, G. A., Saavedra-Hernández, M., Pérez-Mármol, J. M., Aguilar-Ferrándiz, M. E.
The Journal of Alternative and Complementary Medicine, 2016/08
2244

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text
2245

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text
2246

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text
2247

The effectiveness of complementary manual therapies for pregnancy-related back and pelvic pain A systematic review with meta-analysis
Hall, H., Cramer, H., Sundberg, T., Ward, L., Adams, J., Moore, C., Sibbritt, D., Lauche, R.
Medicine (Baltimore), 2016/08
Free full text
2248

The paradox of sham therapy and placebo effect in osteopathy: A systematic review
Cerritelli, F., Verzella, M., Cicchitti, L., D', Alessandro, G., Vanacore, N.
Medicine (Baltimore), 2016/08
Free full text
2249

Osteopathic Manual Treatment for Amyotrophic Lateral Sclerosis: A Feasibility Pilot Study
Maggiani, A., Tremolizzo, L., Della Valentina, A., Mapelli, L., Sosio, S., Milano, V., Bianchi, M., Badi, F., Lavazza, C., Grandini, M., Corna, G., Prometti, P., Lunetta, C., Riva, N., Ferri, A., Lanfranconi, F., Me, Study
The Open Neurology Journal, 2016/08
Free full text
2250

Nutrition Knowledge and Attitude Towards Nutrition Counseling Among Osteopathic Medical Students
Hargrove, E. J.
Unpublished MSc thesis, 2016/08
Free full text
2251

The effect of osteopathic manual therapy with breathing retraining on dysfunctional breathing and exercise economy: a randomised controlled trial
Barnett, L. E.
Unpublished MSc thesis, 2016/08
Free full text
2252

Health literacy screening of patients attending a student-led osteopathy clinic: A pilot investigation
Vaughan, B., Mulcahy, J., Fitzgerald, K.
Complementary Therapies in Clinical Practice, 2016/08
2253

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2254

Effects of an e-learning programme on osteopaths’ back pain attitudes: a mixed methods feasibility study
Draper-Rodi, J.
Unpublished PhD thesis, 2016/07
Free full text
2255

Psychoneuroimmunologie: eine osteopathische Annäherung
(Psychoneuroimmunology: an osteopathic approach)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2256

The tongue after whiplash: case report and osteopathic treatment
Bordoni, B., Marelli, F., Morabito, B.
International Medical Case Reports Journal, 2016/07
Free full text
2257

Naturheilkunde und Komplementarmedizin in medizinischen Leitlinien - konnen europaische Normen Leitlinien fur Naturheilkunde und Komplementarmedizin verdrangen?
(Naturopathy and Complementary Medicine in Medical Guidelines - Can European Standards Replace Guidelines for Naturopathy and Complementary Medicine?)
Jutte, R.
Forschende Komplementärmedizin, 2016/07
2258

Repeat-measures longitudinal study evaluating behavioural and gastrointestinal symptoms in children with autism before, during and after visceral osteopathic technique (VOT)
Bramati-Castellarin, I., Patel, V. B., Drysdale, I. P.
Journal of Bodywork and Movement Therapies, 2016/07
2259

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07
2260

Dynamik der Gedanken oder wenn das Denken den Rhythmus lähmt
(Dynamics of thinking or when thinking paralyzes rhythm)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2261

Im Gespräch mit … Kilian Dräger
(In dialog with Kilian Dräger)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2262

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text
2263

Osteopathic manipulative therapy is feasible and safe after abdominal surgery
King, H. H.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2264

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text
2265

Psyche und Hormonsystem – Dirigenten unseres Lebens
(Psyche and endocrine system - conductors of our life)
Vogt, E. S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2266

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2267

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text
2268

Management of Cesarean Deliveries and Cesarean Scars With Osteopathic Manipulative Treatment: A Brief Report
Martingano, D.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2269

Osteopathy in the cranial field - an investigation into patient perception, satisfaction and self-reported outcomes of a single treatment session
Judkins, R. M.
Unpublished MSc thesis, 2016/07
Free full text
2270

Osteopathic Approach to the Diagnosis of Appendiceal Mucinous Cystadenocarcinoma Mimicking Primary Ovarian Malignant Neoplasm
Martingano, D., Gurm, H., Oliff, A., Martingano, F. X., Aglialoro, G.
The Journal of the American Osteopathic Association, 2016/07
Free full text
2271

Pseudoischialgie bei Dysfunktion der Fibula
(Pseudo sciatica in dysfunction of the fibula)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
2272

Confirmatory factor analysis of the Study Process Questionnaire in an Australian osteopathy student population
Vaughan, Brett
International Journal of Osteopathic Medicine, 2016/06
2273

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06
2274

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text
2275

The use of osteopathic manipulative treatment as part of an integrated treatment for infantile colic:A case report
Snider, K. T.
The AAO Journal, 2016/06
2276

Osteopathische Initiative für Flüchtlinge
(Osteopathic initiative for refugees)
Prediger, G.
Osteopathische Medizin, 2016/06
2277

Red-Reflex-Test in der Osteopathie – eine systematische Literaturübersicht
(Red reflex test in osteopathy - A systematic literature review)
Rotter, G.
Osteopathische Medizin, 2016/06
2278

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06
2279

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text
2280

Osteopaths in the United Kingdom and Australia: Attitudes, practice, confidence and knowledge with regard to melanoma recognition – An observational questionnaire study
Jelineck, S., Bettles, S., Bright, P., Jäkel, A.
International Journal of Osteopathic Medicine, 2016/06
2281

Osteopatia e lombalgia
(Osteopathy and low back pain)
de Oliveira Meirelles, F.
Unpublished MSc thesis, 2016/06
Free full text
2282

Osteopathic manipulative treatment in gynecology and obstetrics: A systematic review
Ruffini, N., D'Alessandro, G., Cardinali, L., Frondaroli, F., Cerritelli, F.
Complementary Therapies in Clinical Practice, 2016/06
2283

Sensomotorische Entwicklung und pädiatrische Osteopathie
(Sensorimotor development and pediatric osteopathy)
Ava Levin, V., Levin, P.
Osteopathische Medizin, 2016/06
2284

Randomised controlled pilot trial on feasibility, safety and effectiveness of osteopathic MANipulative treatment following major abdominal surgery (OMANT pilot trial)
Probst, P., Büchler, E., Doerr-Harim, C., Knebel, P., Thiel, B., Ulrich, A., Diener, M. K.
International Journal of Osteopathic Medicine, 2016/06
2285

O desenvolvimento profissional do osteopata: Representações de profissionais em início decarreira
(The professional development of an osteopath: Representations of early-career professionals)
Pedro, J. C. F.
Unpublished MSc thesis, 2016/06
Free full text
2286

Osteopathische Behandlungstechnik für die Fascia clavipectoralis
(Osteopathic treatment techniques for fascia clavipectoralis)
Baumgart, V.
Osteopathische Medizin, 2016/06
2287

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06
2288

(Manual medicine and osteopathic methods on the growing spine)
Kayser, R., Harke, G.
Der Orthopäde, 2016/06
2289

Ergänzende Anmerkungen zum Artikel „Osteopathische Behandlungstechnik für die Fascia clavipectoralis”
(Supplementary notes on the article “Osteopathic treatment techniques for fascia clavipectoralis“)
Hartwig, B.
Osteopathische Medizin, 2016/06
2290

State of affairs of osteopathy in the Benelux: Benelux Osteosurvey 2013
van Dun, P. L. S., Nicolaie, M. A., Van Messem, A.
International Journal of Osteopathic Medicine, 2016/06
2291

Experiences of intervertebral motion palpation in osteopathic practice – A qualitative interview study among Swedish osteopaths
Sposato, N. S., Bjerså, K.
Journal of Bodywork and Movement Therapies, 2016/05
2292

Eye contact, appetite, and vomiting improved in children with autism spectrum disorder after visceral osteopathic technique
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2293

Significant Benefit Shown After Lumbar Disk Surgery Rehabilitation by Inclusion of Osteopathic Intervention
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2294

Postural Balance and Gait Improved With an Osteopathic Intervention in a Special Needs Population
King, H. H.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2295

Non-specific mechanisms in orthodox and CAM management of low back pain (MOCAM): theoretical framework and protocol for a prospective cohort study
Bradbury, K., Al-Abbadey, M., Carnes, D., Dimitrov, B. D., Eardley, S., Fawkes, C., Foster, J., Greville-Harris, M., Harvey, J. M., Leach, J., Lewith, G., MacPherson, H., Roberts, L., Parry, L., Yardley, L., Bishop, F. L.
BMJ Open, 2016/05
2296

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text
2297

An analysis of the effectiveness of a Midwest osteopathic medical school's pipeline programs: Graduation and GME match of URM and disadvantaged students
Rice, M. J.
Unpublished Dissertation, 2016/05
2298

Osteopathic considerations in obstructive pulmonary disease: A systematic review of the evidence
Raguckas, C., Ference, J., Gross, G. A.
Osteopathic Family Physician, 2016/05
Free full text
2299

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2300

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2301

ENGAGE Initiative: Showcasing Osteopathic Scholarly Activity
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/05
Free full text
2302

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2303

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2304

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2305

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2306

The patient experience of osteopathic healthcare
Orrock, P. J.
Manual Therapy, 2016/04
2307

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2308

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2309

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2310

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text
2311

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03
2312

Osteopathy – a complex business
Vogel, S.
International Journal of Osteopathic Medicine, 2016/03
2313

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2314

Somatic Dysfunction: A Principled Approach to Diagnosis and the Selection of OMT Modalities
Hruby, R. J.
The AAO Journal, 2016/03
2315

„Pädiatrie und Osteopathie” – Kongress der OSD im November 2015
(“Pediatrics and Osteopathy“ - OSD Congress in November 2015)
Bäumer, C. J.
Osteopathische Medizin, 2016/03
2316

Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms? Eine Pilotstudie
(Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome? A Pilot Study)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
2317

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Pädiatrische Praxis, 2016/03
2318

Pilotstudie: Reduziert die Osteopathische Behandlung die Dauer des Neonatalen Abstinenzsyndroms?
(Pilot study: Does an osteopathic treatment reduce the duration of the neonatal abstinence syndrome?)
Sander, K.
Unpublished MSc thesis, 2016/03
Free full text
2319

The Use of Osteopathic Manipulative Treatment for Acute Dental Pain: A Case Report
Snider, K. T.
The AAO Journal, 2016/03
2320

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text
2321

Im Gespräch mit ... Martina Seidler
(In dialog with Martina Seidler)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2322

Resolution of Concussion Symptoms After Osteopathic Manipulative Treatment: A Case Report
Guernsey, D. T., Leder, A., Yao, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2323

20. Europäisches Symposium der Traditionellen Osteopathie
(The 20th European Symposium of Traditional Osteopathy)
Pauler, A.
Osteopathische Medizin, 2016/03
2324

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2325

Hörsturz bei einem Kind nach Beginn einer kieferorthopädischen Behandlung
(Hearing loss in a child after start of an orthodontic treatment)
Refle, S.
Osteopathische Medizin, 2016/03
2326

Groß- und Minderwuchs in der osteopathischen Praxis
(Large and small stature in osteopathic practice)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2327

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2328

Knowing hands converse with an expressive body - An experience of osteopathic touch
Consedine, S., Standen, C., Niven, E.
International Journal of Osteopathic Medicine, 2016/03
2329

Evaluation of an interprofessional team-based learning nutrition and lifestyle modification course
Pogge, E.
Journal of Interprofessional Care, 2016/03
2330

Craniomandibuläre Dysfunktion. Welchen Stellenwert hat Osteopathie in der interdisziplinären Behandlung von Patienten mit craniomandibulärer Dysfunktion (CMD) in Bezug auf Lebensqualität?
(What influence on quality of life does osteopathy have in interdisciplinary treatment of patients suffering from temporomandibular disorder?)
Schmidt, N.
Unpublished MSc thesis, 2016/03
Free full text
2331

Letter to the Editor Regarding “A global view of osteopathy – Mirror or echo chamber”
King, H. H.
International Journal of Osteopathic Medicine, 2016/03
2332

Targeting Patient Subgroups With Chronic Low Back Pain for Osteopathic Manipulative Treatment: Responder Analyses From a Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2333

Die Veränderung der venösen Wiederauffüllzeit bei Patientinnen und Patienten mit Chronisch-venöser Insuffizienz nach osteopathischer Intervention
(Changes of Venous Refill Time in Male and Female Patients with Chronic Venous Insufficiency after Osteopathic Intervention)
Pink, S.
Unpublished MSc thesis, 2016/03
Free full text
2334

Recovery From Chronic Low Back Pain After Osteopathic Manipulative Treatment: A Randomized Controlled Trial
Licciardone, J. C., Gatchel, R. J., Aryal, S.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2335

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text
2336

Die Beeinflussung der Kapazität der Vena portae durch eine Mobilisierung der Leber gemessen mit Doppler-Ultraschall
(Influence of osteopathic treatment on the capacity of the portal vein through a mobilisation of liver measured by Doppler ultrasonography)
Maier, M.
Unpublished MSc thesis, 2016/03
Free full text
2337

Osteopathie bei Infantiler Cerebralparese
(Osteopathy for Infant Cerebral Palsy)
Budroni, J.
Unpublished MSc thesis, 2016/03
Free full text
2338

Resolution of New Daily Persistent Headache After Osteopathic Manipulative Treatment
Alexander, J.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2339

Constipation: A review with osteopathic consideration
Cole, S., Moore, C., Shah, P.
Osteopathic Family Physician, 2016/03
2340

Auswirkungen von frühkindlichem Stress auf das neuroendokrine System und Immunsystem
(Effects of early childhood stress on the neuroendocrine system and immune system)
Carter, P. V.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2341

Schlafstörungen und Epiphyse
(Sleep disorders and pineal gland)
Clostermann, A.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03
2342

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03
2343

Klinische Effektivität einer osteopathischen Behandlung bei Migräne
(Clinical effectiveness of osteopathic treatment for migraines)
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Osteopathische Medizin, 2016/03
2344

Osteopathic approach to chronic constipation in Prader–Willi Syndrome: A case report
Smith, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2016/03
2345

Concussions and Osteopathic Manipulative Treatment: An Adolescent Case Presentation
Castillo, I., Wolf, K., Rakowsky, A.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2346

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2347

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text
2348

Abdominal Trigger Points and Psychological Function
Reeves, R. R., Ladner, M. E.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2349

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2350

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02
2351

Osteopathic educators' attitudes towards osteopathic principles and their application in clinical practice: A qualitative inquiry
Kasiri-Martino, H., Bright, P.
Manual Therapy, 2016/02
2352

Single Accreditation System for Graduate Medical Education: An Opportunity for Lesbian, Gay, Bisexual, and Transgender Health Education Integration in Osteopathic Medicine
Lapinski, J., Diaz, K. M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2353

Osteopathic Physicians on the Editorial Boards of Major Medical Journals Over the Past 30 Years
Ashurst, J. V., Galuska, M.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2354

Burnout Among Osteopathic Residents: A Cross-sectional Analysis
Chan, A. M., Cuevas, S. T., Jenkins, J.
The Journal of the American Osteopathic Association, 2016/02
Free full text
2355

Use of complementary and alternative medicine (CAM) by parents in their children and adolescents with epilepsy - Prevelance, predictors and parents' assessment
Hartmann, N., Neininger, M. P., Bernhard, M. K., Syrbe, S., Nickel, P., Merkenschlager, A., Kiess, W., Bertsche, T., Bertsche, A.
European Journal of Paediatric Neurology, 2016/01
2356

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2357

Altersbedingte Veränderungen des Herz-Kreislauf-Systems
(Age-related changes in the cardiovascular system)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2358

Osteopathic Students' Graduate Medical Education Aspirations Versus Realities: The Relationship of Osteopathic Medicine and Primary Care
Cummings, M.
Academic Medicine, 2016/01
Free full text
2359

Im Gespräch mit … Nicette Sergueef
(In dialog with Nicette Sergueef)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2360

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2361

Prevalence and characteristics of women who consult with osteopathic practitioners during pregnancy; a report from the Australian Longitudinal Study on Women's Health (ALSWH)
Frawley, J., Sundberg, T., Steel, A., Sibbritt, D., Broom, A., Adams, J.
Journal of Bodywork and Movement Therapies, 2016/01
2362

Lumbosakrale Schmerzen und Miktionsbeschwerden bei benignem Prostatasyndrom (BPS)
(Lumbosacral pain and micturition symptoms in benign prostatic hyperplasia (BPH))
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2363

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2364

General Movements in preterm infants undergoing craniosacral therapy: a randomised controlled pilot-trial
Raith, W., Marschik, P. B., Sommer, C., Maurer-Fellbaum, U., Amhofer, C., Avian, A., Lowenstein, E., Soral, S., Muller, W., Einspieler, C., Urlesberger, B.
BMC Complementary and Alternative Medicine, 2016/01
Free full text
2365

As the Twig Is Bent, so Grows the Tree-Part 6: In a Multicenter Study, OMTh Shortens Length of Stay in the Neonatal Intensive Care Unit
King, H. H.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2366

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text
2367

Muscle energy technique improves chronic lateral epicondylitis
Koh, C., III, Seffinger
The Journal of the American Osteopathic Association, 2016/01
Free full text
2368

An indication of current views of Australian general practitioners towards chiropractic and osteopathy: a cross-sectional study
Engel, R. M., Beirman, R., Grace, S.
Chiropractic & Manual Therapies, 2016/01
Free full text
2369

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01
2370

Management of Acute Isolated Soleal Vein Thrombosis in a Pregnant Patient With an Osteopathic Approach to Evaluation
Martingano, D., Eisenberg, J., Aglialoro, G. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2371

The acute effects of a standardised osteopathic manual therapy protocol on the vertical jump and reach performance in healthy basketball players: a cross-over design
Hall, J.
Unpublished MSc thesis, 2016/01
Free full text
2372

An osteopathic approach to the treatment of ovarian cancer
Martingano, D., Cannon, M., Williams, S., Stoner, A.
Osteopathic Family Physician, 2016/01
Free full text
2373

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2374

A formação em osteopatia na Europa: unidade ou diversidade? Os casos da Bélgica, França, Inglaterra e Portugal.
(Osteopathic training in Europe: unity or diversity? The cases of Belgium, France, England and Portugal)
Raimundo, I. S. P.
Unpublished MSc thesis, 2016/01
2375

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2376

Multicenter Osteopathic Pneumonia Study in the Elderly: Subgroup Analysis on Hospital Length of Stay, Ventilator-Dependent Respiratory Failure Rate, and In-hospital Mortality Rate
Noll, D. R., Degenhardt, B. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2377

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text
2378

Osteopathie – eine kurze Einführung. Grundlagen und geschichtlicher Überblick
(Osteopathy - A short review. Principles and history)
Luthin, D.
Gynakologische Praxis, 2016
2379

Review über die osteopathische Behandlung bei obstruktiven Lungenerkrankungen – eine systematische Literaturrecherche
(OMT for obstructice pulmonary diseases – a systematic review)
Schäfer, M.
unpublished D.O. thesis, 2016
Free full text
2380

Arguments for and against movement at the spheno-occipital synostosis: Furthering the debate
Starkey, R.
International Journal of Osteopathic Medicine, 2015/6
2381

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text
2382

Rising to New Challenges: Problems and Proposed Solutions for Osteopathic Program Directors
Goldmann, S. I.
The AAO Journal, 2015/12
2383

Effect of Select Osteopathic Manipulative Treatment Techniques on Patients With Acute Rhinosinusitis
Nishida, Y., Sopchak, M. M., Jackson, M. R., Andersonning, T. R., Leikert, E. P., Goldman, S. I., Jarski, R. W.
The AAO Journal, 2015/12
2384

Cranial and Fascial Distortion Techniques Used as Complementary Treatments to Alleviate Migraine Headache: A Case Report
Ribar, J. S., Capistrant, T. A.
The AAO Journal, 2015/12
2385

Das Urteil des Oberlandesgerichts Düsseldorf vom 8. September 2015
(The decision of the Higher Regional Court Düsseldorf dated September 8, 2015)
Newiger, C.
Osteopathische Medizin, 2015/12
2386

15 Jahre Osteopathische Medizin: ein Interview mit den Gründungsherausgebern
(15 years of Osteopathische Medizin: An interview with the founding editors)
Newiger, C.
Osteopathische Medizin, 2015/12
2387

The Educational Model of Private Colleges of Osteopathic Medicine: Revisited for 2003-2013
Cummings, M.
Academic Medicine, 2015/12
Free full text
2388

Vascular Dynamics – ein osteopathischer Behandlungsansatz
(Vascular Dynamics - An osteopathic treatment approach)
Vogt, R.
Osteopathische Medizin, 2015/12
2389

Osteopathic manipulative treatment for chronic nonspecific neck pain: A systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
International Journal of Osteopathic Medicine, 2015/12
2390

Hat eine osteopathische Technik am Ganglion Stellatum eine Auswirkung auf das autonome Nervensystem gemessen an Herz- und Atemfrequenz an gesunden Individuen?
(Does an osteopathic technique on the stellate ganglion have an influence on the autonomic nervous system measured on heart rate and respiratory rate in healthy subjects?)
Hildebrand, E.
Unpublished MSc thesis, 2015/12
Free full text
2391

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text
2392

Top 5 largest osteopathic medical schools. Ranked by total active enrollment for the 2014-15 school year
listed, No authors
Modern Healthcare, 2015/12
2393

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text
2394

Intra-oral osteopathic technique for chronic temporomandibular disorders
Frederikson, H.
Unpublished MSc thesis, 2015/12
Free full text
2395

Osteopathic treatment for unsettled, fussy and irritable infants in their first year of life: mothers’ experiences and effect on infant temperament
Covich, O. A.
Unpublished MSc thesis, 2015/12
Free full text
2396

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12
2397

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text
2398

Geschichte der konservativen Wirbelsaulentherapie.
[History of conservative spinal therapy]
Kladny, B.
Der Unfallchirurg, 2015/12
2399

Kommentar zum Artikel „Craniomandibuläre Dysfunktion: Bedeutung der Körperhaltung bei Okklusionstests”
(Comment on the article “Craniomandibular dysfunction: Importance of body position in occlusion tests“)
Hartwig, B.
Osteopathische Medizin, 2015/12
2400

Objectivation de l'équilibre en stabilité debout et lors du cycle de marche chez le sujet âgé autonome chuteur: apport de l'Ostéopathie
(Objectification of balance stability when standing and walking among elderly fallers: contribution of Osteopathy)
Huard, Y.
Unpublished PhD thesis, 2015/11
Free full text
2401

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2402

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11
2403

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2404

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2405

How the distinctive cultures of osteopathic and allopathic medical schools affect the careers, perceptions, and institutional efforts of their anatomy faculties: A qualitative case study of two schools
Brokaw, J. J., Byram, J. N., Traser, C. J., Arbor, T. C.
Anatomical Sciences Education, 2015/11
2406

A Preliminary Comparison of Laryngeal Manipulation and Postural Treatment on Voice Quality in a Prospective Randomized Crossover Study
Kennard, E. J., Lieberman, J., Saaid, A., Rolfe, K. J.
Journal of Voice, 2015/11
2407

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11
2408

Adverse Events Due to Chiropractic and Other Manual Therapies for Infants and Children: A Review of the Literature
Todd, A. J., Carroll, M. T., Robinson, A., Mitchell, E. K. L.
Journal of Manipulative and Physiological Therapeutics, 2015/11
2409

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2410

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text
2411

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text
2412

Job Satisfaction and Affective Commitment of Osteopathic Medical School Clinical Faculty
Yurvati, A. H.
Unpublished PhD thesis, 2015/11
2413

Patients' expectations of osteopathic care: a qualitative study
Cross, V., Leach, C. M., Fawkes, C. A., Moore, A. P.
Health Expectations, 2015/10
Free full text
2414

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text
2415

Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being)
Fahlgren, E., Nima, A. A., Archer, T., Garcia, D.
PeerJ, 2015/10
Free full text
2416

Look but ... please don't touch!
De-Giorgio, F., Panarella, L., Miscusi, M., d', Aloja, E., Spagnolo, A. G., Pascali, V. L., Vetrugno, G.
Medicine, Science and the Law, 2015/10
Free full text
2417

Antwort von Prof. Fuessl.
[Reply from Prof. Fuessl]
MMW - Fortschritte der Medizin, 2015/10
2418

Fibromyalgiesyndrom. Die Patienten fordern Osteopathie
(Fibromyalgia syndrome. Patients request osteopathy)
Zehnle, S.
MMW - Fortschritte der Medizin, 2015/10
2419

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text
2420

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text
2421

Kann eine osteopathische Behandlung den Geburtsverlauf bei der protrahierten Geburt beeinflussen? Klinische Studie
(Does osteopathic treatment influence birth process in cases of prolonged labor or failure to progress in labor? Clinical trial)
Forster, B., Jusek, A.
Unpublished D.O. thesis, 2015/10
2422

(Osteopathic treatment in patients with age-related macular degeneration. Pre-post study)
Ihlow, D.
Unpublished D.O. thesis, 2015/10
2423

Intratester-Reliabilität des viszeralen Tensionstests nach Helsmoortel et al. (2002). Reliabilitätsstudie.
(Intra-observer reliability of the visceral tension test developed by Helsmoortel et al. (2002). Reliability study)
Verbaarschot, A.
Unpublished D.O. thesis, 2015/10
2424

Systematische Übersichtsarbeit über die Bewegungen des Herzens in der Mobilität und in der Motilität. Systematischer Review
(Heart motion and motility. Systematic review)
Will, T.
Unpublished D.O. thesis, 2015/10
2425

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10
2426

Interrater-Reliabilität von osteopathischen Befunden am Beispiel der Zwerchfelluntersuchung
(Interrater reliability of osteopathic findings using the example of diaphragmatic examination.)
Körner, J., Porthun, J., Woisetschläger, G.
Osteopathische Medizin, 2015/09
2427

Larson Syndrome of Dysautonomia in Parkinson Disease Managed With Osteopathic Manipulative Treatment: A Case Report
Durrani, M., Mancini, J. D., Flaum, T. B.
The AAO Journal, 2015/09
2428

Embodied Clinical Decision-making in Osteopathic Manipulative Medicine
Esteves, J. E.
The AAO Journal, 2015/09
2429

Perceived teaching quality between near-peer and academic tutors in an osteopathic practical skills class
Vaughan, B., Macfarlane, C.
International Journal of Osteopathic Medicine, 2015/09
2430

Osteopathische Universität – ein Entwurf
(Osteopathic University - a concept)
Levin, P.
Osteopathische Medizin, 2015/09
2431

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2432

Das Rätsel der böhmischen Heiler in der Geschichte der manuellen Therapien
(The enigma of the Czech healers in the history of manual therapies)
Mildenberger, F. G.
Osteopathische Medizin, 2015/09
2433

Implementing the Single Accreditation System for Graduate Medical Education: Seeking Osteopathic Recognition
Shannon, S. C.
The AAO Journal, 2015/09
2434

Rolle der Empathie in der Osteopathie – eine qualitative Studie
(Role of empathy in osteopathy - a qualitative study)
Müller-Steffens, C., Wikus, P.
Osteopathische Medizin, 2015/09
2435

Dysfunction in a Patient With Acute Knee Pain and Osteoarthritis: A Case Report
T., Snider. K.
The AAO Journal, 2015/09
2436

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09
2437

Im Gespräch mit … Dion Kulak
(In dialog with Dion Kulak)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2438

Inhärente Rhythmen – komplexe psychophysische Synergismen durch Synchronisation
(Inherent rhythms - Complex psychophysical synergisms through synchronization.)
Pelz, H.
Osteopathische Medizin, 2015/09
2439

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text
2440

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text
2441

Testung der Interrater-Reliabilität osteopathischer Befundergebnisse bei Untersuchung des abdominalen Diaphragmas ohne Vorgabe der Testdurchführung.
(Testing the interrater reliability of osteopathic findings in the examination of the abdominal diaphragm without specification of test implementation)
Körner, J.
Unpublished MSc thesis, 2015/09
Free full text
2442

L'osteopathie a 1'epreuve de l'Evidence-Based Medicine.
[Osteopathy and Evidence-Based Medicine]
Dugailly, P. M.
Revue Medicale de Bruxelles, 2015/09
2443

Die osteopathische Behandlung akuter Atemwegserkrankungen im Krankenhaus von Haifa
(The osteopathic treatment of acute respiratory diseases in a hospital in Haifa, Israel)
Waldman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2444

Letter to the Editor concerning “A Global View of Osteopathic Practice – Mirror or echo chamber?”
Kerr, J.
International Journal of Osteopathic Medicine, 2015/09
2445

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09
2446

Management of mood disorders by osteopaths in New Zealand: A survey of current clinical practice
Kovanur Sampath, K., Roy, D. E.
International Journal of Osteopathic Medicine, 2015/09
2447

Integration of ultrasonography course in the students' curriculum. Is it always useful?
Garnier, H., Wisniewski, J.
Clinical Anatomy, 2015/09
2448

Interventions for preventing and treating low-back and pelvic pain during pregnancy
Liddle, S. D., Pennick, V.
Cochrane Database of Systematic Reviews, 2015/09
Free full text
2449

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text
2450

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2451

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09
2452

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text
2453

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
2454

Basic Mechanisms of Osteopathic Manipulative Treatment: A Must Read
Patterson, M. M.
The Journal of the American Osteopathic Association, 2015/09
Free full text
2455

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2456

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text
2457

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2458

Colic in infants
Lucassen, P.
BMJ Clinical Evidence, 2015/08
Free full text
2459

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2460

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2461

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text
2462

Im Gespräch mit … Jane Eliza Stark
(In dialog with Jane Eliza Stark)
Höppner, J.P., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2463

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text
2464

Numbers of MD and DO Graduates in Graduate Medical Education Programs Accredited by the Accreditation Council for Graduate Medical Education and the American Osteopathic Association
Jolly, P., Lischka, T., Sondheimer, H.
Academic Medicine, 2015/07
Free full text
2465

Effects of Osteopathic Manipulative Treatment on Diabetic Gastroparesis
Van Ravenswaay, V. J., Hain, S. J., Grasso, S., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2015/07
Free full text
2466

Osteopathische Behandlung bei Patienten mit essenzieller Hypertonie
(Osteopathic treatment in patients with essential hypertension)
Pfeifer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2467

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text
2468

Die Bedeutung der Flüssigkeitsdynamik innerhalb des primären Atemmechanismus
(The importance of fluid dynamics within the primary respiratory mechanism)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2469

A unifying neuro-fasciagenic model of somatic dysfunction – Underlying mechanisms and treatment – Part II
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2015/07
2470

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text
2471

Assessing the immediate effect of osteopathic manipulation on sports related concussion symptoms
Chappell, C., Dodge, E., Dogbey, G. Y.
Osteopathic Family Physician, 2015/07
Free full text
2472

Lass die Natur ihre Arbeit machen
(Let nature do its job)
Deslee, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2473

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2474

Das vaskuläre System als Hilfe für eine präzise anatomische Palpation
(The vascular system as an aid for precise anatomical palpation)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2475

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
2476

Zwischen Traditionalisten und Reformern: Littlejohns Konzept der Anpassung
(Between traditionalists and reformers: Little Johns concept of adaptation)
Liem, T.
Osteopathische Medizin, 2015/06/01/
2477

Role of Osteopathic Manipulative Treatment in a Dynamic Case of Parkinson Disease and Levodopa-Induced Dyskinesia: A Case Report
Apoznanski, T. E., Flaum, T. B.
The AAO Journal, 2015/06
2478

Einfluss zirkadianer Rhythmik auf den Kurzzeiteffekt eines myofaszialen Release des Zwerchfells hinsichtlich vagaler Modulation der Herzratenvariabilität
(Influence of circadian rhythmicity on the short-term effect of a myofascial release of the diaphragm with respect to vagal modulation of heart rate variability)
Hofer, U.
Unpublished MSc thesis, 2015/06
Free full text
2479

Role of osteopathic manipulative treatment in the management of stiff person syndrome
Rajaii, R. M., Cox, G. J., Schneider, R. P.
The Journal of the American Osteopathic Association, 2015/06
Free full text
2480

Effects of the Fourth Ventricle Compression in the Regulation of the Autonomic Nervous System: A Randomized Control Trial
Cardoso-de-Mello-e-Mello-Ribeiro, A. P., Rodríguez-Blanco, C., Riquelme-Agulló, I., Heredia-Rizo, A. M., Ricard, F., Oliva-Pascual-Vaca, Á.
Evidence-Based Complementary and Alternative Medicine, 2015/06
Free full text
2481

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text
2482

Osteopathic Manipulative Treatmentfor Patient With Severe Nausea and Vomiting in Pregnancy: A Case Study
Markelz, K. A., Blumer, J. U.
The AAO Journal, 2015/06
2483

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
2484

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text
2485

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06
2486

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06
2487

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06
2488

Learning Environment, Preparedness and Satisfaction in Osteopathy in Europe: The PreSS Study
Luciani, E., van Dun, P. L., Esteves, J. E., Lunghi, C., Petracca, M., Papa, L., Merdy, O., Jakel, A., Cerritelli, F.
PLoS One, 2015/06
Free full text
2489

The effect of osteopathic manipulative treatment on length of stay in posterolateral postthoracotomy patients: A retrospective case note study
Fleming, R. K., Snider, K. T., Blanke, K. J., Johnson, J. C.
International Journal of Osteopathic Medicine, 2015/06
2490

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text
2491

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06
2492

Kraniosakrální terapie
(CranioSacral Therapy)
Klimešová, M.
Unpublished MSc thesis, 2015/06
Free full text
2493

The effect of the osteopathic thoracic lymphatic pump technique on salivary secretory immunoglobulin A levels in adults with recurrent upper respiratory tract complaints
Blut, D. P. F.
Unpublished MSc thesis, 2015/06
2494

Osteopathic manipulative treatment for an unusual presentation of fibromyalgia: A case report demonstrating the effectiveness of disease guidelines
Paul, L., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2015/06
2495

Allied Health practitioners' role in the Chronic Disease Management program: The experience of osteopathic practitioners
Orrock, P. J., Lasham, K., Ward, C.
International Journal of Osteopathic Medicine, 2015/06
2496

Osteopathie als alternative Therapie bei Reizmagen – eine Pilotstudie
(Osteopathy as an alternative therapy for dyspepsia - A pilot study)
Elsing, C.
Osteopathische Medizin, 2015/06
2497

Einfluss einer Behandlung der lateralen Ventrikel auf die Hirnaktivität – eine Pilotstudie
(Influence of a treatment of the lateral ventricle on brain activity - A pilot study)
Fröhlich, B.
Osteopathische Medizin, 2015/06
2498

Durchblick trotz Wolke: Verwaltung von osteopathischen Praxen per Software
(Perspective in spite of the cloud: Management of osteopathic practices per software)
Hartlep, M.
Osteopathische Medizin, 2015/06
2499

Impact of osteopathic manipulative therapy on quality of life of patients with deep infiltrating endometriosis with colorectal involvement: results of a pilot study
Darai, C., Deboute, O., Zacharopoulou, C., Laas, E., Canlorbe, G., Belghiti, J., Zilberman, S., Ballester, M., Darai, E.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2015/05
2500

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2501

High-velocity thrust to the atlantoaxial joint does not increase mechanical stress on the vertebral artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2502

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05
2503

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2504

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2505

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text
2506

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05
2507

A multicenter, randomized, controlled trial of osteopathic manipulative treatment on preterms
Cerritelli, F., Pizzolorusso, G., Renzetti, C., Cozzolino, V., D'Orazio, M., Lupacchini, M., Marinelli, B., Accorsi, A., Lucci, C., Lancellotti, J., Ballabio, S., Castelli, C., Molteni, D., Besana, R., Tubaldi, L., Perri, F. P., Fusilli, P., D'Incecco, C., Barlafante, G.
PLoS One, 2015/05
Free full text
2508

Kritische Betrachtung einer Besprechung
(Critical consideration of a critique)
Franke, H., Franke, J.D., Fryer, G.
Manuelle Medizin, 2015/05
2509

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text
2510

The impact of MD and DO attitudes and beliefs on their willingness to collaborate clinically with chiropractors
McGregor, D. M.
Unpublished PhD thesis, 2015/05
2511

Effects of osteopathic manipulative treatment on the inflammatory mediators related to asthma
Ragland, C. E.
Unpublished MSc thesis, 2015/05
2512

The meaning of fascia in a changing society
Adstrum, N. S.
Unpublished PhD thesis, 2015/04
2513

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2514

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2515

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2516

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2517

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2518

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2519

President's message
Morrone, W.
Journal of Addictive Diseases, 2015/04
2520

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2521

Im Gespräch mit … Henry Kleßen
(In dialog with Henry Kleßen)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2522

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2523

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2524

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04
2525

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2526

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2527

Can osteopathic manipulative treatment modify the posture in elderly people? – A single-case study
Pellerin, F., Papin-Richard, E., Guihéneuc, P., Niel, S., Guihard, G.
Journal of Bodywork and Movement Therapies, 2015/04
2528

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2529

Developing a clinical teaching quality questionnaire for use in a university osteopathic pre-registration teaching program
Vaughan, B.
BMC Medical Education, 2015/04
Free full text
2530

Does visceral osteopathic treatment accelerate meconium passage in very low birth weight infants?- A prospective randomized controlled trial
Haiden, N., Pimpel, B., Kreissl, A., Jilma, B., Berger, A.
PLoS One, 2015/04
Free full text
2531

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2532

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2533

„Meine Mitte ist verschoben!“
(“My center is shifted!“)
Weese, P.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2534

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text
2535

Wahrnehmungsstörungen bei Grundschulkindern durch Störungen des hochzervikalen Bereichs
(Perception disorders in elementary school children due to disorders of the high cervical area)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04
2536

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2537

An exploration of the changes in signs and symptoms associated with sleep bruxism that follow osteopathic manual therapy: a pilot study
Messersmith, L.
Unpublished MSc thesis, 2015/04
Free full text
2538

Clinical effectiveness of osteopathic treatment in chronic migraine: 3-Armed randomized controlled trial
Cerritelli, F., Ginevri, L., Messi, G., Caprari, E., Di Vincenzo, M., Renzetti, C., Cozzolino, V., Barlafante, G., Foschi, N., Provinciali, L.
Complementary Therapies in Medicine, 2015/04
2539

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2540

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2541

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2542

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2543

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text
2544

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2545

Osteopathische Behandlung der Entrapmentneuropathie des Nervus axillaris
(Osteopathic treatment of entrapment neuropathy of the axillary nerve)
Lefelmann, A.K.
Osteopathische Medizin, 2015/03
2546

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text
2547

Day-to-day practice of osteopaths using osteopathy in the cranial field, who are affiliated with the Sutherland Cranial College of Osteopathy (SCCO): A national survey by means of a standardised data collection tool
Wilkinson, J., Thomas, K. J., Freeman, J. V., McKenna, B.
International Journal of Osteopathic Medicine, 2015/03
2548

Chiropraktik in der Bundesrepublik Deutschland von 1949 bis 1975
(Chiropractic in the Federal Republic of Germany from 1949 to 1975)
Mildenberger, F. G.
Osteopathische Medizin, 2015/03
2549

19. Europäisches Symposium der traditionellen Osteopathie
(The 19th European Symposium of Traditional Osteopathy)
Müller, F.
Osteopathische Medizin, 2015/03
2550

Application of osteopathic manipulative technique in the treatment of back pain during pregnancy
Majchrzycki, M., Wolski, H., Seremak-Mrozikiewicz, A., Lipiec, J., Marszalek, S., Mrozikiewicz, P. M., Klejewski, A., Lisinski, P.
Ginekologia Polska, 2015/03
2551

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text
2552

Adapting and feasibility testing pre-registration e-learning resources for Professionalism in Osteopathy in the UK
Browne, F., Rolfe, K., Currie, A., Walker, T., Roff, S.
International Journal of Osteopathic Medicine, 2015/03
2553

The accuracy of osteopathic manipulations of the lumbar Spine: A Pilot study
Frantzis, E., Druelle, P., Ross, K. E., McGill, S.
International Journal of Osteopathic Medicine, 2015/03
2554

Hypothyreose – können Laborwerte und körperliche Beschwerden durch osteopathische Behandlung beeinflusst werden?
(The Influence of Osteopathic Treament on Biochemical Parameters and Physical Problems in Patients with Hypothyreosis)
Monninger, K.
Unpublished MSc thesis, 2015/03
Free full text
2555

Stress und Stressmanagement bei OsteopathInnen
(Stress and Stress Management of Osteopaths)
Homa-Konrad, K.
Unpublished MSc thesis, 2015/03
Free full text
2556

Exploring the construct validity of the Patient Perception Measure - Osteopathy (PPM-O) using classical test theory and Rasch analysis
Mulcahy, J., Vaughan, B.
Chiropractic & Manual Therapies, 2015/03
Free full text
2557

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03
2558

Impact of the clinical ultrasound elective course on retention of anatomical knowledge by second-year medical students in preparation for board exams
Kondrashov, P., Johnson, J. C., Boehm, K., Rice, D., Kondrashova, T.
Clinical Anatomy, 2015/03
2559

Osteopathic manipulative treatment use in the emergency department: a retrospective medical record review
Ault, B., Levy, D.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2560

Investigation of instruments measuring healthcare practitioners’ attitudes and beliefs toward low back pain: psychometric properties and survey of New Zealand osteopaths and manipulative physiotherapists
Rushworth, W.
Unpublished MSc thesis, 2015/03
Free full text
2561

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text
2562

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2563

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2564

Evidence-based medicine and osteopathic medicine: no paradox
Noll, D. R.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2565

Einfluss der Osteopathie auf den körperlichen und mentalen Zustand von Teenagern
(Influence of osteopathy on the physical and mental states of teenagers)
Egorova, I. A., Buchnov, A. D.
Osteopathische Medizin, 2015/03
2566

Osteopathische Behandlung bei unspezifischen Rückenschmerzen – Literaturübersicht und Metaanalyse
(Osteopathic treatment for unspecific low back pain - systematic review and meta analysis)
Franke, H., Franke, J.D., Fryer, G.
Osteopathische Medizin, 2015/03
2567

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03
2568

Postoperative singultus: an osteopathic approach
Petree, K., Bruner, J.
The Journal of the American Osteopathic Association, 2015/03
Free full text
2569

Fluida und Osteopathie – Kongress der Osteopathie Schule Deutschland 2014
(Fluids and Osteopathy - Congress of the Osteopathic School of Germany 2014)
Hohenschurz-Schmidt, D. J.
Osteopathische Medizin, 2015/03
2570

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
2571

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text
2572

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text
2573

Wie zufrieden sind Eltern Frühgeborener in Deutschland mit osteopathischen Behandlungen ihrer frühgeborenen Kinder innerhalb der ersten 3 Lebensjahre?
(Osteopathic treatments on preborn children within their first 3 years: how content are parents with the effects of treatment?)
Papperger, S.
Unpublished MSc thesis, 2015/02
Free full text
2574

Beschreibung der Insertionsstellen des Ligamentum vertebropericardiacum und der Verbindung zum vegetativen Nervensystem: Eine anatomische Grundlagenstudie an nach Thiel konservierten menschlichen Leichen.
(Description of the insertion sites of the ligament vertebropericardiacum and the connection to the autonomic nervous system: A baseline anatomy study in Thiel embalmed human cadavers)
Hoffmann, R.
Unpublished MSc thesis, 2015/02
Free full text
2575

Use of complementary health approaches among children aged 4-17 years in the United States: National Health Interview Survey, 2007-2012
Black, L. I., Clarke, T. C., Barnes, P. M., Stussman, B. J., Nahin, R. L.
National Health Statistics Reports, 2015/02
Free full text
2576

Das Schielen bei Kindern von 2-6 Jahren - Kann es durch osteopathische Behandlung beeinflusst werden?
(Children from 2 to 6 years suffering from strabism - can it be influenced by osteopathic treatment?)
Vietz, C.
Unpublished MSc thesis, 2015/02
Free full text
2577

Umfragestudie zur Entstehung des kindlichen Schielens (Strabismus) durch prä- bzw. perinatale Einflüsse
(Questionnaire study on the emergence of childhood strabism because of prenatal and perinatal influences)
Vietz, M.
Unpublished MSc thesis, 2015/02
Free full text
2578

Osteopatia como meio terapêutico nas disfunções temporomandibulares e dores orofaciais
(Osteopathy as a therapeutic tool in temporomandibular disorders and orofacial pain)
Ferreira, L. T.
Unpublished MSc thesis, 2015/02
Free full text
2579

Resolution of dacryostenosis after osteopathic manipulative treatment
Apoznanski, T. E., Abu-Sbaih, R., Terzella, M. J., Yao, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text
2580

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text
2581

Promoting optimal breastfeeding through the osteopathic therapeutic cycle
Cornall, D.
Unpublished PhD thesis, 2015/02
Free full text
2582

Sutherlands Herangehensweise an den Körper als Ganzes: Die Schoßtechnik
(Sutherland's approach to the body as a whole: the lap technique)
Chandler, P., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2583

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01
2584

Are We Ready to Lead? ACGME Merger: An Opportunity to Fulfill Osteopathy’s Mission
O'Connell, J. A.
The AAO Journal, 2015/01
2585

Im Gespräch mit … Colin Dove
(In dialog with ... Colin Dove)
Möckel, E., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2586

Pregnancy Research on Osteopathic Manipulation Optimizing Treatment Effects: the PROMOTE study
Hensel, K. L., Buchanan, S., Brown, S. K., Rodriguez, M., Cruser d, A.
American Journal of Obstetrics & Gynecology, 2015/01
Free full text
2587

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text
2588

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01
2589

A study and revisioning of pedagogy and language from the four viewpoints of Sufism, phenomenology of the body, osteopathy, and evolutionary cosmology: Teachings of love and ecology
Davis, M. E.
Unpublished PhD thesis, 2015/01
2590

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2591

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text
2592

Osteopathic clinical reasoning for the diagnosis and management of pelvic girdle pain associated with pregnancy: an interpretive descriptive study
Rioufrays, J.
Unpublished MSc thesis, 2015/01
Free full text
2593

Aufrecht im Alter
(Upright in old age)
Eix, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2594

Racionalidades médicas de los sistemas tradicional colombiano, biomédico y osteopático: una aproximación a la conceptualización de la dolencia del descuaje en Bogotá, Colombia. 2015
(Medical rationalities of the traditional Colombian, biomedical, and osteopathic systems: an approach to the conceptualization of the ailment of descuaje in Bogota, Colombia)
Sanin Pineda, L. F.
Unpublished MSc thesis, 2015/01
Free full text
2595

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01
2596

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
2597

A single graduate medical education accreditation system: ensuring quality training for physicians and improved health care for the public
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/4
Free full text
2598

Osteopathy decreases the severity of IBS-like symptoms associated with Crohn's disease in patients in remission
Piche, T., Pishvaie, D., Tirouvaziam, D., Filippi, J., Dainese, R., Tonohouhan, M., DeGalleani, L., Nebot-Vivinus, M. H., Payrouse, J. L., Hebuterne, X.
European Journal of Gastroenterology & Hepatology, 2014/12
2599

Clinical response and relapse in patients with chronic low back pain following osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Aryal, S.
Manual Therapy, 2014/12
Free full text
2600

Open the Box - An Empirical Research Concering the Evaluation of the Black-Box-Model in the Osteopathic Medicine
Müller, S.
Unpublished MSc thesis, 2014/12
Free full text
2601

Pitfalls and challenges involved in the process of perception and interpretation of palpatory findings
Liem, T.
International Journal of Osteopathic Medicine, 2014/12
2602

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text
2603

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12
2604

Intuition, analysis and reflection: An experimental study into the decision-making processes and thinking dispositions of osteopathy students
Spadaccini, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2014/12
2605

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12
2606

(Letter to GM Ostendorf: osteopath --an independent health professional? In: Insurance Medicine 66 (2014), No. 2, pp 97th)
Psczolla, M.
Versicherungsmedizin, 2014/12
2607

Mit welchen Problemen kommen Eltern mit ihren Kindern im ersten Lebensjahr zum/zur OsteopathenIn und welche somatischen Dysfunktionen werden dabei gefunden?
(Which problems make parents approaching an osteopath for their children in their first year of life and which somatic dysfunctions can be found?)
Mellitzer, E.
Unpublished MSc thesis, 2014/12
Free full text
2608

Cardiovascular Response to Vertebral Osteopathic Manipulative Treatment (OMT), On Asymptomatic Human Subjects
Pedapati, C.
Unpublished MSc thesis, 2014/12
2609

The accelerated physician assistant pathway: a three-year medical school curriculum for physician assistants to obtain DO degrees
Kauffman, M., Ferretti, S. M.
Academic Medicine, 2014/12
Free full text
2610

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text
2611

A prodromal, musculoskeletal presentation of Parkinson's disease: A case report
Simpson, P. A.
International Journal of Osteopathic Medicine, 2014/12
2612

Osteopathic manual therapy as an adjunct treatment for self-management of breast cancer related lymphoedema: the lived experience of lymphoedema and osteopathic treatment
Henderson, K.
Unpublished MSc thesis, 2014/12
Free full text
2613

Use of real-time physiologic parameter assessment to augment osteopathic manipulative treatment training for first-year osteopathic medical students
Heath, D. M., Makin, I. R., Pedapati, C., Kirsch, J.
The Journal of the American Osteopathic Association, 2014/12
Free full text
2614

Osteopathic decapitation: Why do we consider the head differently from the rest of the body? New perspectives for an evidence-informed osteopathic approach to the head
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2014/12
2615

Osteopathic treatment in patients with primary dysmenorrhoea: A randomised controlled trial
Schwerla, F., Wirthwein, P., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2014/12
2616

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2617

Piriformis Syndrome: A Case Study
Lee, J. M., McCaffrey, K.
The AAO Journal, 2014/11
Free full text
2618

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text
2619

Using the Strain-Counterstrain Approach to Highlight the Body Unity Within Osteopathic Treatment
Dixneuf, A., Ghattas, B.
The AAO Journal, 2014/11
Free full text
2620

Przydatność terapii czaszkowo-krzyżowej w leczeniu chorych z niespecyficznymi bólami dolnego odcinka kręgosłupa. Doniesienie wstępne
Utility of craniosacral therapy in treatment of patients with non-specific low back pain. Preliminary report
Bialoszewski, D., Bebelski, M., Lewandowska, M., Slupik, A.
Ortopedia, Traumatologia, Rehabilitacja, 2014/11
2621

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text
2622

17. Internationaler Kongress des VOD
(The 17th International Congress of the German Osteopathic Association)
Kaiser, F.
Osteopathische Medizin, 2014/11
2623

Was zeigen osteopathische Tests an bei Patienten mit schmerzhaftem unteren Rücken (low back pain) die eine Modic 1- oder Modic 2-Veränderung haben im Vergleich zu einer Kontrollgruppe mit schmerzhaftem unteren Rücken ohne Modic-Veränderung ?
(What are showing osteopatic tests by patients with low back pain who have a modic 1 or a modic 2 change in comparison to a control group who has low back pain but no modic changes?)
Gutenkauf, F.
Unpublished MSc thesis, 2014/11
Free full text
2624

Prozess der Wahrnehmung und Interpretation von Palpationsbefunden
(Process of perception and interpretation of palpation findings).
Liem, T.
Osteopathische Medizin, 2014/11
2625

Effekt einer Leberbehandlung auf den Laktatwert im Blut von gesunden Erwachsenen
(The effect of an osteopathic treatment of the liver on the blood lactate level of healthy adults)
Hieden, E.
Unpublished MSc thesis, 2014/11
Free full text
2626

Chiropraktik in Deutschland – die Zeit vor 1945
(Chiropractic in Germany - the time before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2014/11
2627

Beeinflussung des autonomen Nervensystems durch eine osteopathische Recoiltechnik am Sternum
(Influencing the autonomic nervous system through the application of an osteopathic recoil technique on the sternum)
Mayrhofer, D.
Unpublished MSc thesis, 2014/11
Free full text
2628

Professionalism score and academic performance in osteopathic medical students
Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2629

Desenvolvimento e aplicação de um protocolo osteopático de tratamento para bebês com refluxo
(Development and application of an osteopathic treatment protocol for infants with reflux)
Gemelli, M.
Unpublished MSc thesis, 2014/11
Free full text
2630

Observational study fails to demonstrate the effectiveness of OMT in decreasing low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2631

Efeito de Técnicas Osteopáticas Estruturais na Postura e Flexibilidade de Individuos com Escoliose Idiopática do Adolescente
(Effect of Structural Osteopathic Techniques on the Posture and Flexibility of Individuals with Adolescent Idiopathic Scoliosis)
Pelai, E. B.
Unpublished MSc thesis, 2014/11
Free full text
2632

Osteopathic manipulative treatment for postural orthostatic tachycardia syndrome
Goodkin, M. B., Bellew, L. J.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2633

Use of beat-to-beat cardiovascular variability data to determine the validity of sham therapy as the placebo control in osteopathic manipulative medicine research
Henley, C. E., Wilson, T. E.
The Journal of the American Osteopathic Association, 2014/11
Free full text
2634

The Effect of Optimally Timed Osteopathic Manipulative Treatment on Length of Hospital Stay in Moderate and Late Preterm Infants: Results from a RCT
Pizzolorusso, G., Cerritelli, F., Accorsi, A., Lucci, C., Tubaldi, L., Lancellotti, J., Barlafante, G., Renzetti, C., D', Incecco, C., Perri, F. P.
Evidence-based Complementary and Alternative Medicine, 2014/11
Free full text
2635

„Wir Osteopathen sind ein wichtiges Stellglied in der Betreuung von Sportlern“
(“We osteopaths are an important actuator in the care of athletes“)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2636

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in women with persistent non-specific low back pain after childbirth. A randomized controlled trial)
Belz, S.
Unpublished MSc thesis, 2014/10
Free full text
2637

Myers' response to Tozzi's editorial
Myers, T.
Journal of Bodywork and Movement Therapies, 2014/10
2638

Sensations experienced and patients' perceptions of osteopathy in the cranial field treatment
Mulcahy, J., Vaughan, B.
Journal of Evidence-Based Integrative Medicine, 2014/10
Free full text
2639

A modified Delphi consensus study to identify UK osteopathic profession research priorities
Rushton, A. B., Fawkes, C. A., Carnes, D., Moore, A. P.
Manual Therapy, 2014/10
2640

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2641

Das Fasziendistorsionsmodell (nach Typaldos): Die 6 Störungen und deren Behandlung
(The fascial distortion model (according to Typaldos): The 6 disorders and their treatment)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2642

Vergleichende Literaturanalyse über die Notwendigkeit der Einführung von Balintgruppen in die (Kinder-)Osteopathie
(Comparative literature analysis on the necessity of introducing balint groups into (pediatric) osteopathy)
Kohlmann, M.
unpublished MSc thesis, 2014/10
Free full text
2643

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2644

Vergleich der haptischen und der taktilen Wahrnehmung von Osteopathen und nicht manualtherapeutisch tätigen Personen. Querschnittsstudie.
(Haptic and tactile perception: a comparison between osteopaths and professionally not manual-acting individuals. A cross-sectional study)
Heitmüller, K.
Unpublished D.O. thesis, 2014/10
2645

Das Supinationstrauma aus osteopathischer Sicht
(The supination trauma from an osteopathic point of view)
Peramo, J. M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2646

Response to letter to the editor
Bolino, G., Mangiulli, T.
Medicine, Science and the Law, 2014/10
Free full text
2647

Osteopathische Behandlung von Schwangeren mit Rückenschmerzen. Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial)
Röhrich, K.
Unpublished D.O. thesis, 2014/10
2648

Onset of complications following cervical manipulation due to malpractice in osteopathic treatment: a case report
Cicconi, M., Mangiulli, T., Bolino, G.
Medicine, Science and the Law, 2014/10
2649

Valuable information about current clinical practice
Vaughan, B., Thomson, O.
Medicine, Science and the Law, 2014/10
Free full text
2650

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text
2651

Osteopathische Behandlung von Kindern mit einer idiopathischen Haltungsasymmetrie. Eine randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in children with idiopathic postural asymmetry. A randomized controlled trial)
Teichmüller, M.
Unpublished D.O. thesis, 2014/10
2652

Der Muskelfaserriss
(The torn muscle fiber)
Taenzer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2653

Changes in rat spinal cord gene expression after inflammatory hyperalgesia of the joint and manual therapy
Ruhlen, R. L., Singh, V. K., Pazdernik, V. K., Towns, L. C., Snider, E. J., Sargentini, N. J., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2654

Wie groß ist der Erfolg einer ganzheitlichen osteopathischen Behandlung bei Frauen mit persistierenden unspezifischen Rückenschmerzen post partum? Randomisierte kontrollierte Studie.
(Effectiveness of osteopathic treatment in women with persistent non specific low back pain after childbirth. A randomized controlled trial)
Belz, S., Brix, K.
Unpublished D.O. thesis, 2014/10
2655

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text
2656

Behandlung eines nach anterior verlagerten Akromioklavikulargelenks (ACG) nach Sporttrauma
(Treatment of an anteriorly dislocated acromioclavicular joint after sports trauma)
Delarue, C.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2657

Osteothek: Schnelle Hilfe und fundierte Informationen für die osteopathische Praxis
(Osteothek: Quick help and sound information for osteopathic practice)
Dierlmeier, D.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2658

Deformations experienced in the human skin, adipose tissue, and fascia in osteopathic manipulative medicine
Chaudhry, H., Bukiet, B., Ji, Z., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2659

Bewegung – osteopathische Domäne oder ungenutztes Potenzial?
(Movement - osteopathic domain or untapped potential?)
Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
2660

Effectiveness of osteopathic manipulative treatment with home based exercises on progressed flexible pes planus
Kim, C.
Unpublished MSc thesis, 2014/10
Free full text
2661

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2662

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2663

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text
2664

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
2665

The runner's kidney: A case report
Lalonde, F.
International Journal of Osteopathic Medicine, 2014/09/01/
2666

Pilot trial of osteopathic manipulative therapy for patients with frequent episodic tension-type headache
Rolle, G., Tremolizzo, L., Somalvico, F., Ferrarese, C., Bressan, L. C.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2667

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2668

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09
2669

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09
2670

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09
2671

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09
2672

Results, solutions, and learning: The continuing maturation of osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2014/09
2673

Adverse events in pediatric osteopathy
Kales, S.
Unpublished MSc thesis, 2014/09
Free full text
2674

Osteopathische Interventionsevidenz bei Craniomandibulärer Dysfunktion – ein systematischer Review
(Osteopathic Intervention Evidence in Case of Temporomandibular Disorders - A Systematic Review)
Breunig, B.
Unpublished MSc thesis, 2014/09
Free full text
2675

Osteopathie und ihre Effektivität bei craniomandibulärer Dysfunktion (CMD)
(Osteopathic efficiency regarding craniomandibular dysfunction (CMD))
Maron, A.
Unpublished MSc thesis, 2014/09
Free full text
2676

Osteopathie bei chronischen unteren Rückenschmerzen aus Sicht der PatientInnen. Eine qualitative Studie
(The patient's view on osteopathic treatment of chronic low back pain. A qualitative study)
Brenner, F.
Unpublished MSc thesis, 2014/09
Free full text
2677

Pierre robin sequence in a neonate with suckling difficulty and weight loss
Summers, J., Ludwig, J., Kanze, D.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2678

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text
2679

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text
2680

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text
2681

What about OMT and nutrition for managing the irritable bowel syndrome? An overview and treatment plan
Collebrusco, L., Lombardini, R.
Explore (NY), 2014/09
2682

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09
2683

Osteopathie und Naturheilkunde in der Schweiz
(Osteopathy and naturopathy in Switzerland)
Vogel, C.
Osteopathische Medizin, 2014/09
2684

Primary reasons for osteopathic consultation: a prospective survey in Quebec
Morin, C., Aubin, A.
PLoS One, 2014/09
Free full text
2685

A degree of difference: the origins of osteopathy and the first use of the “DO“ designation
Stark, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2686

Changes in biomechanical dysfunction and low back pain reduction with osteopathic manual treatment: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Crow, W. T.
Manual Therapy, 2014/08
Free full text
2687

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2688

Use of osteopathic manipulative treatment to manage recurrent bouts of singultus
Seidel, B., Desipio, G. B.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2689

Multitasking behaviors of osteopathic medical students
Shah, A. V., Mullens, D. J., Van Duyn, L. J., Januchowski, R. P.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2690

Osteopathy as an adjunctive management to standard care for depression in menopausal women
Henderson, P.
Unpublished MSc thesis, 2014/08
Free full text
2691

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text
2692

Effets d'un traitement ostéopathique sur la fonction de la main, des symtômes globaux de la maladie et le statut fonctionnel de personnes atteintes de sclérodermie systémique: une série d'études à cas unique
(Effects of osteopathy on hand function, disease symptoms and functional status in female workers with systemic sclerosis: a series of single case studies)
O'Connor, S.
Unpublished MSc thesis, 2014/08
Free full text
2693

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2694

Quality of life in patients referring to private osteopathic clinical practice: A prospective observational study
Cerritelli, F., Verzella, M., Barlafante, G.
Complementary Therapies in Medicine, 2014/08
2695

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text
2696

Cost-effectiveness of manual therapy for the management of musculoskeletal conditions: a systematic review and narrative synthesis of evidence from randomized controlled trials
Tsertsvadze, A., Clar, C., Court, R., Clarke, A., Mistry, H., Sutcliffe, P.
Journal of Manipulative and Physiological Therapeutics, 2014/07
Free full text
2697

Response: observational study demonstrates that OMT is associated with reduced analgesic prescribing and fewer missed work days
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2698

Im Gespräch mit … Gert Roncada
(In dialog with Gert Roncada)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2699

Impact of osteopathic treatment on pain in adult patients with cystic fibrosis--a pilot randomized controlled study
Hubert, D., Soubeiran, L., Gourmelon, F., Grenet, D., Serreau, R., Perrodeau, E., Zegarra-Parodi, R., Boutron, I.
PLoS One, 2014/07
Free full text
2700

„Hoffentlich ist es nicht so schlimm, wie es eh schon ist“ – oder wenn einem das Leben an die Nieren geht
(“I hope it's not as bad as it already is“ - or when life gets to you)
Schöndorfer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2701

Stimmt unsere Vorstellung vom venösen System?
(Is our conception of the venous system accurate?)
Thon, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2702

The OSTEOPATHIC trial demonstrates significant improvement in patients with chronic low back pain as manifested by decreased prescription rescue medication use
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2703

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2704

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07
2705

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2706

Impact of the single accreditation agreement on GME governance and the physician workforce
Kelley, C. S.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2707

Mountaineering-induced bilateral plantar paresthesia
Henderson, K. K., Parker, J., Heinking, K. P.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2708

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2709

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text
2710

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2711

Osteopathic Manipulative Treatment in Vestibular Neuritis: A Case Report
Ross, B. S., Johnson, V. M.
The AAO Journal, 2014/06
Free full text
2712

Treatment of Common Fibular (Peroneal) Nerve Palsy With Osteopathic Manipulative Medicine: A Case Study
Jahnke, B. M., Hopson, P., Worden, K.
The AAO Journal, 2014/06
Free full text
2713

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 2
Hendryx, J. T.
The AAO Journal, 2014/06
Free full text
2714

Comparison of Patient Records From the Still-Hildreth Sanatorium With Published Reports
Ching, L. M., Shaw, H. H.
The AAO Journal, 2014/06
Free full text
2715

Is There a Place for Osteopathy in Parkinson Disease Management? A Retrospective Case Control Study
Catanzaro, M. P., Vazzana, K. M., Chen, A., Mancini, J. D., Yao, S. C.
The AAO Journal, 2014/06
Free full text
2716

The Role of Osteopathic Manipulative Medicine in the Treatment of Dacryostenosis
Apoznanski, T. E., Abu-Sbaih, R., Yao, S. C.
The AAO Journal, 2014/06
Free full text
2717

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06
2718

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06
2719

New gestational osteopathy unit at the University Hospital Quiron San Jose of Madrid
Guzman Mora, R.
Revista de Enfermeria, 2014/06
2720

Osteopath--ein eigenstandiger Heilberuf?
(Osteopath - an independent health profession?)
Ostendorf, G. M.
Versicherungsmedizin, 2014/06
2721

Osteopathie in Kenia – humanitäre Hilfe und Engagement gegen die weibliche Genitalverstümmelung
(Osteopathy in Kenya - Humanitarian aid and commitment against female genital mutilation)
Gassmaier, H.
Osteopathische Medizin, 2014/06
2722

Behandlung von Säuglingen mit Regulationsstörungen – Anregungen für die Ausbildung gemäß GAIMH
(Treatment of infants with adjustment disorders - Stimuli for the education according to the GAIMH)
Gillemot, B.
Osteopathische Medizin, 2014/06
2723

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2724

Traumatic Groin Injury in a Football Player: A Case Report
Tsukanov, D., Dowling, D. J., Weiss, L.
The AAO Journal, 2014/06
Free full text
2725

Management of Levator Ani Syndrome With Osteopathic Manipulative Treatment: A Case Study
Yoshida, M., Derenge, D., Worden, K.
The AAO Journal, 2014/06
Free full text
2726

Osteopathic manipulative treatment for inpatients with pulmonary exacerbations of cystic fibrosis: effects on spirometry findings and patient assessments of breathing, anxiety, and pain
Swender, D. A., Thompson, G., Schneider, K., McCoy, K., Patel, A.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2727

The effect of cranial osteopathic manual therapy on somatic tinnitus in individuals without otic pathology: Two case reports with one year follow up
Arab, A. M., Nourbakhsh, M. R.
International Journal of Osteopathic Medicine, 2014/06
2728

Application of osteopathy in the cranial field to treat left superior homonymous hemianopsia
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2014/06
2729

An audit of the accuracy of medication documentation in a United Kingdom osteopathic training clinic before and after an educational intervention
Brunt, H., Abbey, H.
International Journal of Osteopathic Medicine, 2014/06
2730

Effect of a general osteopathic treatment on body satisfaction, global self perception and anxiety: A randomized trial in asymptomatic female students
Dugailly, P.M., Fassin, S., Maroye, L., Evers, L., Klein, P., Feipel, V.
International Journal of Osteopathic Medicine, 2014/06
2731

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06
2732

Osteopathic approach to sacroiliac dysfunction in a patient with steroid myopathy: case report and literature review
Kohns, D. J., Fitch, D. S.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2733

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2734

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2735

Osteopathie als zusätzliche Leistung gesetzlicher Krankenkassen
(Osteopathy as an additional service of statutory health insurance companies.)
Newiger, C.
Osteopathische Medizin, 2014/06
2736

Effectiveness of osteopathic manipulative therapy for managing symptoms of irritable bowel syndrome: a systematic review
Muller, A., Franke, H., Resch, K.L., Fryer, G.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2737

Effect of osteopathic manipulative treatment on middle ear effusion following acute otitis media in young children: a pilot study
Steele, K. M., Carreiro, J. E., Viola, J. H., Conte, J. A., Ridpath, L. C.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2738

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text
2739

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text
2740

Reliability and validity of conversion formulas between comprehensive osteopathic medical licensing examination of the United States level 1 and United States medical licensing examination step 1
Lee, A. S., Chang, L., Feng, E., Helf, S.
Journal of Graduate Medical Education, 2014/06
Free full text
2741

Attributions, influences and outcomes for underrepresented and disadvantaged participants of a medical sciences enrichment pipeline program
Pinckney, C.
Unpublished Dissertation, 2014/05
Free full text
2742

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2743

Response to Letter About “An Unexpectedly Progressed Lumbar Herniated Disk“
Lipton, J. A., McLeod, G. A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2744

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05
2745

Osteopathy: helping pregnant women in pain
Randall, S.
The Practising Midwife, 2014/05
2746

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2747

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2748

An Unexpectedly Progressed Lumbar Herniated Disk
Gilliss, A. C.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2749

Determination of Genetic Factors Associated with Response to Osteopathic Manipulative Treatment (OMT) in Individuals with Chronic Lower Back Pain (CLBP)
Richardson, K. K.
Unpublished MSc thesis, 2014/05
2750

The DREEM, part 2: psychometric properties in an osteopathic student population
Vaughan, B., Mulcahy, J., McLaughlin, P.
BMC Medical Education, 2014/05
Free full text
2751

Somatic dysfunction and use of osteopathic manual treatment techniques during ambulatory medical care visits: a CONCORD-PBRN study
Licciardone, J. C., Kearns, C. M., King, H. H., Seffinger, M. A., Crow, W. T., Zajac, P., Devine, W. H., Abu-Sbaih, R. Y., Miller, S. J., Berkowitz, M. R., Dyer, R., Heath, D. M., Treffer, K. D., Nevins, N. A., Aryal, S.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2752

The DREEM, part 1: measurement of the educational environment in an osteopathy teaching program
Vaughan, B., Carter, A., Macfarlane, C., Morrison, T.
BMC Medical Education, 2014/05
Free full text
2753

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2754

Introducing an osteopathic approach into neonatology ward: the NE-O model
Cerritelli, F., Martelli, M., Renzetti, C., Pizzolorusso, G., Cozzolino, V., Barlafante, G.
Chiropractic & Manual Therapies, 2014/05
Free full text
2755

Caring beyond the table: exploring New Zealand osteopaths’ experience of treating pregnant women: a descriptive phenomenological study
McCollum, F.
Unpublished MSc thesis, 2014/05
Free full text
2756

Investigation into factors influencing roles, relationships, and referrals in integrative medicine
Gray, B., Orrock, P.
The Journal of Alternative and Complementary Medicine, 2014/05
Free full text
2757

Effect of osteopathic manipulative therapy in the attentive performance of children with attention-deficit/hyperactivity disorder
Accorsi, A., Lucci, C., Di Mattia, L., Granchelli, C., Barlafante, G., Fini, F., Pizzolorusso, G., Cerritelli, F., Pincherle, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text
2758

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2759

Strain counterstrain technique to decrease tender point palpation pain compared to control conditions: a systematic review with meta-analysis
Wong, C. K., Abraham, T., Karimi, P., Ow-Wing, C.
Journal of Bodywork and Movement Therapies, 2014/04
2760

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2761

Development of a data collection tool to profile osteopathic practice: use of a nominal group technique to enhance clinician involvement
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
2762

Anatomical landmark position--can we trust what we see? Results from an online reliability and validity study of osteopaths
Pattyn, E., Rajendran, D.
Manual Therapy, 2014/04
2763

Im Gespräch mit ... Sue Turner
(In dialog with Sue Turner)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2764

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2765

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04
2766

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2767

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2768

Auffinden von peripheren Nerven am Beispiel des N. radialis
(Locating peripheral nerves using the radial nerve as an example)
Van Loo, B.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2769

Osteopathic management of mild leg length inequality with heel lift therapy: A pilot study analyzing altered gait kinetics and kinematics
Bens, S.
Unpublished MSc thesis, 2014/04
2770

Besserung der Symptome bei Multipler Sklerose
(Improvement of symptoms in multiple sclerosis)
Butenschön, W.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2771

Honoring the Medicine: searching for the embodiment of spiritual commitment and philosophy for student physicians
Roseman, J. L.
Advances in Mind-Body Medicine, 2014/04
2772

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2773

Approach to low back pain – osteopathy
Vaughan, B., Morrison, T., Buttigieg, D., Macfarlane, C., Fryer, G.
Australian Family Physician, 2014/04
Free full text
2774

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2775

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2776

Do placebo effects associated with sham osteopathic procedure occur in newborns? Results of a randomized controlled trial
Martelli, M., Cardinali, L., Barlafante, G., Pizzolorusso, G., Renzetti, C., Cerritelli, F.
Complementary Therapies in Medicine, 2014/04
2777

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2778

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2779

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2780

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text
2781

Osteopathic manipulative treatment as a useful adjunctive tool for pneumonia
Yao, S., Hassani, J., Gagne, M., George, G., Gilliar, W.
Journal of Visualized Experiments, 2014/04
Free full text
2782

Wissenschaftliche Neubewertung der Liquordynamik
(Scientific reassessment of cerebrospinal fluid dynamics)
Hass-Degg, K.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04
2783

A profile of osteopathic care in private practices in the United Kingdom: a national pilot using standardised data collection
Fawkes, C. A., Leach, C. M., Mathias, S., Moore, A. P.
Manual Therapy, 2014/04
2784

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2785

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text
2786

Resolution of Post-traumatic Temporomandibular Joint Pain, Headache and Vision Changes with OMM in the Unified Field: A Case Report
Lipton, J. A., Case, M. G.
The AAO Journal, 2014/03
Free full text
2787

Research and treatment bulletin
International Journal of Osteopathic Medicine, 2014/03
2788

Osteopathic Manipulative Treatment of Pelvic Dysfunction in a Postpartum Patient with Co-Morbid Headaches: A Case Report
Kant, R., Berkowitz, M. R.
The AAO Journal, 2014/03
Free full text
2789

The Bioenergetic Model in Osteopathic Diagnosis and Treatment: An FAAO Thesis, Part 1
Hendryx, J. T.
The AAO Journal, 2014/03
Free full text
2790

Envisioning a global role for osteopathic medicine in the 21st century: Using Blue Ocean Strategy to promote osteopathic health care as the World's leader in healthcare education and do it more efficiently, effectively and at the lowest cost
Slocum, P. C., Papa, F.
International Journal of Osteopathic Medicine, 2014/03
2791

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03
2792

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text
2793

Hydrodynamik des Liquor cerebrospinalis – eine Neubewertung
(Cerebrospinal fluid hydrodynamics - A reassessment)
Chikly, B., Quaghebeur, J.
Osteopathische Medizin, 2014/03
2794

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2795

Osteopathic Manipulation in the Treatment of Primary Nocturnal Enuresis: A Retrospective Chart Review
Kanze, D. M., Kanze, K. A.
The AAO Journal, 2014/03
2796

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2797

Qualitative evaluation of osteopathic manipulative therapy in a patient with gastroesophageal reflux disease: a brief report
Diniz, L. R., Nesi, J., Curi, A. C., Martins, W.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2798

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2799

Assessing criticality in student research reports: Preliminary results from a new educational card sorting activity
Abbey, H., Esteves, J. E., Vogel, S., Tyreman, S. J.
International Journal of Osteopathic Medicine, 2014/03
2800

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03
2801

An investigation into the current practices and educational theories that underpin the teaching of palpation in osteopathic education: A Delphi study
Browning, S.
International Journal of Osteopathic Medicine, 2014/03
2802

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03
2803

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03
2804

The self-directed osteopathic medical student: Bringing adult learning into the osteopathic manipulative technique lab
Jons-Cox, L.A. D.
International Journal of Osteopathic Medicine, 2014/03
2805

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03
2806

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text
2807

Effectiveness of visceral osteopathic treatment on gastrointestinal indicators and behaviour patterns in autistic children: using questionnaire and biochemical markers to measure outcomes
Bramati-Castellarin, I.
Unpublished PhD thesis, 2014/03
Free full text
2808

Vestibular dysfunction in patients with chronic pain or underlying neurologic disorders
Gilbert, J. W., Vogt, M., Windsor, R. E., Mick, G. E., Richardson, G. B., Storey, B. B., Herder, S. L., Ledford, S., Abrams, D. A., Theobald, M. K., Cunningham, D., Kelly, L., Herring, K. V., Maddox, M. L.
The Journal of the American Osteopathic Association, 2014/03
Free full text
2809

OMT associated with reduced analgesic prescribing and fewer missed work days in patients with low back pain: an observational study
Prinsen, J. K., Hensel, K. L., Snow, R. J.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2810

Clinical decision-making and therapeutic approaches in osteopathy - a qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
2811

A qualitative grounded theory study of the conceptions of clinical practice in osteopathy – A continuum from technical rationality to professional artistry
Thomson, O. P., Petty, N. J., Moore, A. P.
Manual Therapy, 2014/02
2812

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2813

Osteopathie als “eigenstandiger Heilberuf“. Sollen Bademeister auf eigene Faust Patienten behandeln?
(Osteopathy as an “independent healing profession“. Should balneology specialists treat patients independently? )
Ostendorf, G. M.
MMW - Fortschritte der Medizin, 2014/02
2814

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text
2815

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text
2816

Osteopathic manipulative treatment in the management of biliary dyskinesia
Heineman, K.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2817

Mini-medical school programs are an effective tool to introduce students to osteopathic medicine
Kaye, K. E., Berns, A. L., Cress, L. R., Nazar, A. M.
The Journal of the American Osteopathic Association, 2014/02
Free full text
2818

The integration of the “spirituality in medicine“ curriculum into the osteopathic communication curriculum at Kansas City University of Medicine and Biosciences
Talley, J. A., Magie, R.
Academic Medicine, 2014/01
Free full text
2819

Somatic dysfunction and fascia's gliding-potential
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
2820

No place like HOME
Pham, J. T.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2821

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2822

Im Gespräch mit ... Alison Brown
(In dialog with Alison Brown)
Möckel, E., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2823

New frontiers in medical education: simulation technology at Campbell University School of Osteopathic Medicine
Maddox, R. W., Schmid, R. J.
North Carolina Medical Journal, 2014/01
2824

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01
2825

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2826

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2827

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2828

Componentes de formação no plano de estudos: a componente prática num curso profissional de osteopatia
(Training components in the syllabus: the practical component in a professional osteopathy course)
Barreto, N. M. S.
Unpublished MSc thesis, 2014/01
Free full text
2829

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2830

Die Galea aponeurotica als fasziale Struktur
(The galea aponeurotica as a fascial structure)
Barty, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2831

Ein neuer Ansatz zur Behandlung von Haltungsstörungen
(A new approach to the treatment of postural disorders)
Beck, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01
2832

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2833

Connectedness, sense of community, and academic satisfaction in a novel community campus medical education model
Vora, R. S., Kinney, M. N.
Academic Medicine, 2014/01
Free full text
2834

Osteopathic Manual Treatment and Ultrasound Therapy for Chronic Low Back Pain: An Illustration of Osteopathic Semantic Confusion
Cymet, T. C.
The Journal of the American Osteopathic Association, 2014/01
Free full text
2835

Osteopathic manual therapy as an adjunct treatment for the self-management of breast cancer related lymphoedema: A prospective case series
Eydt, E.
Unpublished MSc thesis, 2014/01
Free full text
2836

Corrigendum to “Osteopathic Manipulative Treatment (OMT) for Lower Urinary Tract Symptoms (LUTS) in women” [J. Bodyw. Mov. Ther. 17 (2013) 11–18]
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2014/01
Free full text
2837

Osteopathy and low back pain, acupuncture and in vitro fertilization, Tai Chi and osteoarthritis, Andrographis paniculata and ulcerative colitis, and acupressure and vertigo
Pettit, J., Glickman-Simon, R.
Explore (NY), 2014/01
2838

Osteopathic manipulative treatment of congenital talipes equinovarus: a case report
Andreoli, E., Troiani, A., Tucci, V., Barlafante, G., Cerritelli, F., Pizzolorusso, G., Renzetti, C., Vanni, D., Pantalone, A., Salini, V.
Journal of Bodywork and Movement Therapies, 2014/01
2839

Efectividad de la técnica osteopática BLT en el tratamiento conservativo del pie equinovaro infantil
(Efficacy of the osteopathic technique BLT in the conservative treatment of pediatric clubfoot)
Kimmerle, F.E.
Unpublished thesis, 2014
2840

Assessing impact of not attending lectures on osteopathic medical student performance: Brief survey of the literature and proposed future research
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/12
2841

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12
2842

Patient perception of osteopathic training in the UK and patient reported experience
Drysdale, I. P., Hinkley, H., Rolfe, K. J.
International Journal of Osteopathic Medicine, 2013/12
2843

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
2844

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12
2845

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12
2846

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12
2847

Emotional processing and its relationship to chronic low back pain
Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12
2848

Introduction to the special issue on osteopathic education
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2013/12
2849

OMT especially recommended for severe low back pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/12
2850

The OSCE in a pre-registration osteopathy program: Introduction and psychometric properties
Vaughan, B., Florentine, P.
International Journal of Osteopathic Medicine, 2013/12
2851

Investigation of standardized patient ratings of humanistic competence on a medical licensure examination using Many-Facet Rasch Measurement and generalizability theory
Zhang, X., Roberts, W. L.
Advances in Health Sciences Education : Theory and Practice, 2013/12
2852

Acute improvement in hemodynamic control after osteopathic manipulative treatment in the third trimester of pregnancy
Hensel, K. L., Pacchia, C. F., Smith, M. L.
Complementary Therapies in Medicine, 2013/12
Free full text
2853

On the oft-debated question of what it means to be an osteopathic physician
Benzoni, T.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2854

Preventive osteopathic manipulative treatment and stress fracture incidence among collegiate cross-country athletes
Brumm, L. F., Janiski, C., Balawender, J. L., Feinstein, A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2855

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2856

Use of OMT to Treat Patient with Ramsay Hunt Syndrome and HIV: A Case Study
Baker, J. P.
The AAO Journal, 2013/12
Free full text
2857

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2858

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text
2859

The Application of the Cranial Concept in the Investigation of Baffling Medical Disorders and Their Treatment: A Synergopathic Medical Disease Model
Pribadi, K. S.
The AAO Journal, 2013/12
Free full text
2860

The Effect of the Student American Academy of Osteopathy Summer Preceptorship Program on Students’ Perception of Osteopathic Manipulative Treatment
Vazzana, K. M., Chan, V., Wenzel, C. H., Yao, S. C.
The AAO Journal, 2013/12
Free full text
2861

Lymphatic Pump Treatment Repeatedly Enhances the Lymphatic and Immune Systems
Schander, A., Padro, D., King, H. H., Downey, H. F., Hodge, L. M.
Lymphatic Research and Biology, 2013/12
2862

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text
2863

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12
2864

Patients' expectations of private osteopathic care in the UK
Chippendale, E.
International Journal of Osteopathic Medicine, 2013/12
2865

Treatment of refractory irritable bowel syndrome with visceral osteopathy: short-term and long-term results of a randomized trial
Attali, T. V., Bouchoucha, M., Benamouzig, R.
Journal of Digestive Diseases, 2013/12
2866

The effectiveness of the ‘Bruce Jones sacroiliac technique’ in treatment of people with chronic low back pain: a single cohort design
Hanson, G.
Unpublished MSc thesis, 2013/12
Free full text
2867

Outcomes of osteopathic manual treatment for chronic low back pain according to baseline pain severity: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Minotti, D. E.
Manual Therapy, 2013/12
Free full text
2868

Neu: strukturierte curriculare Fortbildung „Osteopathische Verfahren“
(New: structured curricular training “Osteopathic methods“)
Psczolla, M.
Manuelle Medizin, 2013/12
Free full text
2869

Strukturierte curriculare Fortbildung Osteopathische Verfahren
(Structured curricular advanced training osteopathic methods)
v. Heymann, W., Buchmann, J.
Manuelle Medizin, 2013/12
2870

16. Internationaler Kongress des VOD
(The 16th International Congress of the German Osteopathic Association)
Prediger, G., Risch, A. J.
Osteopathische Medizin, 2013/11
2871

Zukunft und Qualität der Osteopathie in Deutschland
(Future and quality of osteopathy in Germany)
Osteopathische Medizin, 2013/11
2872

Evidenzbasierte Medizin – der Goldstandard auch in der Osteopathie?
(Evidence-based medicine - the golden standard also in osteopathy?)
Hartwig, B.
Osteopathische Medizin, 2013/11
2873

Rib-Raising-Technik verringert den Atemwegswiderstand
(Rib raising technique reduces airway resistance)
Braun, G.
Osteopathische Medizin, 2013/11
2874

Prevalence of visits to five types of complementary and alternative medicine practitioners by the general population: a systematic review
Cooper, K. L., Harris, P. E., Relton, C., Thomas, K. J.
Complementary Therapies in Clinical Practice, 2013/11
2875

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text
2876

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text
2877

Role of osteopathic structural diagnosis and osteopathic manipulative treatment for diabetes mellitus and its complications
Johnson, A. W., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2013/11
Free full text
2878

Pursuit of Complementary and Alternative Medicine Treatments in Adolescents With Cerebral Palsy
Majnemer, A., Shikako-Thomas, K., Shevell, M. I., Poulin, C., Lach, L., Schmitz, N., Law, M., Group the, Q.
Journal of Child Neurology, 2013/11
2879

The attitudes and self-reported practices of New Zealand osteopaths to exercise consultation and its use within osteopathy
Mistry, R.
Unpublished MSc thesis, 2013/11
Free full text
2880

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text
2881

Osteopathic manipulative treatment in tarsal somatic dysfunction: a case study
Batt, J., Neeki, M. M.
The Journal of the American Osteopathic Association, 2013/11
Free full text
2882

Gegenüberstellung von vizeralen Lehrsystemen verschiedener Osteopathieschulen in Deutschland. Eine Umfrage.
(Comparison of visceral approaches in different osteopathic schools in Germany. Survey)
Clostermann, A.
Unpublished D.O. thesis, 2013/10
2883

Influence of Manual Therapy on Functional Mobility After Joint Injury in a Rat Model
Ruhlen, R. L., Snider, E. J., Sargentini, N. J., Worthington, B. D., Singh, V. K., Pazdernik, V. K., Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2884

Response to “Letter to the Editor Regarding ‘The Somatic Connection: Manual Therapy Is Beneficial for Cervical Radiculopathy””
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2885

Effectiveness of osteopathic treatment in pregnant women suffering from low back pain (LBP). A randomized controlled trial
Gundermann, S.
Unpublished D.O. thesis, 2013/10
2886

Bewegung und Stille in der Arbeit mit Kindern
(Movement and stillness while working with children)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2887

Studienziel: Erhebung von Daten zur psychischen Belastung und Beanspruchung bei der Arbeit von Osteopathen in Deutschland. Studiendesign: Querschnittsstudie.
(Psychosocial working conditions of German osteopaths. Cross-sectional study)
Salandi, C.
Unpublished D.O. thesis, 2013/10
2888

Abseits ausgetretener Pfade: Ein neuer Blick auf die Faszie
(Off the beaten paths: a new look at the fascia)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2889

Natural Bridge: Wo sich Osteopathie und Natur verbinden
(The Natural Bridge: Where osteopathy and nature combine)
Stark, J. E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2890

Im Gespräch mit … Philip van Caille
(In dialog with Philip van Caille)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2891

Gesichtsfeldeinschränkung nach Unfall
(Visual field impairment after accident)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10
2892

Osteopathic dermatology residency training through Nova Southeastern University College of Osteopathic Medicine at Largo Medical Center
Walls, B.
Cutis, 2013/10
Free full text
2893

Pattern and predictors of complementary and alternative medicine (CAM) use among pediatric patients with epilepsy
Doering, J. H., Reuner, G., Kadish, N. E., Pietz, J., Schubert-Bast, S.
Epilepsy & Behavior, 2013/10
2894

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2895

Prevention of progressive back-specific dysfunction during pregnancy: an assessment of osteopathic manual treatment based on Cochrane Back Review Group criteria
Licciardone, J. C., Aryal, S.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2896

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2897

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text
2898

The effects of osteopathic treatment on common femoral artery blood flow and skin temperature in spinal cord injured and able-bodied individuals
Murray, D.
Unpublished MSc thesis, 2013/10
Free full text
2899

Patients' appraisals of public and private healthcare: a qualitative study of physiotherapy and osteopathy
Bradbury, K. J., Bishop, F. L., Yardley, L., Lewith, G.
Journal of Health Psychology, 2013/10
2900

Re: An investigation of cranial motion through a review of biomechanically based skull deformation literature
Gabutti, M., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2013/09
2901

Re: Re: An investigation of cranial motion through a review of biomechanically based skull deformation literature
Kemper, A. R., Brolinson, P. G., Seimetz, C. N., Duma, S. M.
International Journal of Osteopathic Medicine, 2013/09
2902

Osteopathic manipulative treatment (OMT) during labor facilitates a natural, drug-free childbirth for a primigravida patient: A case report
Smallwood, C. R., Borgerding, C. J., Cox, M. S., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2013/09
2903

Benefits of osteopathic manual treatment on chronic low back pain – At last, a large high quality clinical trial!
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/09
2904

Klinische Forschung in der Osteopathie – Teil 2: neuronale und organische Störungen
(Clinical research in osteopathy - Part 2: Neuronal and organic disorders)
Rauch, A.
Osteopathische Medizin, 2013/09
2905

Osteopathische Behandlung bei psychischen Traumafolgestörungen
(Osteopathic treatment in mental posttraumatic stress disorders)
Krebs, C.A., von Franque, M.
Osteopathische Medizin, 2013/09
2906

Osteopathen in Deutschland: ausgewählte Ergebnisse der Osteopathie-Zählung 2013
(Osteopaths in Germany: Selected results of the 2013 osteopathy census)
Ismail-Tsaous, E.
Osteopathische Medizin, 2013/09
2907

Osteopathie in Portugal staatlich reguliert
(Osteopathy in Portugal is regulated by the state)
Hartlep, M.
Osteopathische Medizin, 2013/09
2908

Thoracic and abdominal lymphatic pump techniques inhibit the growth of S. pneumoniae bacteria in the lungs of rats
Creasy, C., Schander, A., Orlowski, A., Hodge, L. M.
Lymphatic Research and Biology, 2013/09
Free full text
2909

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text
2910

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: an illustration of osteopathic semantic confusion. Author reply
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
2911

Osteopathic Management of a Family with Inherited Cervical Dystonia
Mancini, J. D., Burns, D. K.
The AAO Journal, 2013/09
Free full text
2912

Usefulness of Video Learning for Osteopathic Manipulative Medicine (OMM) Techniques in the Educational and Clinical Setting
Meghpara, M. K., Terzella, M. J., Flaum, T. B., Jung, M.K., Yao, S. C.
The AAO Journal, 2013/09
Free full text
2913

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text
2914

The importance of residency program size and location on American Osteopathic Board of Surgery In-Training Examination outcomes
Falcone, J. L., Rosen, M. E.
Journal of Surgical Research, 2013/09
2915

A single systems research design to examine the effectiveness of osteopathic treatment for people with osteoarthritis of the hip
Howat, T.
Unpublished MSc thesis, 2013/09
Free full text
2916

Offer and use of complementary and alternative medicine in hospitals of the French-speaking part of Switzerland
Carruzzo, P., Graz, B., Rodondi, P. Y., Michaud, P. A.
Swiss Medical Weekly, 2013/09
Free full text
2917

Osteopath is incorrect term for osteopathic physicians
Kaufman, B.
American Family Physician, 2013/08
Free full text
2918

Evaluation of the acceptability of Peer Physical Examination (PPE) in medical and osteopathic students: a cross sectional survey
Consorti, F., Mancuso, R., Piccolo, A., Consorti, G., Zurlo, J.
BMC Medical Education, 2013/08
Free full text
2919

A profile of osteopathic practice in Australia 2010-2011: a cross sectional survey
Burke, S. R., Myers, R., Zhang, A. L.
BMC Musculoskeletal Disorders, 2013/08
2920

Interventions for preventing and treating pelvic and back pain in pregnancy
Pennick, V., Liddle, S. D.
Cochrane Database of Systematic Reviews, 2013/08
Free full text
2921

One of ours
Burhop, J.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2922

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2923

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2924

Conservative approach to tardive dyskinesia-induced neck and upper back pain
Reifsnyder, J. W., Tettambel, M. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2925

Mathematical analysis of the flow of hyaluronic acid around fascia during manual therapy motions
Roman, M., Chaudhry, H., Bukiet, B., Stecco, A., Findley, T. W.
The Journal of the American Osteopathic Association, 2013/08
Free full text
2926

Die osteopathische Behandlung der Geburtserfahrung
(Osteopathic treatment of the birth experience)
Marris, T.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2927

Im Gespräch mit … Dr. Dina Guerassimiouk
(In dialog with Dr. Dina Guerassimiouk)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2928

Langfristige Begleitung eines Kindes mit spastischer Hemiparese
(Long-term treatment of a child with spastic hemiparesis)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2929

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2930

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2931

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2932

Osteopathic manipulative treatment for facial numbness and pain after whiplash injury
Genese, J. S.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2933

The short-term effect of a lymphatic pump protocol on blood cell counts in nursing home residents with limited mobility: a pilot study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text
2934

Fascia's function: classical osteopathic perspectives and current research compared
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text
2935

Reassessing cerebrospinal fluid (CSF) hydrodynamics: a literature review presenting a novel hypothesis for CSF physiology
Chikly, B., Quaghebeur, J.
Journal of Bodywork and Movement Therapies, 2013/07
2936

Changes in alpha band activity associated with application of the compression of fourth ventricular (CV-4) osteopathic procedure: A qEEG pilot study
Miana, L., Hugo do Vale Bastos, V., Machado, S., Arias-Carrión, O., Nardi, Antonio E., Almeida, L., Ribeiro, P., Machado, D., King, H., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text
2937

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07
2938

Osteopathic manipulative treatment for pediatric conditions: a systematic review
Posadzki, P., Lee, M. S., Ernst, E.
Pediatrics, 2013/07
2939

Osteopathische Diagnostik und Behandlung bei Stillproblemen
(Osteopathic diagnostics and treatment for breastfeeding problems)
Haller, L.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07
2940

Efficacy of osteopathy and other manual treatment approaches for malocclusion – A systematic review of evidence
Andresen, T., Bahr, C., Ciranna-Raab, C.
International Journal of Osteopathic Medicine, 2013/06
2941

Osteopathic intervention for chronic pain, remaining thoracic stiffness and breathing impairment after thoracoabdominal oesophagus resection: A single subject design study
Bjerså, K., Sachs, C., Hyltander, A., Fagevik Olsén, M.
International Journal of Osteopathic Medicine, 2013/06
2942

Item development for a questionnaire investigating patient self reported perception, satisfaction and outcomes of a single osteopathy in the cranial field (OCF) treatment
Mulcahy, J., Vaughan, B., Boadle, J., Klas, D., Rickson, C., Woodman, L.
International Journal of Osteopathic Medicine, 2013/06
2943

Palpatory phenomena in the limbs: A proposed mechanism
Scarr, G.
International Journal of Osteopathic Medicine, 2013/06
2944

Gesundheit durch Ganzheit – ein osteopathisch-salutogenetischer Ansatz
(Health by means of wholeness - An osteopathic-salutogenic approach)
Risch, A. J.
Osteopathische Medizin, 2013/06
2945

Klinische Forschung in der Osteopathie – Teil 1: muskuloskelettale Störungen
(Clinical research in osteopathy - Part 1: Musculoskeletal disorders)
Rauch, A.
Osteopathische Medizin, 2013/06
2946

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06
2947

Compliance with clinical guidelines for whiplash improved with a targeted implementation strategy: a prospective cohort study
Rebbeck, T., Macedo, L. G., Maher, C. G.
BMC Health Services Research, 2013/06
Free full text
2948

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06
2949

Osteopathic manipulative treatment and nutrition: An alternative approach to the irritable bowel syndrome
Collebrusco, L., Lombardini, R.
Health, 2013/06
Free full text
2950

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2951

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text
2952

Osteopathic manual treatment in patients with diabetes mellitus and comorbid chronic low back pain: subgroup results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2953

Treatment of a posterior rib utilizing a multimodal sequence of osteopathic manipulative treatments
Baker, J. P., Ely, R.
The AAO Journal, 2013/06
Free full text
2954

Distance learning and osteopathic manipulative medicine
Blumer, J. U.
The AAO Journal, 2013/06
Free full text
2955

Relief of persistent jaw pain with the use of osteopathic manipulative medicine
Lipton, J. A., Covington, J. D.
The AAO Journal, 2013/06
Free full text
2956

Osteopathic evaluation of somatic dysfunction and craniosacral strain pattern among preterm and term newborns
Pizzolorusso, G., Cerritelli, F., D', Orazio, M., Cozzolino, V., Turi, P., Renzetti, C., Barlafante, G., D', Incecco, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2957

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text
2958

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text
2959

Complementary and alternative medicine for pediatric otitis media
Levi, J. R., Brody, R. M., McKee-Cole, K., Pribitkin, E., O'Reilly, R.
International Journal of Pediatric Otorhinolaryngology, 2013/06
2960

Patients' expectations of private osteopathic care in the UK: a national survey of patients
Leach, C. M., Mandy, A., Hankins, M., Bottomley, L. M., Cross, V., Fawkes, C. A., Fiske, A., Moore, A. P.
BMC Complementary Medicine and Therapies, 2013/05
Free full text
2961

How do experiences of physiotherapy and osteopathy vary between NHS and private practice?
Bradbury, K.
Unpublished PhD thesis, 2013/05
Free full text
2962

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2963

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2964

An osteopathic approach to gastrointestinal disease: somatic clues for diagnosis and clinical challenges associated with Helicobacter pylori antibiotic resistance
Smilowicz, A.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2965

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text
2966

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05
2967

La prise en charge medicale et osteopathique de l'enuresie nocturne primalre isolee.
(The medical and osteopathic management of isolated primary nocturnal enuresis)
Burguete, E., Dubois, T.
Soins Pédiatrie/Puériculture, 2013/05
2968

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2969

Im Gespräch mit … François Corfù
(In dialog with François Corfù)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04
2970

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text
2971

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2972

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2973

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2974

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2975

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text
2976

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2977

Impact indices shed false light
McDonald, R. G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2978

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2979

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2980

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2981

Ohio osteopathic residency directors' self-reported administrative knowledge and skills before and after participation in an administrative training program
Sheehan, O. O., Brannan, G.
The Journal of the American Osteopathic Association, 2013/04
Free full text
2982

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04
2983

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text
2984

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text
2985

Developing a chronic pain self-management clinic at the British School of Osteopathy: Quantitative pilot study results
Abbey, H., Nanke, L.
International Journal of Osteopathic Medicine, 2013/03
2986

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03
2987

Is osteopathic manipulative treatment effective in migraine?
Cerritelli, F., Caprari, E., Di Vincenzo, M., Ginevri, L. R., Messi, G., Renzetti, C., Cozzolino, V., Frattesi, C., Barlafante, G., Foschi, N.
International Journal of Osteopathic Medicine, 2013/03
2988

Osteopathic principles in the modern world
Cotton, A.
International Journal of Osteopathic Medicine, 2013/03
2989

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03
2990

Profiling osteopathic practice in the UK using standardised data collection
Fawkes, C. A., Leach, J. M. C., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
2991

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03
2992

From distinct to indistinct, the life cycle of a medical heresy. Is osteopathic distinctiveness an anachronism?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2013/03
2993

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03
2994

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03
2995

An historical perspective on principles of osteopathy
Stark, J. E.
International Journal of Osteopathic Medicine, 2013/03
2996

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
2997

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
2998

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03
2999

Osteopathie im Kontext der italienischen Politik
(Osteopathy in the context of Italian politics)
Tozzi, P.
Osteopathische Medizin, 2013/03
3000

Osteopathische Aspekte der Haltungsasymmetrie des Säuglings – eine funktionelle Betrachtung
(Osteopathic aspects of infantile postural asymmetry – A functional examination)
Riedel, M.
Osteopathische Medizin, 2013/03
3001

Enuresis als Folge eines erhöhten Drucks in den Kavitäten – ein Fallbeispiel
(Enuresis as a consequence of an increased pressure in the cavities – A case study)
Klein, M.
Osteopathische Medizin, 2013/03
3002

Gehirn und Osteopathie – Kongress der Osteopathie Schule Deutschland in Berlin
(Brain and osteopathy – Congress of the Osteopathy School Germany in Berlin)
Goldenstein, R.
Osteopathische Medizin, 2013/03
3003

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Study of the influence of osteopathy on obstructive sleep apnea syndrome)
Dahlke, J.
Osteopathische Medizin, 2013/03
3004

Osteopathic manual treatment and ultrasound therapy for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Minotti, D. E., Gatchel, R. J., Kearns, C. M., Singh, K. P.
Annals of Family Medicine, 2013/03
Free full text
3005

Special issue: Osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2013/03
3006

An Exploration of Emerging Professional Identity in Women Osteopathic Medical Students: Does Gender Matter?
Dunatov, L. J.
Unpublished Dissertation, 2013/03
3007

Effect of osteopathic manipulative treatment on incidence of postoperative ileus and hospital length of stay in general surgical patients
Baltazar, G. A., Betler, M. P., Akella, K., Khatri, R., Asaro, R., Chendrasekhar, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3008

Somatic hygiene: osteopathic manipulative medicine as preventive treatment
Bowers, R. J.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3009

Osteopathic manipulative treatment for colonic inertia
Cohen-Lewe, A.
The Journal of the American Osteopathic Association, 2013/03
Free full text
3010

Osteopathic manipulative treatment for Lyme disease-induced Bell’s palsy: A case study
Baker, J. P., Baker, C. D.
The AAO Journal, 2013/03
Free full text
3011

Evaluating teaching methods and assessment tools of high velocity low amplitude techniques for undergraduate osteopathic manipulative treatment of the spine
Channell, M. K.
The AAO Journal, 2013/03
Free full text
3012

Osteopathic manipulative treatment of pes anserine bursitis using the triple technique: A case report
Chmielewski, R., Peña, N., Capalbo, G.
The AAO Journal, 2013/03
Free full text
3013

Sensory integration syndrome or developmental coordination disorder: A case report
Crow, T.
The AAO Journal, 2013/03
Free full text
3014

Gait disturbance in the elderly: Contribution of an osteopathic treatment
Huard, Y.
The AAO Journal, 2013/03
Free full text
3015

Normalization of thoracoabdominal fascial and autononic tone: A case study for the diagnosis and treatment of atypical chest pain
Litman, R. G.
The AAO Journal, 2013/03
Free full text
3016

Sequelae of traumatic closed-head injury: A case report of a 71-year-old male seen forty years later
Litman, R. G.
The AAO Journal, 2013/03
Free full text
3017

‘POSTE’ study (Patients OSTeopathic Experience): A UK national survey of patients: Part III
Drysdale, I. P., Rolfe, K. J., Hinkley, H.
International Journal of Osteopathic Medicine, 2013/03
3018

Patients' expectations of private osteopathic care in the UK: A national survey of patients
Leach, J. M. C., Mandy, A., Cross, V., Fawkes, C. A., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03
3019

Langzeiteffekte osteopathischer Behandlungen bei chronischer Prostatitis/chronischem Beckenschmerzsyndrom : 5-Jahres-Follow-up einer randomisiert kontrollierten Studie und Uberlegungen zum pathophysiologischen Kontext.
(Long-term effects of osteopathic treatment of chronic prostatitis with chronic pelvic pain syndrome: a 5-year follow-up of a randomized controlled trial and considerations on the pathophysiological context)
Marx, S., Cimniak, U., Rutz, M., Resch, K.L.
Urologe A, 2013/03
3020

Neoplasmas ósseos e osteopatia hipertrófica em cães
(Bone neoplasms and hypertrophic osteopathy in dogs)
Trost, M. E.
Unpublished Dissertation, 2013/02
Free full text
3021

Referrals to chiropractors and osteopaths: a survey of general practitioners in rural and regional New South Wales, Australia
Wardle, J. L., Sibbritt, D. W., Adams, J.
Chiropractic & Manual Therapies, 2013/02
Free full text
3022

How patients choose osteopaths: a mixed methods study
Bishop, F. L., Bradbury, K., Hj Jeludin, N. N., Massey, Y., Lewith, G. T.
Complementary Therapies in Medicine, 2013/02
3023

Strain-counterstrain to treat restrictions of the mobility of the cervical spine in patients with neck pain: a sham-controlled randomized trial
Klein, R., Bareis, A., Schneider, A., Linde, K.
Complementary Therapies in Medicine, 2013/02
Free full text
3024

Charakteristik von Nebenwirkungen, die im Rahmen der Osteopathieausbildung bei Studenten auftreten (im Vergleich zu Nebenwirkungen, die im Rahmen der Chiropraxisausbildung auftreten)
(Adverse events sustained by osteopathic students during their undergraduate training at an osteopathic school (compared with adverse events sustained by chiropractic students during their undergraduate training))
Steger, S.
Unpublished MSc thesis, 2013/02
3025

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text
3026

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
3027

Pain research in complementary and alternative medicine in Australia: a critical review
Zheng, Z., Xue, C. C.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text
3028

Efeitos da técnica de strain-counterstrain sobre os músculos mastigatórios em mulheres com disfunção temporomandibular
(Effects of strain-counterstrain technique in masticatory muscles of women with temporomandibular disorder: a randomized double-blind placebo-controlled trial)
Stefanelli, V. C.
Unpublished MSc thesis, 2013/02
Free full text
3029

Fracture healing with osteopathy in traditional Mongolian medicine
Zhao, N., Wang, M., Li, X.
Journal of Traditional Chinese Medicine, 2013/02
Free full text
3030

Headache in children: update on complementary treatments
Schetzek, S., Heinen, F., Kruse, S., Borggraefe, I., Bonfert, M., Gaul, C., Gottschling, S., Ebinger, F.
Neuropediatrics, 2013/02
Free full text
3031

Comparison of gait training versus cranial osteopathy in patients with Parkinson's disease: a pilot study
Muller, T., Pietsch, A.
NeuroRehabilitation, 2013/02
3032

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3033

Polytrauma durch Motorradunfall
(Polytrauma due to motorcycle accident)
Koop, J. P.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3034

Die Rolle des Diaphragmas bei der lymphatischen Absorption aus der Peritonealhöhle
(The role of the diaphragm in lymphatic absorption from the peritoneal cavity)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3035

Im Gespräch mit … Tom Shaver
(In dialog with Tom Shaver)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3036

Der Einfluss einer manipulativen Technik auf den Occiput-Atlas-Axis-Komplex (OAA) im Vergleich zu einer lokalen Wärmebehandlung des OAA-Bereiches auf die habituelle Okklusion
(The influence of manipulative treatment of the Occiput Atlas Axis (OAA) Complex in comparison to a local heat application of the OAA Complex on habitual occlusion)
Haase, H.
Unpublished MSc thesis, 2013/01
3037

Untersuchung der Wirksamkeit der Osteopathie im Rahmen der gesundheitsbedingten Lebensqualität im Wochenbett
(Investigating the efficacy of Osteopathy in Childbed - regarding the health related quality of life of the mothers)
Dlugos, J. M.
Unpublished MSc thesis, 2013/01
Free full text
3038

Beschwerden in der Schwangerschaft – Kann Osteopathie die Lebensqualität beeinflussen?
(Complaints during pregnancy – Can osteopathy influence the patient’s quality of life?)
Göttlich, G.
Unpublished MSc thesis, 2013/01
Free full text
3039

Osteopathic manipulative treatment (OMT) for lower urinary tract symptoms (LUTS) in women
Franke, H., Hoesele, K.
Journal of Bodywork and Movement Therapies, 2013/01
3040

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3041

Evidencia científica del movimiento respiratorio primario y su aceptación en las diferentes escuelas de osteopatía del mundo
(Scientific evidence of the primary respiratory movement and its acceptance in the different osteopathic schools of the world)
Caicedo Ocampo, M. d. P.
Unpublished MSc thesis, 2013/01
Free full text
3042

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3043

Die Rolle der Osteopathie im Umgang mit Trauma – ein persönlicher Bericht
(The role of osteopathy in dealing with trauma - a personal account)
Brown, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3044

Empatía en médicos con experiencia en Medicina Alternativa
(Empathy in physicians with experience in Alternative Medicine)
Hernández Vela, S.
Unpublished MSc thesis, 2013/01
Free full text
3045

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3046

Biotensegrity: a unifying theory of biological architecture with applications to osteopathic practice, education, and research--a review and analysis
Swanson, R. L.
The Journal of the American Osteopathic Association, 2013/01
Free full text
3047

A comparative study of cervical hysteresis characteristics after various osteopathic manipulative treatment (OMT) modalities
Barnes, P. L., Laboy, F., Noto-Bell, L., Ferencz, V., Nelson, J., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2013/01
3048

Manual therapy for childhood respiratory disease: a systematic review
Pepino, V. C., Ribeiro, J. D., Ribeiro, M. A., de Noronha, M., Mezzacappa, M. A., Schivinski, C. I.
Journal of Manipulative and Physiological Therapeutics, 2013/01
3049

Investigating inter-relationships between pain, mobility, and posture following osteopathic treatment in patients with chronic neck pain
Frith, K. L.
Unpublished MSc thesis, 2013/01
Free full text
3050

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01
3051

Thermographic Skin Measurement and Osteopathic Palpation of Tibial Interosseous Strains in Adults A Comparative Pilot Study.
Muntinga, E.
Unpublished D.O. thesis, 2013
3052

A six year head-to-head comparison of osteopathic and allopathic applicants to a university-based, allopathic general surgery residency
Schlitzkus, L. L., Clark, C. J., Agle, S. C., Schenarts, P. J.
Journal of Surgical Education, 2012/12-11
Free full text
3053

An investigation of cranial motion through a review of biomechanically based skull deformation literature
Seimetz, C. N., Kemper, A. R., Duma, S. M.
International Journal of Osteopathic Medicine, 2012/12
3054

Manual therapy for chronic obstructive airways disease: a systematic review of current evidence
Heneghan, N. R., Adab, P., Balanos, G. M., Jordan, R. E.
Manual Therapy, 2012/12
Free full text
3055

Nouvelle technique passive d’ouverture de la trompe d’Eustache. Évaluation par tympanométrie de l’effet d’une nouvelle manipulation sur l’ouverture de la trompe d’Eustache chez les enfants de moins de six ans atteints d’une otite moyenne avec ou sans effusion
(New passive technique for opening the Eustachian tube. Evaluation by tympanometry of the effect of a new manipulation on the opening of the Eustachian tube in children under six years of age with otitis media with or without effusion)
El Hachem, N., Halimi, M.
Kinésithérapie, la Revue, 2012/12
Free full text
3056

Osteopathic diagnosis and treatment of sacral fracture: A case study
Dean, A. L.
The AAO Journal, 2012/12
Free full text
3057

Konferenz der Osteopathic International Alliance 2012 in Paris
(Conference of the Osteopathic International Alliance, Paris 2012)
Mayer, J.
Osteopathische Medizin, 2012/12
3058

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12
3059

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12
3060

Osteopathische manuelle Behandlung von Scharlach bei Kindern im 19. und 20. Jahrhundert
(Osteopathic manual treatment of scarlet fever in children in the 19th and 20th centuries)
Liem, T., Ciranna-Raab, C.
Osteopathische Medizin, 2012/12
3061

Interview mit Theodor Dierk Petzold über Salutogenese und Osteopathie
(Interview with Theodor Dierk Petzold on salutogenesis and osteopathy)
Petzold, T. D.
Osteopathische Medizin, 2012/12
3062

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12
3063

Methods of assessment used by osteopathic educational institutions
Vaughan, B., Sullivan, V., Gosling, C., McLaughlin, P., Fryer, G., Wolff, M., Gabb, R.
International Journal of Osteopathic Medicine, 2012/12
3064

VOD-Kongress 2012 in Weimar – „The Embryo and the Health”
(Weimar's 2012 VOD-Congress - 'The Embryo and the Health')
Risch, A. J.
Osteopathische Medizin, 2012/12
3065

Manipulative therapies for infantile colic
Dobson, D., Lucassen, P. L., Miller, J. J., Vlieger, A. M., Prescott, P., Lewith, G.
Cochrane database of systematic reviews, 2012/12
Free full text
3066

Craniosacral therapy: a systematic review of the clinical evidence
Ernst, E.
Focus on Alternative and Complementary Therapies, 2012/12
3067

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3068

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3069

Electronic Medical Records Adoption and Usage Among Osteopathic Physicians in New York State
Rosenthal, J. I.
Unpublished PhD thesis, 2012/12
3070

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3071

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3072

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3073

Depression, somatization, and somatic dysfunction in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Gatchel, R. J., Kearns, C. M., Minotti, D. E.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3074

Touch - more than a basic science
Lalonde, F.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3075

Manipulation of the coccyx with anesthesia for the management of coccydynia
Emerson, S. S., Speece III., A. J.
The Journal of the American Osteopathic Association, 2012/12
Free full text
3076

The effect of osteopathic manual therapy on the vascular supply to the lower extremity in individuals with knee osteoarthritis: A randomized trial
Jardine, W. M., Gillis, C., Rutherford, D.
International Journal of Osteopathic Medicine, 2012/12
3077

A research protocol to determine if OMM is effective in decreasing pain in chronic pain patients and decreasing opioid use: Brief report
Smith, J. B., Ridpath, L. C., Steele, K. M.
The AAO Journal, 2012/12
Free full text
3078

Investigation into the role subject foot position has on the assessment of the Seated Flexion Test and a test of inter-rater reliability
Silva, M. J., Boudakian, C., Hruby, R.
The AAO Journal, 2012/12
Free full text
3079

Isolated calcaneofibular ligament injuries treated with osteopathic manipulative treatment: A case series
Olds, K., Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/12
3080

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3081

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3082

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3083

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3084

Complementary and Alternative Therapies in Surgical Care
Bjerså, K.
Unpublished PhD thesis, 2012/11
Free full text
3085

Osteopathic manipulative treatment: much more than simply a “hands-on“ phenomenon
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text
3086

Die osteopathische Behandlung von Frauen mit Gebärmuttersenkung. Randomisierte kontrollierte Studie.
(Osteopathic treatment of women with pelvic organ prolapse. A randomized controlled trial)
Amendt, J., Thannheimer, Y.
Unpublished D.O. thesis, 2012/10
3087

Die möglichen Effekte von osteopathischen Behandlungen bei komatösen Patienten mit erhöhtem Hirndruck
(Possible effects of osteopathic treatments in comatose patients with intracranial hypertension. Exploratory Observational Study)
Arens, O., Blum, A., Braun, S.
Unpublished D.O. thesis, 2012/10
3088

Bemerkenswerte Fortschritte bei behinderten Patienten durch „evolutionäre Osteopathie“
(Remarkable progress in disabled patients through “evolutionary osteopathy“)
Deslee, E., Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3089

Einfluss der osteopathischen Behandlung auf die Lebensqualität von Kindern und Jugendlichen mit Asthma. Prä-Post Studie.
(The influence of osteopathic treatment on quality of life in children and adolescents with asthma. A pre-post study)
Berning, F., Hagoort, J.
Unpublished D.O. thesis, 2012/10
3090

Effektivität der osteopathischen Behandlung bei Patienten mit „Trockenem Auge“. Randomisierte kontrollierte Studie.
(The effectiveness of osteopathic treatment in patients suffering from dry eye disease (DED). A randomized controlled study)
Biwer, A.
Unpublished D.O. thesis, 2012/10
3091

Osteopathische Behandlung von Patienten mit Restless-Legs-Syndrom. Randomisierte kontrollierte Studie.
(Osteopathic treatment of patients with restless legs syndrome. Randomized controlled trial)
Bonacker, M., Gabriel, S., Ruchser, J.
Unpublished D.O. thesis, 2012/10
3092

Why reservations remain: a critical reflection about the systematic review and meta-analysis “Osteopathic manipulative treatment for low back pain“ by Licciardone et al
Franke, H.
Journal of Bodywork and Movement Therapies, 2012/10
3093

(Evaluation of the Effectiveness of Osteopathic Treatment on Cholesterol Levels in Patients Suffering from Hypercholesterolemia. A randomized controlled study)
Eggers, G.
Unpublished D.O. thesis, 2012/10
3094

Die Auswirkungen von osteopathischen Behandlungen bei Patient/innen mit dem Fibromyalgiesyndrom. Prä-Post Studie.
(Osteopathic treatment effects in patients with fibromyalgia. Pre-Post Study)
Gleich, A., Klein, C., Sheriff, S.
Unpublished D.O. thesis, 2012/10
3095

(Osteopathic treatment of patients with shoulder pain. A randomized controlled study)
Hinse, T., Klosterkamp, M.
Unpublished D.O. thesis, 2012/10
3096

Können osteopathische Behandlungen die Symptomatik sowie die Häufigkeit des chronischen Spannungskopfschmerzes verbessern? Randomisierte kontrollierte Studie.
(Can osteopathic treatments improve the symptoms and the frequency of Chronic Tension-Type headache (CTTH)? A randomized controlled trial)
Koralewski, D., Kothe, M., Schröter, C.
Unpublished D.O. thesis, 2012/10
3097

Evaluation der Interindividuellen Reliabilität eines osteopathischen Gewebetests (Gesamtgewebe-Restriktions-Tests/All Tissue Tension Test). Eine diagnostische Studie.
(The All Tissue Tension Test (A Triple T): Evaluation of Interrater Reliability. Diagnostic Study)
Krieger, A., Roggendorf, M.
Unpublished D.O. thesis, 2012/10
3098

Wirkung von osteopathischen Behandlungen bei Kindern mit Rechenstörungen in der 3. Klasse Grundschule. Eine randomisierte kontrollierte Studie.
(To evaluate the effectiveness of osteopathic treatment in 3rd elementary school class children suffering from dyscalculia. A randomized controlled trial)
Nickels-Kratz, K.
unpublished D.O. thesis, 2012/10
3099

Über die Ursprünge der Biodynamik in der Osteopathie. Sind Grundzüge des Biodynamischen Gedankengutes schon in den Aussagen von A. T. Still zu finden? Eine historische Literaturübersicht
(The origins of biodynamics in osteopathy. Can principles of biodynamic ideas already be detected in statements of A.T. Still? Basic Research)
Roth, R.
Unpublished D.O. thesis, 2012/10
3100

Die osteopathische Behandlung bei Frauen mit persistierenden Rückenschmerzen post partum. Randomisierte kontrollierte Studie.
(Osteopathic treatment in women with persistent low back pain after childbirth. A randomized controlled trial)
Rother, D., Rother, K.
Unpublished D.O. thesis, 2012/10
3101

Die Beweglichkeit des Dünndarms bei In- und Exspiration
(The mobility of the small intestine during inspiration and expiration)
Schröter, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3102

Wirksamkeit osteopathischer Behandlungen bei Kindern mit habitueller, idiopathischer Epistaxis. Randomisierte kontrollierte Studie
Effectiveness of osteopathic treatment in children with . A randomized controlled trial.
Bergau, R, Strunk, A
Unpublished D.O. thesis, 2012/10
3103

Im Gespräch mit … Carol Trowbridge
(In conversation with Carol Trowbridge)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3104

The immediate effects of sigmoid colon manipulation on pressure pain thresholds in the lumbar spine
McSweeney, T. P., Thomson, O. P., Johnston, R.
Journal of Bodywork and Movement Therapies, 2012/10
Free full text
3105

971 Neonatology-Osteopathy (Ne-O) Study: RCT on the Effect of Osteopathic Manipulative Treatment on Los
Accorsi, A., Lucci, C., Pizzolorusso, G., Tubaldi, L., Cerritelli, F., Perri, F. P.
Archives of Disease in Childhood, 2012/10
3106

Osteopathic manipulative treatment in obese patients with chronic low back pain: a pilot study
Vismara, L., Cimolin, V., Menegoni, F., Zaina, F., Galli, M., Negrini, S., Villa, V., Capodaglio, P.
Manual Therapy, 2012/10
Free full text
3107

Geographic patterns in primary care visits provided by osteopathic physicians
Licciardone, J. C.
Family Medicine, 2012/10
3108

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10
3109

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3110

Combined manual therapy techniques for the treatment of women with infertility: a case series
Kramp, M. E.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3111

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text
3112

Die physiologische Entwicklung in den ersten Lebensjahren
(The physiological development in the first years of life)
Guerassimiouk, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10
3113

Consent in osteopathy: A cross sectional survey of patients' information and process preferences
Daniels, G., Vogel, S.
International Journal of Osteopathic Medicine, 2012/09
3114

Osteopathic manipulative treatment of somatic dysfunction as an integral component in the care of patients with chronic medical disease: A thirty-month study in rural Appalachia
Litman, R. G.
The AAO Journal, 2012/09
Free full text
3115

Osteopathic education: Editorial call for papers
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2012/09
3116

An open letter to those in purely osteopathic manipulative medicine practices on reimbursement strategies
Jorgensen, D. J.
The AAO Journal, 2012/09
3117

Follow-up to: OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2012/09
Free full text
3118

Using manual and conventional therapies to enhance musculoskeletal health: highlights of the Osteopathic Research Center's 10th Anniversary Conference
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3119

WSO feiert 20-jähriges Bestehen mit Sommerfest und Sommerakademie
(The Vienna School of Osteopathy (WSO) celebrates 20th year of existence with summer festival and summer academy)
Risch, A. J.
Osteopathische Medizin, 2012/09
3120

Metaphern für Gesundheit – Gesundheit als Metapher
(Metaphors for health - Health as metaphor)
Risch, A. J.
Osteopathische Medizin, 2012/09
3121

Funktionsstörungen des Ösophagus und des gastro-ösophagealen Übergangs: Techniken zur Behandlung
(Functional disorders of the esophagus and esophagogastric junction: Techniques for the treatment)
Scheuerer, L. M., Raab, M.
Osteopathische Medizin, 2012/09
3122

Interview mit Jane Stark über die biografischen Quellen der Osteopathie
(Interview with Jane Stark on the biographical sources of osteopathy)
Stark, J.
Osteopathische Medizin, 2012/09
3123

Osteopathie bei Infantiler Zerebralparese – Pilotstudie Kann durch craniale Behandlung ein positiver Effekt auf die Gelenksbeweglichkeit bei Infantiler Zerebralparese erzielt werden?
(Osteopathic Treatment in Cases of Infantile Cerebral Palsy – Pilot Study Does cranial treatment achieve a positive effect on joint mobility in cases of infantile cerebral palsy?)
Palko, P.
Unpublished MSc thesis, 2012/09
Free full text
3124

Die Anamnese in der Osteopathie - Theorie und Praxis
(Case History Taking in Osteopathy - Theory and Practice)
Mena, J. E.R.
Unpublished MSc thesis, 2012/09
Free full text
3125

Osteopathie und ihre Effektivität bei Fasciitis plantaris
(Osteopathy and its effectiveness in fasciitis plantaris)
Burmeister, S.
Unpublished MSc thesis, 2012/09
Free full text
3126

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving the quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Gulisano, V., Orfei, S.
Clinical Cases in Mineral and Bone Metabolism, 2012/09
Free full text
3127

Einfluss der osteopathischen Behandlung auf die Blutdruckwerte bei Patienten mit essentieller arterieller Hypertonie
(Influence of Osteopathic Treatment on Blood Pressure Values of Patients with Essential Arterial Hypertension)
Wasserfaller, A.
Unpublished MSc thesis, 2012/09
Free full text
3128

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3129

Advancing osteopathic medicine through research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3130

Associations of cytokine concentrations with key osteopathic lesions and clinical outcomes in patients with nonspecific chronic low back pain: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M., Hodge, L. M., Bergamini, M. V.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3131

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3132

Precompetition manipulative treatment and performance among Virginia Tech athletes during 2 consecutive football seasons: a preliminary, retrospective report
Brolinson, P. G., Smolka, M., Rogers, M., Sukpraprut, S., Goforth, M. W., Tilley, G., Doolan, K. P.
The Journal of the American Osteopathic Association, 2012/09
Free full text
3133

Neuropathy of the inferior alveolar nerve: A case report
Seals, R. A., Crow, T.
The AAO Journal, 2012/09
Free full text
3134

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text
3135

Synergopathic medicine and the cranial concept in the successful treatment of a patient with acute paralytic ileus: A case report
Pribadi, K. S.
The AAO Journal, 2012/09
Free full text
3136

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the USMLE
Lenchus, J. D.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3137

What puts the adverse in 'adverse events'? Patients' perceptions of post-treatment experiences in osteopathy - a qualitative study using focus groups
Rajendran, D., Bright, P., Bettles, S., Carnes, D., Mullinger, B.
Manual Therapy, 2012/08
3138

Health-related Internet use among patients of osteopathic physicians
Cooley, D. L., Mancuso, A. M., Weiss, L. B., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3139

Osteopathy improves the severity of irritable bowel syndrome: a pilot randomized sham-controlled study
Florance, B. M., Frin, G., Dainese, R., Nebot-Vivinus, M. H., Marine Barjoan, E., Marjoux, S., Laurens, J. P., Payrouse, J. L., Hebuterne, X., Piche, T.
European Journal of Gastroenterology & Hepatology, 2012/08
Free full text
3140

Psoas syndrome: a frequently missed diagnosis
Tufo, A., Desai, G. J., Cox, W. J.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3141

Preventative Osteopathic Manipulative Treatment and the Elderly Nursing Home Resident: A Pilot Study
Snider, K. T., Snider, E. J., Johnson, J. C., Hagan, C., Schoenwald, C.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3142

Touch: vital to patient-physician relationships
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3143

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3144

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3145

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text
3146

Putting on White Coats: Professional Socialization of Medical Students Through Narrative Pedagogy in Standardized Patient Labs
Patterson, S. D.
Unpublished PhD thesis, 2012/08
Free full text
3147

Quels traitements pour les coliques du nourrisson?
(Which treatments for infantile colics?)
Bruyas-Bertholon, V., Lachaux, A., Dubois, J.P., Fourneret, P., Letrilliart, L.
La Presse Médicale, 2012/07-08
3148

Selbst anzuwendende Übungen für Patienten im osteopathischen Kontext
(Home-based exercises for patients in the osteopathic context)
Resch, A.
Unpublished MSc thesis, 2012/07
Free full text
3149

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3150

Im Gespräch mit … Myriam Vleminckx
(In dialog with Myriam Vleminckx)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3151

„Sacral Sag“ und mögliche klinische Folgen
(“Sacral Sag“ and possible clinical consequences)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3152

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3153

Increase of lower esophageal sphincter pressure after osteopathic intervention on the diaphragm in patients with gastroesophageal reflux
da Silva, R. C., de Sa, C. C., Pascual-Vaca, A. O., de Souza Fontes, L. H., Herbella Fernandes, F. A., Dib, R. A., Blanco, C. R., Queiroz, R. A., Navarro-Rodriguez, T.
Diseases of the Esophagus, 2012/07
Free full text
3154

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3155

Kreuzschmerzen während der Schwangerschaft
(Low back pain during pregnancy)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07
3156

Osteopathic manipulative treatment to resolve head and neck pain after tooth extraction
Meyer, P. M., Gustowski, S. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3157

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3158

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3159

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3160

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text
3161

The safety and efficacy of osteopathic manipulation in the treatment of mTBI (mild traumatic brain injury) in U.S. service members as validated by SPECT scan: A report of planned research
Nevins, N. A., Fraix, M.
The AAO Journal, 2012/06
Free full text
3162

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06
3163

Bericht über die AAO-Convocation 2012 in Louisville
(Report of the AAO-Convocation, Louisville 2012)
Osteopathische Medizin, 2012/06
3164

Interview mit Jaap van der Wal über die Embryologie und ihre Bedeutung für die Osteopathie
(Interview with Jaap van der Wal on embryology and its significance for osteopathy)
van der Wal, J.
Osteopathische Medizin, 2012/06
3165

Osteopathic physicians and international medical graduates in the rural primary care physician workforce
Fordyce, M. A., Doescher, M. P., Chen, F. M., Hart, L. G.
Family Medicine, 2012/06
3166

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06
3167

Osteopathic manipulative medicine for carpal tunnel syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3168

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3169

Rigor in medical writing: quoting accurately
Patterson, M. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3170

Osteopathic manipulative treatment in pregnant women
Lavelle, J. M.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3171

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text
3172

Application of osteopathic manipulative treatment to a patient with unremitting chest pain and shortness of breath undergoing “Rule-Out Myocardial Infarction” protocol for one week
Berkowitz, M. R.
International Journal of Osteopathic Medicine, 2012/06
3173

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3174

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3175

Thanks but no thanks: how denial of osteopathic service in the world wars shaped the profession
Schriner, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3176

Efficacy of osteopathic manipulative treatment for low back pain in euhydrated and hypohydrated conditions: a randomized crossover trial
Parker, J., Heinking, K. P., Kappler, R. E.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3177

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text
3178

Osteopathic treatment of chronic gonalgia in the elderly: Changes in pain and posture
Huard, Y.
The AAO Journal, 2012/04
Free full text
3179

Kopfschmerzen: Behandlung nach dem Fasziendistorsionsmodell
(Headache: treatment according to the fascial distortion model)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3180

Im Gespräch mit … Lorenz Wilkens
(In dialog with Lorenz Wilkens)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3181

Assessment of Low Back and Pelvic Pain after applying the Pelvis Global Manipulation Technique in Patients with Primary Dysmenorrhea: A Pilot Study
Molins-Cubero, S., Boscá-Gandia, J. J., Rus-Martinez, M. A.
European Journal Osteopathy & Related Clinical Research, 2012/04
Free full text
3182

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3183

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3184

Wie Vorstellungen die Beschwerden der Patienten beeinflussen
(How beliefs influence patient discomforts)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3185

Dysfunktionen der Faszien als beschwerdeunterhaltender Faktor
(Dysfunctions of the fascia as a complaint-sustaining factor)
Forner, K.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04
3186

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3187

Prediction of Osteopathic Medical School Performance on the basis of MCAT score, GPA, sex, undergraduate major, and undergraduate institution
Dixon, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text
3188

What’s in a Name? A Brief Look at the History of Board Certification in Neuromusculoskeletal Medicine and Osteopathic Manipulative Medicine
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
3189

Redirect terminology debate toward improved definition of osteopathic medicine
Ching, L. M.
The Journal of the American Osteopathic Association, 2012/03
Free full text
3190

Wasser, Licht, Luft, Eis und das 16. Europäische Symposium der Traditionellen Osteopathie
(Report: Water, light, air, ice and the 16th European Symposium of Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2012/03
3191

Interview mit Prof. Matthias Beck, AVT-College, Nagold
(Interview with Prof. Matthias Beck, AVT-College, Nagold)
Beck, M.
Osteopathische Medizin, 2012/03
Free full text
3192

Osteopathische Therapie in der Migränebehandlung: eine randomisierte kontrollierte Studie über die Wirksamkeit
(Osteopathic medicine: Osteopathic therapy in the treatment of migraine: A randomized controlled study about the effectiveness)
Burmeister, U., Beck, M., Voigt, K., Liebnitzky, J., Bergmann, A.
Osteopathische Medizin, 2012/03
3193

Interview mit Christian Ciranna-Raab, Osteopathie Schule Deutschland
(Interview with Christian Ciranna-Raab, Osteopathische Schule Deutschland)
Ciranna-Raab, C.
Osteopathische Medizin, 2012/03
Free full text
3194

Interview mit Prof. Dietmar Daichendt, Hochschule für Gesundheit und Sport
(Interview with Prof. Dietmar Daichendt, University for Health and Sports)
Daichendt, D.
Osteopathische Medizin, 2012/03
Free full text
3195

Interview mit Raimund Engel, Donau Universität Krems
(Interview with Raimund Engel, Danube University Krems)
Engel, R.
Osteopathische Medizin, 2012/03
Free full text
3196

Interview mit Marina Fuhrmann, Hochschule Fresenius, Idstein
(Interview with Marina Fuhrmann, Hochschule Fresenius, Idstein)
Fuhrmann, M.
Osteopathische Medizin, 2012/03
Free full text
3197

Interview mit Dr. med. Bernhard Hartwig, IKT, München
(Interview with Dr. med. Bernhard Hartwig, IKT, Munich)
Hartwig, B.
Osteopathische Medizin, 2012/03
Free full text
3198

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03
3199

Osteopathiestudium in Deutschland und Österreich
(Osteopathy studies in Germany and Austria)
Newiger, C.
Osteopathische Medizin, 2012/03
3200

Kopfschmerzbehandlung – Gedanken aus dem Praxisalltag
(Practice and technique: Treatment of headache - Thoughts from the practical daily routine)
Unverricht, R.
Osteopathische Medizin, 2012/03
3201

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03
3202

Interview mit Claudia Wiederin, fhg, Innsbruck
(Interview with Claudia Wiederin, fhg, Innsbruck)
Wiederin, C.
Osteopathische Medizin, 2012/03
Free full text
3203

Low back pain and kidney mobility: local osteopathic fascial manipulation decreases pain perception and improves renal mobility
Tozzi, P., Bongiorno, D., Vitturini, C.
Journal of Bodywork and Movement Therapies, 2012/03
3204

Chiropractic or Osteopathic Manipulation for Children in the United States: An Analysis of Data from the 2007 National Health Interview Survey
Ndetan, H., Evans, M. W., Hawk, C., Walker, C.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
3205

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text
3206

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text
3207

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text
3208

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text
3209

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text
3210

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text
3211

Anterior hip pain – Have you considered femoroacetabular impingement?
Chakraverty, J. K., Snelling, N. J.
International Journal of Osteopathic Medicine, 2012/03
3212

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03
3213

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text
3214

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text
3215

„Was Sie machen, ist doch keine Osteopathie!“ – Ansätze zu einem konsensfähigen Selbstverständnis
(“What you are doing is not osteopathy after all!“ - Approaches to a consensual self-image)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3216

Wie viel Differenzialdiagnostik braucht die Osteopathie?
(How much differential diagnostics does osteopathy need?)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3217

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3218

Die ersten Tage der DO … Aus dem Nähkästchen geplaudert
(The first days of the DO - telling it all)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3219

Hat der Osteopath einen bestimmten Persönlichkeitstypus?
(What is the personality type of an osteopath?)
Och, V.
Unpublished MSc thesis, 2012/02
Free full text
3220

Über den Zugang von Osteopathen zu erwachsenen Patienten im neurologischen Bereich in Österreich
(About the access of osteopaths to adult patients in the neurological field in Austria)
Müntner, A.
Unpublished MSc thesis, 2012/02
Free full text
3221

Ankommen in der Gegenwart oder ist die Osteopathie noch zu retten?
(Arriving in the present or can osteopathy still be saved?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3222

A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel
Cruser d, A., Maurer, D., Hensel, K., Brown, S., White, K., Stoll, S.
Journal of Manual & Manipulative Therapy, 2012/02
3223

Osteopathische Einflussmöglichkeiten auf die fetale Kopfposition im mütterlichen Becken bei Erstgebärenden
(Osteopathic possibilities to influence the fetal head position in the maternal pelvis in primipara)
Wünsch, A.
Unpublished MSc thesis, 2012/02
Free full text
3224

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text
3225

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text
3226

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3227

Fasziendistorsionsmodell nach Typaldos im Routinebetrieb eines Ambulatoriums
(Fascial distortion model according to Typaldos in routine operation of an outpatient clinic)
Gallei, L.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3228

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02
3229

Osteopathie und ihre Wirkung auf lumbale, diskogene Radikulopathien bei CT -gezielt periradikulär infiltrierten Patienten
(Osteopathy and its effect on lumbar radicular pain related to patients with CT-guided nerve root infiltrations)
Rachinger, J.
Unpublished MSc thesis, 2012/01
Free full text
3230

Osteopathie und Palpation – ein psychophysikalischer Hintergrund
(Osteopathy and Palpation – A Psychophysical Approach)
Larcher-Schleich, K.
Unpublished MSc thesis, 2012/01
Free full text
3231

Untersuchung des Einflusses der Osteopathie auf das obstruktive Schlafapnoesyndrom
(Examination of the influence of osteopathy on the Obstructive Sleep Apnoea Syndrome)
Dahlke, J.
Unpublished MSc thesis, 2012/01
Free full text
3232

Vergleichende Analyse der Curricula der Osteopathie Ausbildungen mit Masterabschluss an der European School of Osteopathy, ESO, Großbritannien und der Internationalen Schule für Osteopathie, WSO, Österreich
(A Comparative Analysis of the Curricula of the European School of Osteopathy, ESO, UK and the International School of Osteopathy, WSO, Austria leading to a Master‘s Degree)
Düpree, B.
Unpublished MSc thesis, 2012/01
Free full text
3233

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text
3234

Lymphatic pump manipulation mobilizes inflammatory mediators into lymphatic circulation
Schander, A., Downey, H. F., Hodge, L. M.
Experimental Biology and Medicine, 2012/01
3235

Use of therapies other than disease-modifying agents, including complementary and alternative medicine, by patients with multiple sclerosis: a survey study
Stoll, S. S., Nieves, C., Tabby, D. S., Schwartzman, R.
The Journal of the American Osteopathic Association, 2012/01
Free full text
3236

Cranial osteopathic manipulative medicine's growing evidence base
King, H. H.
The Journal of the American Osteopathic Association, 2012/01
Free full text
3237

The immediate effect of osteopathic ‘rib raising’ technique on heart rate variability: a randomised sham controlled experiment
White, N.
Unpublished MSc thesis, 2012/01
Free full text
3238

A hypothesis to explain the palpatory experience and therapeutic claims in the practice of osteopathy in the cranial field
Hamm, D.
International Journal of Osteopathic Medicine, 2011/12
3239

Towards a more international community in osteopathy
Moran, R. W.
International Journal of Osteopathic Medicine, 2011/12
3240

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12
3241

Therapeutic effects of cranial osteopathic manipulative medicine: a systematic review
Jäkel, A., von Hauenschild, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
3242

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text
3243

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text
3244

Consulting parents about the design of a randomized controlled trial of osteopathy for children with cerebral palsy
Edwards, V., Wyatt, K., Logan, S., Britten, N.
Health Expectations, 2011/12
3245

Subjektive Krankheitstheorien bei Patienten mit lumbalem Rückenschmerz
(Subjective theories of illness of patients with low back pain)
Penger, S.
Unpublished MSc thesis, 2011/12
Free full text
3246

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12
3247

The 2011 Thomas L. Northup Memorial Lecture – A Road Less Traveled: Osteopathy’s Legacy, Osteopathic Medicine’s Challenge
Degenhardt, B. F.
The AAO Journal, 2011/12
Free full text
3248

Increasing the number of osteopathic graduate medical education programs–“The time has come…”
Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
3249

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text
3250

Interview mit Jean-Pierre Barral: „Nur das Gewebe weiß Bescheid“
(Interview with Jean-Pierre Barral: “only the tissue knows“)
Barral, J.P.
Osteopathische Medizin, 2011/12
3251

OMT and exercises for a patient with limited knee range of motion prior to knee replacement: A case report
Clark, R. C.
The AAO Journal, 2011/12
Free full text
3252

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text
3253

Osteopathischer Herbstgenuss in Potsdam
(Autumn osteopathic enjoyment in Potsdam)
Prediger, G.
Osteopathische Medizin, 2011/12
3254

Perspectives on quality assurance methods – A comparison of osteopathic programmes in two countries: A pilot study
Michelson, H. C.
Unpublished MSc thesis, 2011/12
Free full text
3255

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12
3256

Kranialer rhythmischer Impuls: Ist die palpierte Frequenz abhängig von der Berufserfahrung der Untersucher?
(Cranial rhythmic impulse: Is the palpation frequency dependent on the professional experience of the examiner?)
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
Osteopathische Medizin, 2011/12
3257

Wirksamkeit einer osteopathischen Behandlung bei Kinetose
(Effectiveness of an osteopathic treatment of motion sickness)
Thiel, O. L.
Osteopathische Medizin, 2011/12
3258

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text
3259

Sociodemographic and geographic characteristics associated with patient visits to osteopathic physicians for primary care
Licciardone, J. C., Singh, K. P.
BMC Health Services Research, 2011/11
Free full text
3260

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text
3261

Einfluss der Osteopathie bei Patienten mit schichtarbeitsbedingten Schlafstörungen
(Influence of osteopathy on patients with shiftwork-caused sleep disorders)
Brübach, S.
Unpublished MSc thesis, 2011/11
Free full text
3262

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text
3263

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text
3264

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3265

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text
3266

Patienteninfo: Obstruktive Bronchitis im Kindesalter
(Patient information: Obstructive bronchitis in childhood)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3267

Chronischer Schlafmangel aufgrund von Atmungsproblemen
(Chronic sleep deprivation due to respiratory problems)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3268

Osteopathische Behandlung der Lungenentzündung: schneller gesund, weniger Komplikationen
(Osteopathic treatment of pneumonia: faster recovery, fewer complications)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10
3269

Support for women in osteopathic medicine who breastfeed: a call for action
Pieh-Holder, K. L.
The Journal of the American Osteopathic Association, 2011/10
Free full text
3270

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3271

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09
3272

The effect of strain counterstrain (SCS) on forearm strength compared to sham positioning
Wong, C. K., Moskovitz, N., Fabillar, R.
International Journal of Osteopathic Medicine, 2011/09
3273

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Melnick, A.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3274

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text
3275

Ultrasonography-guided osteopathic manipulative treatment for a patient with thoracic outlet syndrome
Sucher, B. M.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3276

Hat eine Intervention an der Schädelbasis Einfluss auf das Prämenstruelle Syndrom?
(Does an intervention at the cranial base have an influence on premenstrual syndrome?)
Hödl, S.
Unpublished MSc thesis, 2011/09
Free full text
3277

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text
3278

Lebensqualitätssteigerung bei osteopathischer Behandlung
(Increased Quality of Life in Osteopathic Therapy)
Bordás, R.
Unpublished MSc thesis, 2011/09
Free full text
3279

Interrater-Reliabilität bei der Beurteilung der Körpersprache nach dem Fasziendistorsionsmodell (FDM)
(Interrater reliability in evaluating the body language based on the Fascial Distortion Model (FDM))
Anker, S.
Unpublished MSc thesis, 2011/09
Free full text
3280

Das autonome Nervensystem in der Osteopathie: Überblick über die therapeutischen Optionen
(The autonomic nervous system in osteopathy: Overview of therapeutic options)
Beck, A.K.
Osteopathische Medizin, 2011/09
3281

Neubewertung der klassischen osteopathischen Feldtheorie am Beispiel von Perzeption und Wahrnehmung
(Reevaluation of the classic osteopathic field theory using perception and cognition as example)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/09
3282

Situation der Osteopathie in Frankreich
(Situation of osteopathy in France)
Steringot, P.
Osteopathische Medizin, 2011/09
3283

Zahnmedizinische Begriffe für Osteopathen – eine Einführung
(Dental concepts for osteopaths - An introduction)
Hippel, S.
Osteopathische Medizin, 2011/09
3284

Interview mit Jim Jealous über Mentoren in der Osteopathie
(Interview with Jim Jealous on mentors in osteopathy)
Jealous, J. S.
Osteopathische Medizin, 2011/09
3285

Call for papers: An invitation to contribute to a special issue on osteopathic principles
Fryer, G.
International Journal of Osteopathic Medicine, 2011/09
3286

Medición de la emisión biofotónica antes y después de la intervención osteopática en pacientes con lumbalgia mecánica
(Measurement of biophotonic emission before and after osteopathic intervention in patients with mechanical low back pain)
Prieto Murillo, E. F.
Unpublished MSc thesis, 2011/09
Free full text
3287

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text
3288

Dynamics of indicators of quality of life in patients with chronic pain syndrome in the lumbus and lower extremities after osteopathic treatment
Yakovets, G. V., Novoseltsev, S. V.
The AAO Journal, 2011/09
Free full text
3289

From The Archives: Smith RK. Osteopathic Specialists. In: Webster GV. Concerning Osteopathy, revised ed. Carthage, NY: Floyd J. Rich; 1915, 157-164.
Smith, R. K.
The AAO Journal, 2011/09
Free full text
3290

Spondylogenic-cranial biomechanic disorders in patients with chronic cerebrovascular insufficiency in the vertebrobasilar basin and their osteopathic correction
Novoseltsev, S. V.
The AAO Journal, 2011/09
3291

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text
3292

Efecto de las técnicas de articulación y manipulación sobre los apoyos plantares en el antepié varo infantil
(Effect of articulation and manipulation techniques on plantar support in varus forefoot in children)
Ángeles Franco, M., Villarroya, A., Marcén, Y., Gómez-Gámez, A.
Osteopatía Científica, 2011/09
3293

Harold A. Blood, DO , FAAO , Memorial Lecture: 100 Years of Osteopathic Leadership
Dickey, J. L.
The AAO Journal, 2011/09
Free full text
3294

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09
3295

Osteopathic manual treatment of children with scarlet fever in the nineteenth and twentieth centuries
Liem, T., Ciranna-Raab, C.
The AAO Journal, 2011/09
Free full text
3296

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09
3297

Sprache und Kommunikation in der Osteopathie: Glossare im Internet
(Language and communication in osteopathy: glossaries on the Internet)
Risch, A. J.
Osteopathische Medizin, 2011/09
3298

Revisión sistemática del tratamiento manipulativo para el hombro doloroso
(A systematic review of manipulative therapy for the treatment of shoulder pain)
Pribicevic, M., Pollar, H., Bonell, R., de Luca, K.
Osteopatía Científica, 2011/09
3299

Criterios de calidad en investigación osteopática (III)
(Quality criteria for osteopathic research (III))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/09
3300

Research and treatment bulletin 1/2011
Blanchard, P.
International Journal of Osteopathic Medicine, 2011/09
3301

“Whatever you are, be a good one“: osteopathic identity, equality, and the California merger
Perrotta, A. L.
The Journal of the American Osteopathic Association, 2011/09
Free full text
3302

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text
3303

Lymphofaszialer Release (LFR) – Faszie und Fluida in einem
(Lympho-fascia release (LFR) - fascia and fluids in one)
Chikly, B., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3304

Lymphstau im linken Bein
(Lymphatic congestion in the left leg)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3305

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text
3306

Osteopathische Behandlung von Neugeborenen und Kleinkindern
(Osteopathic treatment of newborns and infants)
Nagel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3307

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3308

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text
3309

Patienteninfo: Lastenschiffer und Polizei – Lymphe und Lymphsystem
(Patient information: Cargo shippers and police - lymph and lymphatic system)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07
3310

Re: The Fall of the postural-structural-biomechanical model in manual therapy: exemplified by lower back pain. A response to reviewers and further thoughts
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/07
3311

Re: Is a postural-structural-biomechanical model, within manual therapy, viable? A JBMT debate
Franke, H.
Journal of Bodywork and Movement Therapies, 2011/07
Free full text
3312

Erzielt ein Cranial base release bei TMD - Patienten einen Effekt auf die maximale aktive Mundöffnung und die subjektive Schmerzwahrnehmung?
(Will a cranial base release have an effect by TMD - Patients on the maximum active mouth opening and the subjective perception of pain?)
Beisswenger, T.
Unpublished MSc thesis, 2011/07
Free full text
3313

An investigation into the transition from student to practising osteopath
Davidson, Y. M.
Unpublished MSc thesis, 2011/07
Free full text
3314

Therapie chronischer Rückenschmerzen: Vergleich der Wirksamkeit von Weichteilosteopathie gegenüber klassischer Krankengymnastik sowie einer Kombination beider Therapiearten mit einem Herzratenvariabilitätstraining
(Therapy of chronic back pain: Comparison of the effectivity of soft part osteopathy with conventional physiotherapy and a combination of both treatments with a heart rate variability training)
Beutinger, D.
Unpublished PhD thesis, 2011/07
Free full text
3315

A review of the breastfeeding literature relevant to osteopathic practice
Cornall, D.
International Journal of Osteopathic Medicine, 2011/06
3316

Opinions on research and evidence based medicine within the UK osteopathic profession: A thematic analysis of public documents 2003–2009
Humpage, C.
International Journal of Osteopathic Medicine, 2011/06
3317

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06
3318

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06
3319

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06
3320

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3321

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3322

Eine empirische Studie zum beruflichen Selbstverständnis von OsteopathInnen und deren Einstellung zur gesetzlichen Anerkennung der Osteopathie
(An Empirical Study on the Professional Self-Conception of Osteopaths and Their Attitude towards the Legal Acknowledgement of Osteopathy)
Riermeier, R.
Unpublished MSc thesis, 2011/06
Free full text
3323

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text
3324

Is it feasible and effective to provide osteopathy and acupuncture for patients with musculoskeletal problems in a GP setting? A service evaluation
Cheshire, A., Polley, M., Peters, D., Ridge, D.
BMC Family Practice, 2011/06
Free full text
3325

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text
3326

Osteopathic manipulative treatment in patients with low back pain
Licciardone, J. C.
Clinical Rheumatology, 2011/06
3327

Influence of craniosacral therapy on anxiety, depression and quality of life in patients with fibromyalgia
Mataran-Penarrocha, G. A., Castro-Sanchez, A. M., Garcia, G. C., Moreno-Lorenzo, C., Carreno, T. P., Zafra, M. D.
Evidence-Based Complementary and Alternative Medicine, 2011/06
Free full text
3328

Osteopathie bei Kindern und Jugendlichen mit juveniler idiopathischer Arthritis
(Osteopathy for children and adolescents with juvenile idiopathic arthritis)
Strohmayer, A.
Unpublished MSc thesis, 2011/06
Free full text
3329

Die Behandlung des Reizdarmsyndroms mit Osteopathie
(Treatment of irritable bowel syndrome with osteopathy)
Scheuchl, F. G.
Unpublished MSc thesis, 2011/06
Free full text
3330

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text
3331

Einfluss osteopathischer Behandlungen auf den Gesundheitszustand von Schichtarbeiter/innen in der baden-württembergischen Automobilindustrie, die in der Fließfertigung arbeiten
(Evaluation of the hypothesis whether osteopathic treatments have an influence on the general state of health of male and female shift workers working in flow production in the automotive industry of Baden-Wuerttemberg)
Mende-Geyer, E.
Unpublished MSc thesis, 2011/06
Free full text
3332

Überblick und Vergleich der in Österreich angebotenen Bildungsmöglichkeiten im Teilbereich Craniosacrale Osteopathie
(Overview and Comparison of the educational possibilities offered in Austria in the section craniosacralic osteopathy)
Berthold, L.
Unpublished MSc thesis, 2011/06
Free full text
3333

Wie ist der Status quo der emotionalen Kompetenz beiWSO-(Wiener Schule für Osteopathie) Abgängern in Österreich?
(What is the status quo of emotional competence among Vienna School of Osteopathy (WSO)graduates in Austria?)
Archer, B.
Unpublished MSc thesis, 2011/06
Free full text
3334

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text
3335

Klassische Osteopathie: eine Feldtheorie als Vorbild und Grundlage
(Classic osteopathy: A field theory as a model and basis)
Hartmann, C., Pöttner, M.
Osteopathische Medizin, 2011/06
3336

The use of videos in teaching psychomotor skills: A look at a new way of teaching osteopathic manipulative treatment to a remote campus
Ferronato, M., Hruby, R. J.
The AAO Journal, 2011/06
Free full text
3337

Patients’ perceptions of post-treatment experiences in osteopathy: A qualitative study using focus groups
Bright, P., Rajendran, D., Bettles, S., Carnes, D., Mullinger, B.
European Journal of Integrative Medicine, 2011/06
Free full text
3338

Osteopathic approach to a patient with chronic fatigue syndrome
Chong, A., Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
3339

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text
3340

Flawed science is not evidence-based osteopathic medicine
Berkowitz, M. R.
The AAO Journal, 2011/06
Free full text
3341

Die Folgen der Armut lindern - osteopathische Behandlung in Kenia
(Alleviating the effects of poverty - osteopathic treatment in Kenya)
Abb, B.
Osteopathische Medizin, 2011/06
3342

Der viszeral assoziierte Schulterschmerz
(Viscerally Associated Shoulder Pain. Subjective Perspectives and Diagnostic Procedures ? The Osteopathic Point of View)
Fischer, U.
Unpublished MSc thesis, 2011/06
Free full text
3343

Der unmittelbare Einfluss der Osteopathie auf die Atemleistung von Mitgliedern der Feuerwehr
(The immediate effect of osteopathy on fire fighters lung function)
Hellich, W.
Unpublished MSc thesis, 2011/05
Free full text
3344

Kann die Osteopathische Behandlung das Auftreten und die Ausprägung allergischer Reaktionen bei körperlicher Belastung beeinflussen?
(Osteopathy and its effects on frequency and severity of exercise induced anaphylactic symptoms?)
Kremser, S.
Unpublished MSc thesis, 2011/05
Free full text
3345

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3346

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3347

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3348

Gesundheit als Metapher. Welche Konzepte für Gesundheit haben deutschsprachige OsteopathInnen mit akademischem Hintergrund?
(Health as Metaphor - What are the concepts of health of German speaking osteopaths with an academic background?)
Risch, A. J.
Unpublished MSc thesis, 2011/05
Free full text
3349

Global Listening - Ein Test mit vielen Facetten
(Global Listening - a test with many facets)
Krall, B.
Unpublished MSc thesis, 2011/05
Free full text
3350

The Impact of an Osteopathic Medical Program on Information Technology Skills of Physicians Entering the Workforce
Bronsburg, S. E.
Unpublished PhD thesis, 2011/05
3351

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3352

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3353

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text
3354

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
3355

Efectos de las técnicas de anclaje miofascial y energía muscular en pacientes con bruxismo
(Effects of the myofascial anchorage and muscular energy techniques in patients with bruxism)
Cejo, P. E., Legal, L.
Osteopatía Científica, 2011/05
3356

Técnica de thrust para disfunción posterior unilateral del cóndilo occipital
(Thrust technique for unilateral posterior dysfunction of the occipital condyle)
Pérez Cátedra, P., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05
3357

Criterios de calidad en investigación osteopática (II)
(Quality criteria in osteopathic research (II))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/05
3358

Kieferbeschwerden aus Sicht des Fasziendistorsionsmodells (FDM)
(Jaw complaints from the point of view of the fascial distortion model (FDM))
Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
3359

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3360

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3361

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3362

Psychosomatik des Kiefergelenks
(Psychosomatics of the temporomandibular joint)
Lieberman, J.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04
3363

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3364

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3365

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3366

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3367

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3368

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3369

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3370

Evaluation of colleges of osteopathic medicine: training for the evaluators
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text
3371

The fall of the postural-structural-biomechanical model in manual and physical therapies: exemplified by lower back pain
Lederman, E.
Journal of Bodywork and Movement Therapies, 2011/04
3372

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04
3373

Osteopathic manipulative treatment is effective on pain control associated to spinal cord injury
Arienti, C., Dacco, S., Piccolo, I., Redaelli, T.
Spinal Cord, 2011/04
Free full text
3374

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text
3375

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03
3376

An evaluation of osteopathic school programs designed to promote rural location by graduates
Whitacre, B. E., Pace, V., Hackler, J. B., Janey, M., Landgraf, C. E., Pettit, W. J.
International Journal of Osteopathic Medicine, 2011/03
3377

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3378

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3379

Impact of osteopathic manipulative treatment on secretory immunoglobulin a levels in a stressed population
Saggio, G., Docimo, S., Pilc, J., Norton, J., Gilliar, W.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3380

Osteopathic manipulative treatment in developing countries: a call for education and research
Szkwarko, D.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3381

Somatische Dysfunktion
(Somatic dysfunction)
Adler-Michaelson, P.
Osteopathische Medizin, 2011/03
3382

Interview mit Raimund Engel zur Osteopathie in Europa
(Interview with Raimund Engel about osteopathy in Europe)
Engel, R.
Osteopathische Medizin, 2011/03
3383

Osteopathische Behandlung bei Schwindel: eine Pilotstudie
(Osteopathic treatment for vertigo: A pilot study)
Fraix, M.
Osteopathische Medizin, 2011/03
3384

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03
3385

Muscle energy technique: An evidence-informed approach
Fryer, G.
International Journal of Osteopathic Medicine, 2011/03
3386

Efficacy of osteopathic manipulative treatment of female patients with migraine: results of a randomized controlled trial
Voigt, K., Liebnitzky, J., Burmeister, U., Sihvonen-Riemenschneider, H., Beck, M., Voigt, R., Bergmann, A.
The Journal of Alternative and Complementary Medicine, 2011/03
Free full text
3387

Os osteopatas em Portugal: processo de profissionalização e formação identitária
(The Osteopaths in Portugal: Professionalisation and Identity)
Henriques, A. J. d. P. B.
Unpublished MSc thesis, 2011/03
Free full text
3388

Osteopathic Manipulative Treatment of Isolated Chronic Sphenoidal Sinusitis in a Post-Sinus Surgery Patient: A Case Report
Shah, R., Berkowitz, M. R.
The AAO Journal, 2011/03
Free full text
3389

The 2010 Northup Memorial Lecture: Low Frequency Oscillations in Human Physiology and Cranial Osteopathy
Nelson, K. E.
The AAO Journal, 2011/03
Free full text
3390

A “System” of Cranial Manipulation: An Original Contribution on Osteopathic Technique
Miller, D. S.
The AAO Journal, 2011/03
Free full text
3391

From The Archives: From: Fryette, HH. Principles of Osteopathic Technique. Carmel, CA: American Academy of Osteopathy, 1954. 61-64.
Fryette, H.H.
The AAO Journal, 2011/03
Free full text
3392

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text
3393

Internationales Symposium: Osteopathie bei Neugeborenen & Kleinkindern vom 19.-21.11.2010
(International Symposium: Osteopathy for newborns & infants from 19-21.11.2010)
Nagel, M.
Osteopathische Medizin, 2011/03
3394

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals (Interviews))
Newiger, C.
Osteopathische Medizin, 2011/03
3395

Prinzipien der osteopathischen Notfalltechniken nach Robert Rousse
(Principles of osteopathic emergency techniques according to Robert Rouse)
Prediger, G.
Osteopathische Medizin, 2011/03
3396

A preliminary investigation of the effect of the osteopathic lymphatic pump technique on salivary immunoglobulin A levels in asymptomatic subjects: A single systems design pilot study
Ehrlenbach, H.
Unpublished MSc thesis, 2011/03
Free full text
3397

„Hier treffe ich Leute, die was zu sagen haben. Im Sinne von Erfahrung.“
(“Here, I meet people who have something to say. In the sense of experience“)
Vellmer, S.
Osteopathische Medizin, 2011/03
3398

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03
3399

Research and treatment bulletin 2/2011
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2011/03
3400

Internationaler Konsens zur Osteopathie - die Benchmarks der WHO
(International consensus regarding osteopathy - WHO's benchmarks)
Dräger, K.
Osteopathische Medizin, 2011/03
3401

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3402

Osteopathische Interventionen bei Erkrankungen der Prostata
(Osteopathic interventions in diseases of the prostate gland)
Marx, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
3403

Communication by degrees
Melnick, A.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3404

Chronische Prostatitis: Gemeinsam geht's besser! 
(Chronic prostatitis: Let's work together!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02
3405

Management of Dupuytren contracture with ultrasound-guided lidocaine injection and needle aponeurotomy coupled with osteopathic manipulative treatment
Sampson, S., Meng, M., Schulte, A., Trainor, D., Montenegro, R., Aufiero, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3406

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text
3407

Cranial osteopathy for children with cerebral palsy: a randomised controlled trial
Wyatt, K., Edwards, V., Franck, L., Britten, N., Creanor, S., Maddick, A., Logan, S.
Archives of Disease in Childhood, 2011/02
Free full text
3408

Osteopathy for musculoskeletal pain patients: a systematic review of randomized controlled trials
Posadzki, P., Ernst, E.
Clinical Rheumatology, 2011/02
Free full text
3409

Management of suppurative cervical lymphadenitis in a healthy 24-year-old man
Hernandez, M., Chowdhury, R., Woods, J., Cabrera, J., Hardigan, P. C.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3410

Osteopathic manipulative treatment for the treatment of hospitalized premature infants with nipple feeding dysfunction
Lund, G. C., Edwards, G., Medlin, B., Keller, D., Beck, B., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3411

Student abstracts and poster competitions: encouraging research
Prinsen, J. K.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3412

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3413

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text
3414

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01
3415

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text
3416

What really does it have to do with osteopathy anyway? New Zealand osteopath practitioners talk about rural Māori health
Awatere, S. A.
Unpublished MSc thesis, 2011/01
Free full text
3417

HR Influence in a For-Profit Osteopathic Medical School: Staffing, Polices and Procedures
Pelletier, C.
Unpublished MSc thesis, 2011/01
3418

Desarrollo de un sistema multimedia como herramienta educativa para osteopatía estructural de la articulación sacroiliaca
(Development of a multimedia system as an educational tool for structural osteopathy of the sacroiliac joint)
Mahecha Orjuela, D. M.
Unpublished MSc thesis, 2011/01
Free full text
3419

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text
3420

Biomechanical assessment of kinematic measures associated with an osteopathic cervical diagnosis and treatment technique
Rutledge, B. A.
Unpublished MSc thesis, 2011/01
Free full text
3421

Influencia de la thumb move de C7/T1 combinada con el stretching del ligamento anular del carpo sobre el área de sección transversal del nervio mediano en un caso de STC bilateral
(Influence of the thumb move at C7/T1 combined with stretching of the carpal annular ligament on a cross sectional area of the median nerve in a case of bilateral carpal tunnel syndrome)
Aguirrea, F. B., Boscá Gandíaa, J. J., Brizb, Vicente H., Pascual-Vacaa, J. O.
Osteopatía Científica, 2011/01
3422

Alteraciones en las concentraciones de amonio sérico después de la aplicación de la técnica osteopática sobre el hígado según Ralph-Faylor
(Changes in plasma ammonia levels after aplication of Ralph Failor's liver pumping technique)
Alberto de Sousa, L.
Osteopatía Científica, 2011/01
3423

The identification, assessment and management of somatisation in clients of osteopathic practitioners in New Zealand
You, H. Y.
Unpublished MSc thesis, 2011/01
Free full text
3424

A preliminary investigation into the attitudes and practices of New Zealand osteopaths in relation to the health care system: Does the future hold a greater degree of integration into the biomedical system?
Rose, L.
Unpublished MSc thesis, 2011/01
Free full text
3425

Structural or cranial osteopathy: Factors influencing practitioner preference
Norrie, J.
Unpublished MSc thesis, 2011/01
Free full text
3426

Técnica semidirecta de thrust para una disfunción somática no neutra en ERS izquierda de la tercera vértebra cervical
(Thrust technique for left ERS somatic dysfunction of the third cervical vertebra)
Guerrero, A. M., Rodríguez, R. P.
Osteopatía Científica, 2011/01
3427

Women’s attitudes to and experiences of osteopathic care during pregnancy
Kurth, A.
Unpublished MSc thesis, 2011/01
Free full text
3428

An exploration of the experience of parents in the osteopathic treatment of their infants
Gardner, K.
Unpublished MSc thesis, 2011/01
Free full text
3429

Efectos neuroFisiológicos de la manipulación vertebral
(Neurophysiological effects of spinal manipulation)
Pickar, J. G.
Osteopatía Científica, 2011/01
3430

The effect of home-exercise with and without additional osteopathic treatment for those with shoulder impingement syndrome
Darragh, T.
Unpublished MSc thesis, 2011/01
Free full text
3431

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text
3432

Criterios de calidad en investigación osteopática (I)
(Quality criteria for osteopathic research (I))
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2011/01
3433

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011
3434

Osteopathic Treatment for Irritable Bowel Syndrome. A Systematic Review.
Müller, A.
Unpublished MSc thesis, 2011
Free full text
3435

Veränderung der Wurfgenauigkeit und Wurfgeschwindigkeit bei Handballspielerinnen nach osteopathischer Intervention
(Changes in the Throwing Accuracy and Throwing Velocity of Competitive Female Handball Players after Osteopathic Intervention)
Bitter, H.
Unpublished MSc thesis, 2010/12
Free full text
3436

Wirkt sich eine viszerale Behandlung auf das parietale System aus? Eine Studie am Beispiel der arthrotischen Hüfte und der Unterbauchorgane
(Does a visceral treatment have an effect on the parietal system? A Case Study using the example of the arthritic hip and the pelvic organs)
Gosch, D.
Unpublished MSc thesis, 2010/12
Free full text
3437

The accuracy of diagnostic palpation: the comparison of soft tissue findings with random blood sugar in diabetic patients
Nelson, K. E., Mnabhi, A. K. S., Glonek, T.
Osteopathic Family Physician, 2010/12
3438

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text
3439

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text
3440

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text
3441

EROP-Richtlinien: Kernkompetenzen und Praxisstandards in der osteopathischen Medizin
(EROP guidelines: Core competencies and practice standards in osteopathic medicine)
Mayer, J.
Osteopathische Medizin, 2010/12
3442

Interview mit Dr. med. Johannes Mayer zum Thema EROP-Richtlinien: Kernkompetenzen und Praxisstandards
(Interview with Dr. Johannes Mayer, M.D. on the topic EROP guidelines: Core competencies and practice standards)
Schmidt, S.
Osteopathische Medizin, 2010/12
3443

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text
3444

Langjährige Schilddrüsenunterfunktion und muskuläre Beschwerden: Ist Osteopathie für die betroffenen Frauen von Nutzen?
(Long-term hypothyroidism and muscle diseases: Is osteopathy of use to the afflicted women?)
Sonberg, M., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2010/12
3445

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text
3446

Progression through osteopathic training in Australia: The student experience
Hartup, J. K., Murphy, R. A., Plowman, L. M., Myers, R.
International Journal of Osteopathic Medicine, 2010/12
3447

Do different practitioners attract different patients? The importance of keeping an open mind
Thornton-Smith, K., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/12
3448

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12
3449

Osteopathie und ihre Wirkung auf die „Spastizität“ bei posttraumatischer Rückenmarksläsion
(Osteopathy and its effect on “spasticity“ related to post-traumatic spinal cord lesions)
Riedl, B.
Unpublished MSc thesis, 2010/12
Free full text
3450

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 2: Treatment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
3451

The use of spinal and sacroiliac joint procedures within the British osteopathic profession. Part 1: Assessment
Fryer, G., Johnson, J. C., Fossum, C.
International Journal of Osteopathic Medicine, 2010/12
3452

It Means Just What I Choose It to Mean--Neither More nor Less
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/12
Free full text
3453

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text
3454

Die Bekanntheit und Akzeptanz der Osteopathie bei niedergelassenen Ärzten im ländlichen und kleinstädtischen Bereich am Beispiel Wald und Weinviertel
The level of knowledge about osteopathy among medical doctors in private practice in the rural and small-town Weinviertel region
Wotruba, S.
Unpublished MSc thesis, 2010/12
Free full text
3455

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text
3456

Integrating Osteopathic Principle into Daily Practice
Hruby, R. J.
The AAO Journal, 2010/12
Free full text
3457

Kann mit Osteopathie der Stimmumfang von Sängerinnen der Stimmlage Sopran vergrößert werden?
(Can osteopathy expand the vocal compass of female singers with the voice type soprano?)
Amlinger, E.
Unpublished MSc thesis, 2010/11
Free full text
3458

Comments on “Commentary on the globalization of osteopathic medicine”
Findlay, T.
Osteopathic Family Physician, 2010/11
3459

Efficacy of a standardized osteopathic manipulative therapy protocol on pulmonary function and symptomatology in moderate persistent asthmatic children
Brady, N. S.
Annals of Allergy, Asthma and Immunology, 2010/11
3460

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3461

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3462

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3463

Reliability of bony anatomic landmark asymmetry assessment in the lumbopelvic region: application to osteopathic medical education
Stovall, B. A., Kumar, S.
The Journal of the American Osteopathic Association, 2010/11
Free full text
3464

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11
3465

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3466

Sind Faszien in vivo und in vitro aktiv und passiv kontraktionsfähig, welche Mechanismen ermöglichen dieses Kontraktionsverhalten und welche Konsequenzen ergeben sich für die Osteopathie? Systematische Übersichtsarbeit
(Do fascia feature the capacity of active and passive contraction; which mechanisms facilitate these contractive properties; and which consequences result with regard to applied osteopathy? A systematic review)
Brand, E.M.
Unpublished D.O. thesis, 2010/10
3467

Response to “Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations“
Gimpel, J. R.
Teaching and Learning in Medicine, 2010/10
3468

New COMLEX-USA-to-USMLE conversion formula needed
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3469

Hat die osteopathische Behandlung Einfluss auf Immunparameter bei Patienten mit chronischen Rückenschmerzen? Prä-Post Pilotstudie
(Does osteopathic treatment influence immune parameters in patients with chronic low back pain? A pre-post pilot trial)
Conrady, A., Döring, R.
Unpublished D.O. thesis, 2010/10
3470

Osteopathische Behandlung von Frauen mit Harninkontinenz. Eine kontrollierte klinische Studie.
(Osteopathic treatment in women suffering from urinary incontinence. A controlled clinical trial)
Grönwald, C., Pantel, M.
Unpublished D.O. thesis, 2010/10
3471

Können osteopathische Behandlungen einen Beitrag zur Verbesserung von Miktionsbeschwerden (LUTS) bei Patienten mit benignem Prostatasyndrom (BPS) leisten? Randomisierte kontrollierte Studie.
(Do osteopathic treatments influence the lower urinary tract symptoms (LUTS) in patients with benign prostatic syndrome (BPS)? A randomized controlled trial)
Kramer, S., Schüle, G., Welzel, M.
Unpublished D.O. thesis, 2010/10
3472

Wirkt die osteopathische Behandlung bei Patienten mit Psoriasis vulgaris? Randomisierte kontrollierte Studie
(Does osteopathic treatment affect the symptoms of psoriasis vulgaris? A randomized controlled trial)
Martin, J.
Unpublished D.O. thesis, 2010/10
3473

Hat osteopathische Behandlung einen Effekt auf Schlafstörungen bei Kindern zwischen drei und zehn Jahren? Prä-Post-Pilostudie.
(Does osteopathic treatment influence sleep disturbances in children between three and ten years? Pre-post pilot trial)
Schulmeyer, A.
Unpublished D.O. thesis, 2010/10
3474

Osteopathisches Patientenprofil in Bezug auf das Gesundheitssystem in Deutschland. Umfrage 2009
(Potential existing profile of typical osteopathy users at the German Health System. A survey 2009)
Tüffers, C.
Unpublished D.O. thesis, 2010/10
3475

Systematische Übersichtsarbeit über Definition, Nomenklatur und Klassifikation der Säuglingsasymmetrie bzw. Schiefhals bei Säuglingen.
(A Systematic Review on the Definition, Nomenclature and Classification on Infantile Asymmetry, respectively, Torticolllis in Infants)
Wagner, C.
Unpublished D.O. thesis, 2010/10
3476

Management of benign paroxysmal positional vertigo with the canalith repositioning maneuver in the emergency department setting
Burmeister, D. B., Sacco, R., Rupp, V.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3477

Realigning the JAOA to sharpen our focus
Capobianco, P. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3478

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests over a 4-month period
Degenhardt, B. F., Johnson, J. C., Snider, K. T., Snider, E. J.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3479

Effects of rib raising on the autonomic nervous system: a pilot study using noninvasive biomarkers
Magoun Jr., H. I.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3480

OMT relieves low back pain during pregnancy
Kleman, P. G.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3481

Development, implementation, and outcomes of an initiative to integrate evidence-based medicine into an osteopathic curriculum
Laird, S., George, J., Sanford, S. M., Coon, S.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3482

Soul sickness: a frequently missed diagnosis
Tobe, E. H.
The Journal of the American Osteopathic Association, 2010/10
Free full text
3483

Plagiozephalie bei frühgeborenem Mädchen
(Plagiocephaly in premature baby girl)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3484

Komplementäre Behandlung der idiopathischen Säuglingsasymmetrie
(Complementary treatment of idiopathic infant asymmetry)
Peschke, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10
3485

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text
3486

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/
3487

Osteopathische Erfahrungswerte mit idiopathischen Skoliosen
(Experiences regarding osteopathic treatment of idiopathic scoliosis)
Loibner-Gruendler, B.
Unpublished MSc thesis, 2010/09
Free full text
3488

Osteopathic manipulative treatment in a patient with idiopathic dysautonomia: a case presentation
Cromeens, B., Gamber, R.
Osteopathic Family Physician, 2010/09
3489

Baby-Shiatsu – eine energetische Ergänzung zur osteopathischen Behandlung
(Baby Shiatsu: An energetic supplement to osteopathic treatment)
Kalbantner-Wernicke, K., Wernicke, T.
Osteopathische Medizin, 2010/09
3490

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text
3491

Various methods of CRI palpation of body parts, their diagnostic values and interpretation of the findings
Pribadi, K. S.
The AAO Journal, 2010/09
Free full text
3492

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text
3493

Wie viel Placebo steckt in der Osteopathie?
(How much placebo remains in osteopathy?)
Resch, K.L.
Osteopathische Medizin, 2010/09
3494

Adverse events in manual therapy: A systematic review
Carnes, D., Mars, T. S., Mullinger, B., Underwood, M.
International Journal of Osteopathic Medicine, 2010/09
3495

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09
3496

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3497

A possible contribution of osteopathic medicine in the management of children affected by ADD/ADHD
Cozzolino, V., Accorsi, A., Di Mattia, L., Granchelli, C., Lucci, C., Pizzolorusso, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
3498

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
3499

Impact of OMT on reducing length of stay in a population of pre-term infants
Cozzolino, V., La Mola, E., Ciardelli, F., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09
3500

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09
3501

Development of a standardised data collection (SDC) tool to profile osteopathic practice in the United Kingdom
Fawkes, C. A., Leach, C. M. J., Mathias, S., Moore, A. P.
International Journal of Osteopathic Medicine, 2010/09
3502

The use of spinal and sacroiliac joint assessment and treatment procedures within the British osteopathic profession
Fryer, G., Johnson, J. C.
International Journal of Osteopathic Medicine, 2010/09
3503

Osteopathic manipulative treatment for chronic neck pain: A randomized placebo controlled trial on the effect on pain and disability
Mandara, A., Ceriani, A., Guzzetti, G., Gulisano, V., Fusaro, A., Bado, F.
International Journal of Osteopathic Medicine, 2010/09
3504

Osteopathy as a therapy during pregnancy: A randomised controlled trial
Nistler, G., Deutschmann, U., Lenz, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3505

8th International conference on advances in osteopathic research – ICAOR 2010
International Journal of Osteopathic Medicine, 2010/09
3506

A randomized control trial on the effectiveness of osteopathic manipulative treatment in reducing pain and improving quality of life in elderly patients affected by osteoporosis
Papa, L., Mandara, A., Bottali, M., Mosca, G., Orfei, S.
International Journal of Osteopathic Medicine, 2010/09
3507

Osteopathic treatment of women with primary dysmenorrhoea: A randomised controlled trial
Pinter-Haas, A., Schach-Hirte, A., Wirthwein, P., Metcalfe, D., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09
3508

Osteopathic treatment of women with voiding dysfunction: A randomized controlled trial
Ringkamp, C., Rodriquez, B., Alberts, K., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09
3509

Osteopathic treatment of patients with shoulder pain: A randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
International Journal of Osteopathic Medicine, 2010/09
3510

Are student attitudes to back pain aligned with European guidelines? A survey within UK osteopathic educational institutions (OEIs) using the Attitudes to Back Pain Scale for musculoskeletal practitioners (ABS-mp)
Stokoe, J., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/09
3511

Adverse events and treatment reactions in osteopathy
Vogel, S.
International Journal of Osteopathic Medicine, 2010/09
3512

Exploring European osteopathic identity: An analysis of the professional websites of European osteopathic organizations
Wagner, C., van Dun, P. L. S.
International Journal of Osteopathic Medicine, 2010/09
3513

Osteopathic management of an adult patient suffering from trigeminal neuralgia after a post-operative Arnold Chiari type 1 decompression: Case report
Zegarra-Parodi, R., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
3514

Training in osteopathic structural techniques from a student perspective: A survey of final year students
Zegarra-Parodi, R., Renard, E.O., Allamand, P.
International Journal of Osteopathic Medicine, 2010/09
3515

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text
3516

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09
3517

Efectos de la desactivación de los puntos-gatillo de los músculos de la pantorrilla en las fascitis plantares
(The effects of calf muscle trigger-points disactivation in plantar fasciitis)
Renan Ordine, R., Alburquerque Sendín, F.
Osteopatía Científica, 2010/09
3518

Investigación en osteopatía en el ámbito internacional
(Research in osteopathy at the international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/09
3519

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text
3520

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09
3521

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07
3522

Physiotherapie et osteopathie: une prise en charge reellement holistique des sportifs.
(Physiotherapy and osteopathy: a real holistic supervision of athletes)
Larequi, Y.
Revue Medicale Suisse, 2010/08
3523

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3524

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07
3525

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07
3526

Nasen- und Darmschleimhaut in der osteopathischen Behandlung
(Nasal and intestinal mucosa in osteopathic treatment)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3527

Der osteopathisch ganzheitliche Ansatz zur Homöostase (Teil 2)
(The osteopathic holistic approach to homeostasis, part 2)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3528

Encouraging OFP editorial staff to present information and articles on the use of Osteopathic manipulative care
Urse, G. N.
Osteopathic Family Physician, 2010/07
3529

Research and osteopathy: an interview with Dr Gary Fryer by Helge Franke
Franke, H.
Journal of Bodywork and Movement Therapies, 2010/07
Free full text
3530

Characteristics of pediatric patients seen in medical school-based osteopathic manipulative medicine clinics
Lund, G., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/07
Free full text
3531

Defining osteopathic medicine: can you put your finger on it?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2010/07
Free full text
3532

Osteopathische Techniken bei Nasennebenhöhlenentzündung
(Osteopathic techniques in sinusitis)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3533

CRPS und Osteopathie – Möglichkeiten und Grenzen
(CRPS and osteopathy - possibilities and limits)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3534

Idiopathische Trigeminusneuralgie
(Idiopathic trigeminal neuralgia)
Liem, T., Kühn, D.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
3535

No effect of osteopathic treatment on trunk morphology and spine flexibility in young women with adolescent idiopathic scoliosis
Hasler, C., Schmid, C., Enggist, A., Neuhaus, C., Erb, T.
Journal of Children's Orthopaedics, 2010/06
Free full text
3536

Anterior superior iliac spine asymmetry assessment on a novel pelvic model: an investigation of accuracy and reliability
Stovall, B. A., Bae, S., Kumar, S.
Journal of Manipulative and Physiological Therapeutics, 2010/06
Free full text
3537

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text
3538

Medecine manuelle - osteopathie en France.
(Manual medicine-osteopathy in France)
Vautravers, P.
Annals of Physical and Rehabilitation Medicine, 2010/06
3539

Evidence Does Not Grow Stale with Age
Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
3540

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text
3541

Low Back Pain in Rowers
Fleming, R. K., Snider, K. T.
The AAO Journal, 2010/06
Free full text
3542

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text
3543

Osteopathic Diagnosis and Treatment of Dorsalgia Caused by Disturbance of Proprioception in the Cervical Spine
Lepin, A. L., Mokhov, D. E., Novoseltsev, S. V.
The AAO Journal, 2010/06
Free full text
3544

Median Arcuate Ligament Syndrome – Literature Study and Osteopathic Considerations
Peeters, L.
The AAO Journal, 2010/06
Free full text
3545

Somatic Dysfunction Following Sigmoid Colon Resection for Diverticulitis: A Case Report
Ridgeway, V., Berkowitz, M. R.
The AAO Journal, 2010/06
Free full text
3546

Interview mit Angela Schleupen und Karl Heinz Riedl zur Osteopathie in der Frauenheilkunde
(An interview with Angela Schleupen and Karl Heinz Riedl on osteopathy in gynecology)
Schleupen, A., Riedl, K. H.
Osteopathische Medizin, 2010/06
3547

Methoden der osteopathischen Diagnostik und der Reflexdiagnostik bei Zervikalgiepatienten
(Methods of osteopathic diagnostics and reflex diagnostics in patients with cervicalgia)
Usupbékova, B. C., Mokhov, D. E., Vasilenko, A. M., Paoletti, S.
Osteopathische Medizin, 2010/06
3548

Teaching osteopathic students technique; using research to identify good teaching practice
Browning, S.
International Journal of Osteopathic Medicine, 2010/06
3549

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06
3550

Diagnostyka fizjoterapeutyczna i osteopatyczna w zawodowych zaburzeniach glosu.
(The application of physiotherapeutic and ostheopatic diagnostics in occupational voice disorders)
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Kowalska, M. S.
Medycyna Pracy, 2010/06
3551

The Influence of Rib Raising on the Lung Function of Chronic Obstructive Pulmonary Disease Patients
Friedrich, S.
Unpublished MSc thesis, 2010/06
Free full text
3552

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05
3553

L'osteopathie pour soulager certaines douleurs.
(Osteopathy for relieving certain pain)
Gnaho, S.
Revue de l'infirmiere, 2010/05
3554

International medical graduates can be the answer to osteopathic graduate medical education vacancies and international recognition of osteopathic medicine
DeLengocky, T.
Osteopathic Family Physician, 2010/05
3555

Commentary on the globalization of osteopathic medicine
Qureshi, Y., Kusienski, A. M.
Osteopathic Family Physician, 2010/05
3556

Wie gut funktioniert die Zusammenarbeit zwischen Zahnärzten und Osteopathen im Raum Steiermark?
(How efficient is the cooperation between dentists and osteopaths in Styria?)
Kaltenböck, M.
Unpublished MSc thesis, 2010/05
Free full text
3557

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3558

Estudio comparativo sobre la eficacia de las técnicas de thrust y energía muscular en el músculo piriforme
(Comparative study on the efficacy of thrust and muscle energy techniques in the piriformis muscle)
Hunt, G. M., Legal, L.
Osteopatía Científica, 2010/05
3559

Fe de errores de “El efecto en el umbral del dolor en un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es infl uenciable por las expectativas del sujeto?”
(Erratum to “The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?“)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/05
3560

Repercusión de la maniobra lift de vejiga sobre el punto gatillo miofascial del músculo tibial anterior y de la apófisis espinosa de lumbar 5
(Repercussions of the urinary bladder lift manipulation on the myofascial trigger point of the tibialis anterior muscle and fifth lumbar spinous process)
Marchuk, C., Legal, L.
Osteopatía Científica, 2010/05
3561

Osteopathic diagnosis of an acetabular injury
Morthland, T., Cote, N. S., Humphrey, J., Fulk, D.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3562

Modificaciones radiológicas del espacio entre el occipucio y el cuerpo del atlas tras una manipulación global (OAA) de Fryette
(Radiological changes in the atlanto-occipital space after Fryette global manipulation (OAA))
Otaño, L., Legal, L.
Osteopatía Científica, 2010/05
3563

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3564

El desarrollo científico de la osteopatía en el ámbito internacional
(Scientific development of osteopathy at international level)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2010/05
3565

The anachronistic fight for osteopathic distinctiveness
Shore, E. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text
3566

Osteopathische Behandlung von homonymen Gesichtsfeldausfällen bei Erwachsenen mit erworbener Hirnschädigung im Zuge des stationären Rehabilitationsaufenthaltes
(Osteopathy relating to homonymous hemianoptic failures with adults with acquired brain damage in the course of the stationary rehabilitation phase)
Fäßlacher, W.
Unpublished MSc thesis, 2010/05
Free full text
3567

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
3568

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text
3569

Formbarkeit von Faszien und Membranen: Behandlung innerer Brücken im Kontext der Forschung
(Plasticity of Fascias and Membranes: Treatment of Inner Bridges in the Context of Research)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3570

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3571

Diagnose und Behandlung von Zahnschmerzen nach dem Fasziendistorsionsmodell (FDM)
(Diagnosis and treatment of dental pain according to the Fascial Distortion Model (FDM))
Stein, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3572

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3573

Diagnosis and management of primary pulmonary leiomyosarcoma
Arnold III., L. M., Burman, S. D., H., O-Yurvati A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3574

Adding MI principles to your communication skills: an interview with Susan Butterworth, PhD
Butterworth, S.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3575

Call to action: aggressively managing lipid levels
Carr, L. L.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3576

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3577

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3578

Effect of osteopathy in the cranial field on visual function--a pilot study
Sandhouse, M. E., Shechtman, D., Sorkin, R., Drowos, J. L., Caban-Martinez III., A. J., Patterson, M. M., Shallo-Hoffmann, J., Hardigan, P., Snyder, A.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3579

Musculoskeletal dysfunction and drop foot: diagnosis and management using OMM
Sucher, B. M.
The Journal of the American Osteopathic Association, 2010/04
Free full text
3580

14. Europäisches Symposium der traditionellen Osteopathie
(14th European Symposium of Traditional Osteopathy)
Bauer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3581

Mikro- und makroskopische Betrachtung der Faszienfunktionen
(Microscopic and Macroscopic Reflections on the Functions of Fascias)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04
3582

An introduction to clinical research in osteopathic medicine
Earley, B. E., Luce, H.
Primary Care: Clinics in Office Practice, 2010/03
Free full text
3583

DOs vs. Dos: proposed medical school creates rift between osteopathic physicians, UNT
Ortolon, K.
Texas Medicine, 2010/03
3584

Kommentar der Deutsch-Amerikanischen Akademie für Osteopathie e.V. (DAAO)
(Comment of the German-American Academy of Osteopathy (DAAO))
Adler-Michaelson, P.
Osteopathische Medizin, 2010/03
3585

Forum zum Artikel: “Wissenschaftliche Bewertung osteopathischer Verfahren”
(Forum on the article: “Scientific assessment of osteopathic procedures“. Comment of the German Society of Chiropractic and Osteopathy (DGCO))
Daichendt, D.
Osteopathische Medizin, 2010/03
3586

Holistic Osteopathic Approach Reveals Unusual Etiology for Vertigo with Co-morbid Headache: A Case Report
Berkowitz, M. R.
The AAO Journal, 2010/03
Free full text
3587

Case Study: Exhalation Somatic Dysfunction after Multiple Rib Fractures and Pneumothorax
Calman, J.
The AAO Journal, 2010/03
Free full text
3588

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text
3589

Kommentar des Verbands der Osteopathen Deutschland e.V. (VOD)
(Comment of the German Osteopathic Association (VOD))
Fuhrmann, M.
Osteopathische Medizin, 2010/03
3590

Kommentar des Deutschen Registers Osteopathische Medizin (DROM)
(Comment of the German Register of Osteopathic Medicine (DROM))
Hartwig, B.
Osteopathische Medizin, 2010/03
3591

Kommentar der Deutschen Gesellschaft für Osteopathische Medizin e.V. (DGOM)
(Comment of the German Society of Osteopathic Medicine (DGOM))
Hogrefe, C.
Osteopathische Medizin, 2010/03
3592

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor in regards to the article: 'Osteopathic treatment of developmental hip dysplasia in infants during the first year of life')
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2010/03
3593

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text
3594

(Comment on the letter to the editor)
Mayer, J.
Osteopathische Medizin, 2010/03
3595

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text
3596

Kommentar des Verbands Osteopathie Schule Deutschland (VOSD)
(Comment of the Association of the Osteopathic School in Germany (VOSD))
Nagel, M.
Osteopathische Medizin, 2010/03
3597

Kommentar des Register der Traditionellen Osteopathen in Deutschland GmbH (ROD)
(Comment of the Registry of Traditional Osteopathy in Germany (ROD))
Prediger, G.
Osteopathische Medizin, 2010/03
3598

Kommentar der Akademie für Osteopathie AFO
(Comment of the Academy of Osteopathy (AFO))
Schwerla-Goeggel, B. S.
Osteopathische Medizin, 2010/03
3599

Leserbrief zum Artikel „Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres”
(Letter to the editor about the article: “Osteopathic treatment of development-conditioned hip dysplasia in infants during the first year of life“)
Spittank, H.
Osteopathische Medizin, 2010/03
3600

Wissenschaftliche Bewertung osteopathischer Verfahren: Der Vorstand der Bundesärztekammer hat in seiner Sitzung vom 28. August 2009 folgende Ausarbeitung des Wissenschaftlichen Beirats zustimmend zur Kenntnis genommen
(Scientific assessment of osteopathic procedures)
Osteopathische Medizin, 2010/03
3601

Osteopathic neuromuscular re-abilitation
Lederman, E.
International Journal of Osteopathic Medicine, 2010/03
3602

Osteopathy 2.0: Osteopathy and the new web
Lucas, N. P.
International Journal of Osteopathic Medicine, 2010/03
3603

Can osteopathy help women with a history of hypothyroidism and musculoskeletal complaints? Outcome of a preliminary, prospective, open investigation
Sonberg, M., Mullinger, B., Rajendran, D.
International Journal of Osteopathic Medicine, 2010/03
3604

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03
3605

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3606

Efficacy of osteopathic manipulation as an adjunctive treatment for hospitalized patients with pneumonia: a randomized controlled trial
Noll, D. R., Degenhardt, B. F., Morley, T. F., Blais, F. X., Hortos, K. A., Hensel, K., Johnson, J. C., Pasta, D. J., Stoll, S. T.
Osteopathic Medicine and Primary Care, 2010/03
Free full text
3607

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3608

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3609

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3610

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3611

Uniform instruction using web-based, asynchronous technology in a geographically distributed clinical clerkship: analysis of osteopathic medical student participation and satisfaction
Peska, D. N., Lewis, K. O.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3612

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3613

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text
3614

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text
3615

Use of osteopathic manipulative treatment to manage compensated trendelenburg gait caused by sacroiliac somatic dysfunction
Gilliss, A. C., Swanson II., R. L., Janora, D., Venkataraman, V.
The Journal of the American Osteopathic Association, 2010/02
Free full text
3616

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01
3617

Osteopathie: Die Sicht der Bundesärztekammer
(Osteopathy: The view of the German Medical Association)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3618

Akute Irritation des Nervus cutaneus femoris lateralis
(Acute irritation of the lateral cutaneous femoral nerve)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3619

Inter-Intrareabilitätsstudie zur Testung cranialer Strukturen im Konzept der ''Mechanischen Vernetzung'' (Lien Mechanik Osteopathy-LMO)
(Inter-examiner Study for cranial Structures in the examination record of Lien Mechanique Osteopatique (LMO))
Richter-Schultz, K.
Unpublished MSc thesis, 2010/01
Free full text
3620

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01
3621

The osteopathic physician and end-of-life care
Hernandez, M., Ledbetter, S., Trevil, R., Perez, A., White, C.
Osteopathic Family Physician, 2010/01
3622

Osteopathic Medicine and Primary Care: one journal, two audiences
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2010/01
Free full text
3623

Osteopathic manipulative treatment of back pain and related symptoms during pregnancy: a randomized controlled trial
Licciardone, J. C., Buchanan, S., Hensel, K. L., King, H. H., Fulda, K. G., Stoll, S. T.
American Journal of Obstetrics & Gynecology, 2010/01
Free full text
3624

Dolor y estrategias terapéuticas en osteopatía (IV)
(Pain and therapeutics approaches in osteopathy (IV))
Hernández Xumet, J. E.
Osteopatía Científica, 2010/01
3625

El efecto en el umbral del dolor de un miotoma tras la manipulación vertebral del nivel correspondiente, ¿es influenciable por las expectativas del sujeto?
(The effect on the pain threshold in a myotome after a spinal manipulation… is it influenced by the subject's expectations?)
Manso, M. G., Rodríguez Díaz, J.
Osteopatía Científica, 2010/01
3626

Influencia de la técnica de bombeo del globo ocular en la presión intraocular en sujetos hipertensos sometidos a medicación
(Influence of the eye pumping technique on intraocular pressure in hypertensive subjects under medication)
Sánchez Jorge, S., Palomeque del Cerro, L.
Osteopatía Científica, 2010/01
3627

Modificaciones inmediatas en la dinámica uterina tras la realización de la técnica de equilibración de la sincondrosis esfenobasilar según Upledger
(Immediate changes in the uterine dynamics after application of the balancing technique in the sphenobasilar synchondrosis according Upledger)
Vecino Rodríguez, A., Martínez Loza, E.
Osteopatía Científica, 2010/01
3628

Diseño de un modelo de atención en osteopatía desde el componente de la prestación de servicios, orientado hacia el manejo de pacientes con lumbalgia de tipo mecánico, para instituciones prestadoras de servicios de salud de mediana complejidad en Colombia
(Design of an osteopathic care model from the service delivery component, oriented towards the management of patients with mechanical low back pain, for medium complexity health care institutions in Colombia)
Mejía Arango, A.
Unpublished MSc thesis, 2010/01
Free full text
3629

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3630

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3631

The effects of osteopathy in the cranial field on stress as measured by salivary cortisol levels
Vreede, J. E.
Unpublished MSc thesis, 2010/01
Free full text
3632

Development of a preliminary questionnaire to investigate the attitudes of NZ osteopaths regarding the use of exercise in osteopathy
Mckay-Watts, R.
Unpublished MSc thesis, 2010/01
Free full text
3633

Effect of a novel osteopathic technique on the axial length of the eye
Huang, J. H.I.
Unpublished MSc thesis, 2010/01
Free full text
3634

An exploration of the influences that shape the opinions and practices of osteopaths in relation to osteopathy in the cranial field
Braybrook, J. E.
Unpublished MSc thesis, 2010/01
Free full text
3635

Osteopathische Betrachtung der Narbenbehandlung
(Osteopathic Reflection on the Treatment of Scars)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01
3636

Has osteopathy a role to play in treatment of flu?
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text
3637

Contribution of the osteopathy on the flexibility of the lumbar column and intensity of pain in young adult patients with acute low back pain
Rocha, R., Pereira, J. S.
Revista Terapia Manual, 2010
3638

Osteopathic Treatment of Patients with Chronic Non-Specific Neck Pain: Development of a Study Protocol
Schwerla, F.
Unpublished MSc thesis, 2010
Free full text
3639

Osteopathic Treatment of Female Incontinence
Hösele, K.
Unpublished MSc thesis, 2010
Free full text
3640

Effectiveness of the osteopathic treatment of women with uterine fibroids: Development of a study protocol of a randomized controlled trial
Salomon, J.
Unpublished MSc thesis, 2010
Free full text
3641

Benchmarks for Training in Osteopathy
World Health, Organization
, 2010
Free full text
3642

Development of a Study Protocol on the Osteopathic Treatment of Late Whiplash Syndrome
Kaiser, A.K.
Unpublished MSc thesis, 2010
Free full text
3643

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3644

Musculoskeletal dysfunction and drop foot: diagnosis and management using osteopathic manipulative medicine
Lavelle, J. M., McKeigue, M. E.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3645

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3646

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12
3647

Carpal tunnel syndrome: ultrasonographic imaging and pathologic mechanisms of median nerve compression
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3648

Die Integration der Osteopathie in die öffentliche Gesundheitsversorgung in Südtirol
(The integration of osteopathy in the public health care system in South Tyrol)
Morandell, R.
Unpublished MSc thesis, 2009/12
Free full text
3649

Profile of members of the Australian Osteopathic Association: Part 2 - The patients
Orrock, P.
International Journal of Osteopathic Medicine, 2009/12
3650

Die Rolle der Osteopathie in der Korrektur von Schädeldeformierungen bei Neugeborenen und Kleinstkindern
(The role of osteopathy in correcting cranial deformations in neonates and young infants)
Amiel-Tison, C., Soyez-Papiernik, E.
Osteopathische Medizin, 2009/12
3651

Beziehung und Bindung in der osteopathischen Kinderbehandlung
(Relationship and attachment in osteopathic treatment of children)
Dräger, K., Dräger, C.
Osteopathische Medizin, 2009/12
3652

Osteopathische Behandlung entwicklungsbedingter Hüftdysplasie bei Säuglingen während des ersten Lebensjahres
(Osteopathic treatment of developmental hip dysplasia in infants during the first year of life)
Lasovetskaya, L., Karpova, T.
Osteopathische Medizin, 2009/12
3653

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text
3654

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text
3655

Analyse critique de l’enseignement de techniques manipulatives rachidiennes basées sur les « lois de Fryette »
(Critical analysis of teaching spinal manipulation techniques based on the “Fryette laws“)
Zegarra-Parodi, R., Fabre, L.
Kinésithérapie, la Revue, 2009/12
3656

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text
3657

Empathie als Teil des Wahrnehmungsprozesses in der Osteopathie Teil II
(Empathy as part of the perception process in osteopathy, part 2)
Fiedler, I. C.
Unpublished MSc thesis, 2009/12
Free full text
3658

Der osteopathische Ansatz bei der gastroösophagealen Refluxerkrankung im Säuglingsalter
(The osteopathic approach to gastroesophageal reflux in infants)
Haindl, M.
Unpublished MSc thesis, 2009/12
Free full text
3659

The Neutral in biodynamic cranio-sacral osteopathy – an extraordinary state of consciousness
Nyul, G.
Unpublished MSc thesis, 2009/12
Free full text
3660

Osteopathy and Evidence Based Medicine. Analysis of Studies Investigating Benefits of Osteopathy as Treatment of Back Pain
Richter, A.
Unpublished MSc thesis, 2009/12
Free full text
3661

Der Einfluss der osteopathischen Behandlung auf die respiratorische Leistung bei Kindern mit Asthma bronchiale
(The influence of osteopathic treatment on the respiratory capabilities of children suffering from asthma)
Schäfer, E.M.
Unpublished MSc thesis, 2009/12
Free full text
3662

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text
3663

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text
3664

Effects of an osteopathic clinical based approach for the treatment of chronic non-specific low back pain in factory workers: A single cohort, pilot study
Yardley, S.
Unpublished MSc thesis, 2009/12
Free full text
3665

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3666

Osteopathic manipulative treatment in the management of notalgia paresthetica
Richardson, B. S., Way, B. V., Speece III., A. J.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3667

Kann eine Strain Counterstrain Technik die Beschwerden beim Restless-Legs-Syndrom lindern?
(Can a Strain Counterstrain technique help to alleviate the symptoms of the Restless Legs Syndrome?)
Kroll, T.
Unpublished MSc thesis, 2009/11
Free full text
3668

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3669

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text
3670

Reprint of: a preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2009/11
3671

Complementary and alternative health care use in young children with physical disabilities waiting for rehabilitation services in Canada
April, K. T., Feldman, D. E., Zunzunegui, M. V., Descarreaux, M., Grilli, L.
Disability and Rehabilitation, 2009/11
3672

Chronische Prostatitis/chronisches Beckenschmerzsyndrom. Einfluss osteopathischer Behandlungen - eine randomisiert kontrollierte Studie.
(Chronic prostatitis/chronic pelvic pain syndrome. Influence of osteopathic treatment - a randomized controlled study)
Marx, S., Cimniak, U., Beckert, R., Schwerla, F., Resch, K.L.
Urologe A, 2009/11
3673

Reliabilitätsstudie über die Befunderhebung der Wirbelsäule nach der Methode der Lien Mécanique Ostéopathique
(A reliability study on spine findings according to the LMO method)
Hafen-Bardella, C.
Unpublished MSc thesis, 2009/11
Free full text
3674

Osteopathie bei akuter Hörminderung im Tieftonbereich
(Osteopathic treatment of acute hearing loss in the low-frequency range)
Raanaas, H.
Unpublished MSc thesis, 2009/11
Free full text
3675

Schulmedizin – Osteopathie Das Wissen zur Osteopathie und deren Akzeptanz bei Ärzten im Kanton Zürich
(Conventional Medicine vs. Osteopathy: Knowledge of Osteopathy and its Acceptance by Conventionally Trained Physicians in the Canton of Zurich)
Wiesend, K.
Unpublished MSc thesis, 2009/11
Free full text
3676

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text
3677

3-Jahres Beobachtungsstudie osteopathischer und klinischer Parameter von Kindern mit diagnostizierter Haltungsasymmetrie
(3-year-observational-study of osteopathic and clinical parameters in children with diagnosed infantile postural asymmetry)
Bockius, D., Thomann, P.
Unpublished D.O. thesis, 2009/10
3678

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text
3679

Therapeutische Wirksamkeit der osteopathischen Behandlung bei Patienten mit funktioneller Stimmstörung
(Therapeutic effectiveness of osteopathic treatment in patients with functional dysphonia)
Braun, G., Seibl, G., Skrivanek, J.
Unpublished D.O. thesis, 2009/10
3680

Einfluss von osteopathischer und physiotherapeutischer Behandlung auf die idiopathische Säuglingsasymmetrie. Eine randomisierte kontrollierte Studie
(Evaluation of the effectiveness of osteopathic and physiotherapeutic intervention on idiopathic infantile asymmetry. A randomized controlled trial)
Brockmeyer, I., Exner-Panne, K., Peschke, K
Unpublished D.O. thesis, 2009/10
3681

Osteopathische Behandlung von Patienten mit Schulterschmerz. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of patients with shoulder pain. A randomized controlled trial)
Bube, J., Hettasch, J.
Unpublished D.O. thesis, 2009/10
3682

Untersuchung der therapeutischen Wirksamkeit osteopathischer Behandlungen bei Patienten mit chronischen Nackenschmerzen nach einem posttraumatischen Zervikalsyndrom durch ein Beschleunigungstrauma.
(Evaluation of the effectiveness of osteopathic treatments in patients with chronic neck pain after a posttraumatic cervical syndrome following a whiplash injury. A randomized controlled trial)
Engemann, K., Hofmeier, G.
Unpublished D.O. thesis, 2009/10
3683

Einfluss osteopathischer Behandlungen auf craniomandibuläre Dysfunktionen. Eine randomisierte kontrollierte Studie
(Influence of osteopathic treatments on Craniomandibular Dysfunction. A randomized controlled trial)
Gerber, B., Kästner, K., Schrammek, T.
Unpublished D.O. thesis, 2009/10
3684

Biomedical research competencies for osteopathic medical students
Cruser, D. A., Dubin, B., Brown, S. K., Bakken, L. L., Licciardone, J. C., Podawiltz, A. L., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text
3685

Hat eine entstauende osteopathische Leberbehandlung einen messbaren Einfluss auf den Durchfluss der Lebervenen?
(Do osteopathic liver-decongestion techniques influence the flow rate of the hepathic veins measurably?)
Haermeyer, C., Pott, S.
Unpublished D.O. thesis, 2009/10
3686

The immediate effect of individual manipulation techniques on pulmonary function measures in persons with chronic obstructive pulmonary disease
Noll, D. R., Johnson, J. C., Baer, R. W., Snider, E. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text
3687

Auswirkung von osteopathischen Behandlungen auf das Metabolische Syndrom
(Effectiveness of osteopathic treatment on the Metabolic Syndrome)
Kaske, R., Wittchow, R.
Unpublished D.O. thesis, 2009/10
3688

Haben osteopathische Behandlungen einen positiven Einfluss auf das Symptombild von Frauen, die an Endometriose erkrankt sind? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments influence the symptom-pattern in women suffering from endometriosis positively?)
Koop Dick, S.
Unpublished D.O. thesis, 2009/10
3689

(Does osteopathic treatment influence thoracolumbar junction back pain positively?)
Lützelberger, N.
Unpublished D.O. thesis, 2009/10
3690

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text
3691

Osteopathische Behandlung von Frauen mit Blasenentleerungsstörungen (BES). Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with voiding dysfunction. A randomized controlled trial)
Ringkamp, C., Rodriquez, B.
Unpublished D.O. thesis, 2009/10
3692

Osteopathie bei saisonal bedingter allergischer Rhinokonjunktivitis. Eine randomisierte kontrollierte Studie
Osteopathic treatment on Seasonal Allergic Rhinoconjuntivitis. A randomized controlled trial
Sachse-Sterlemann, K., Wernicke, K.
Unpublished D.O. thesis, 2009/10
3693

The impact of visceral osteopathic treatment on the meconium evacuation in very low birth weight infants
Haiden, N.
Unpublished MSc thesis, 2009/10
Free full text
3694

Effekte osteopathischer Behandlung auf Adipositias im Jugenalter. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment on adolescent obesity. A randomized controlled trial)
Schöndorfer, S., Wentzke, S.
Unpublished D.O. thesis, 2009/10
3695

Der Einfluss des Kontaktes zwischen Therapeut und Patient in der manuellen Therapie und Konsequenzen für die Osteopathie
(The impact of therapist-patient contact in manual therapy and its consequences on osteopathy)
Stöcker, R.
Unpublished D.O. thesis, 2009/10
3696

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3697

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3698

Erfahrungsbericht aus dem Basketball–Trainingslager
(Report on the Experiences Gained During the Basketball Training Camp of the Men's National Team)
Kaufmann, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3699

Akuter Bandscheibenvorfall
(Acute spinal disk herniation)
Klein, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3700

Neue Sportosteopathieausbildung an der OSD
(New sports osteopathy education at OSD)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3701

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3702

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3703

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10
3704

Migräne bei Kindern und Jugendlichen. Eine randomisierte kontrollierte Studie
(Migraine in children and adolescents. A randomized controll trial)
Aarts, U., Sterenberg, M., Wijnen, A.
Unpublished D.O. thesis, 2009/10
3705

Eficacia de la técnica osteopática de liberación del hueso lagrimal en la obstrucción congénita del conducto nasolagrimal
(Efficacy of the osteopathic technique of lacrimalis bone release in children with congenital nasolacrimal duct obstruction)
Navarro, J. P., Capo i Giner, J. V.
Osteopatia Cientifica, 2009/09-12
Free full text
3706

Management of chronic posttraumatic headache: a multidisciplinary approach
Channell, M. K., Mueller, L. L., Hahn, R.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3707

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3708

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3709

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09
3710

Osteopathie nach HWS-Schleudertrauma
(Osteopathy after whiplash injury)
Tempelhof, S.
Osteopathische Medizin, 2009/09
3711

Measurement of Cranial Palpation Pressures used by Professional Osteopaths
Zegarra-Parodi, R., De Chauvigny De Blot, P., Rickards, L., Naili, S., Renard, E.
European Journal of Pain, 2009/09
Free full text
3712

Application of Osteopathy in the Cranial Field to Successfully Treat Vertigo: A Case Series
Berkowitz, M. R.
The AAO Journal, 2009/09
Free full text
3713

A case report of Osteopathic Manipulative Treatment in a 14 year-old girl with McCune-Albright Syndrome
Colonvega, M., Hensel, K., Minotti, D. II., Williams, S.
The AAO Journal, 2009/09
Free full text
3714

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text
3715

Uncontrolled Asthma: Osteopathic Manipulative Treatment Applied in a Rural Setting
Sanchez, J. Jr.
The AAO Journal, 2009/09
Free full text
3716

Interest in rural medicine among osteopathic residents and medical students
Colegrove, D. J., Whitacre, B. E.
Rural and Remote Health, 2009/09
3717

Survey, systematisation and comparison of the Master of Science in Osteopathy training programmes by means of three schools
Höltl, A.
Unpublished MSc thesis, 2009/09
Free full text
3718

Ist die Ernährung Bestandteil der osteopathischen Untersuchung und Behandlung von selbständigen Osteopathen?
(Do self-employed osteopaths take nutrition into account when conducting diagnosis and treatment?)
Meuser-Scheliga, M.
Unpublished MSc thesis, 2009/09
Free full text
3719

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09
3720

Swedenborg's influence on Sutherland's ‘Primary Respiratory Mechanism’ model in cranial osteopathy
Jordan, T.
International Journal of Osteopathic Medicine, 2009/09
3721

Principios de la osteopatía en la investigación
(Osteopathic principles in research)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/09
3722

Influencias de la relación maxilomandibular en el tratamiento postural mediante inhibición muscular
(Influence of maxillomandibular relationship in postural treatment involving muscle inhibition)
Rodríguez Blanco, C., Torres-Lagares, D., Munuera-Martínez, P. V., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09
3723

Impact of osteopathic manipulative treatment on cost of care for patients with migraine headache: a retrospective review of patient records
Schabert, E., Crow, W. T.
The Journal of the American Osteopathic Association, 2009/08
Free full text
3724

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text
3725

The use of osteopathic manipulative treatment as adjuvant therapy in patients with peripheral arterial disease
Lombardini, R., Marchesi, S., Collebrusco, L., Vaudo, G., Pasqualini, L., Ciuffetti, G., Brozzetti, M., Lupattelli, G., Mannarino, E.
Manual Therapy, 2009/08
Free full text
3726

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3727

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3728

Cranial palpation pressures used by osteopathy students
Kary, D.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3729

Letter to the Editor (2) Regarding “Brachial Plexus Injuries in Neonates”
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3730

Survey results: OMT and CAM
Ramos, R. L., Sharma, S., Lipoff, D. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3731

Osteopathy in the cranial field provides an important contribution to the practice of medicine as a clinical application of osteopathic principles
Rosen, M. E.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3732

Brachial plexus injuries in neonates
Sucher, B. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3733

The road to becoming an osteopathic physician is long for a good reason
Zubcevik, N.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3734

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text
3735

Towards evidence based medicine for paediatricians. Is cranio-sacral therapy useful in the management of crying babies?
Bradley, E., Finlay, F.
Archives of Disease in Childhood, 2009/07
3736

Headache (chronic tension-type)
Krishnan, A., Silver, N.
BMJ Clinical Evidence, 2009/07
Free full text
3737

An investigation into the regulation of intra-cranial pressure and its influence upon the surrounding cranial bones
Gard, G.
Journal of Bodywork and Movement Therapies, 2009/07
3738

Exploring European osteopathic identity: An analysis of professional websites of European osteopathic organizations
Wagner, C.
Unpublished MSc thesis, 2009/07
Free full text
3739

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3740

Hand anlegen beim akuten Schulterschmerz?
(Lay a hand on acute shoulder pain?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3741

Akute Krankheitsbilder – Möglichkeiten und Grenzen der klinischen Osteopathie heute
(Acute Clinical Pictures – Chances and Limits of Today's Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3742

Sinusitis
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3743

Akute Halswirbelsäulenerkrankungen – Grenzbereiche
(Frontiers – Acute Diseases of the Cervical Spine)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07
3744

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text
3745

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Reeves, R. R., Burke, R. S.
The Journal of the American Osteopathic Association, 2009/06
Free full text
3746

Intent to “teach“ and pay to play in osteopathic medical education
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/06
Free full text
3747

Comments on cranio-sacral method and efficacy
Blacklaw-Jones, R. D.
International Journal of Osteopathic Medicine, 2009/06
3748

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text
3749

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text
3750

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06
3751

The effects of high-velocity low-amplitude thrust manipulation and mobilisation techniques on pressure pain threshold in the lumbar spine
Thomson, O. P., Haig, L., Mansfield, H.
International Journal of Osteopathic Medicine, 2009/06
3752

Einfluss von osteopathischen Behandlungen auf die Leistungsfähigkeit von Hobbyläufern: Masterthesis zur Erlangung des Masters of Science Osteopathie an der Donauuniversität Krems 2007
(Effect of osteopathic treatment on the athletic performance of hobby runners)
Haberl, F. J.
Osteopathische Medizin, 2009/06
3753

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text
3754

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text
3755

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text
3756

Clinical practice characteristics of osteopathic and allopathic primary care physicians at academic health centers: results from the National Ambulatory Medical Care Survey
Licciardone, J. C., Clearfield, M. B., Guillory, V. J.
Academic Medicine, 2009/06
Free full text
3757

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text
3758

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text
3759

Schwindel in der osteopathischen Praxis
(Dizziness in osteopathy practice)
Thomas, D.
Osteopathische Medizin, 2009/06
3760

Ein Wintermärchen: 13. Europäisches Symposium der Traditionellen Osteopathie
(A winter fairy tale: The 13th European Symposium on Traditional Osteopathy)
Vellmer, S.
Osteopathische Medizin, 2009/06
3761

The separate osteopathic medical education pathway: isn't it time we got our acts together? Counterpoint
Cohen, J. J.
Academic Medicine, 2009/06
Free full text
3762

Osteopathic manual medicine for vertigo: review of literature, case report, and future research
Fraix, M.
The AAO Journal, 2009/06
Free full text
3763

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text
3764

OMT as an adjunct therapy for post-traumatic headache in U.S. soldiers: A case series
Kozminski, M., Kozminski, T.
The AAO Journal, 2009/06
Free full text
3765

Osteopathic Manipulative Management in Sudden Infant Death Syndrome
MacDonald, R. C.
The AAO Journal, 2009/06
Free full text
3766

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text
3767

Case Study: An Osteopathic Approach to Management of a Patient with Charcot-Marie Tooth Syndrome Type II
Thoreson, M.
The AAO Journal, 2009/06
Free full text
3768

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06
3769

Contraindications in Osteopathy
Gatterbauer, A.
Unpublished MSc thesis, 2009/05
Free full text
3770

Treatment approaches in osteopathy for the therapy of migraine
Michal, I.
Unpublished MSc thesis, 2009/05
Free full text
3771

Umstellung von Physiotherapie auf Osteopathie – ein problembelasteter Prozess für Therapeuten in Deutschland?
(Re-orientation of a Practice from Physiotherapy to Osteopathy - A problematic process for therapists in Germany?)
Wieligmann, J.
Unpublished MSc thesis, 2009/05
Free full text
3772

The three leaves of Glénard- An examination of a functional aspect
Wolke, N.
Unpublished MSc thesis, 2009/05
Free full text
3773

Osteopathic manipulative medicine in pregnancy: Acute physiological and biomechanical effects
Hensel, K. L.
Unpublished PhD thesis, 2009/05
3774

The Changing Face of Medical Education: The Role of Religion, Integrative Medicine and Osteopathy
Grossoehme, D. H., Ragsdale, J., Dixon, C., Berz, K., Zimmer, M.
The Open Medical Education Journal, 2009/05
Free full text
3775

Osteopathic manipulative treatment and carpal tunnel syndrome: Analysis of pathogenesis, mechanisms of treatment and applicability to specific and general populations
Walz, B. D.
Unpublished MSc thesis, 2009/05
3776

Efectos inmediatos del estiramiento de los músculos isquiosurales en el sistema estomatognático en la cervicalgia mecánica
(The immediate effects of hamstring muscle stretching on the stomatognathic system in mechanical neck pain)
Bretischwerdt, C., Rivas, L., Palomeque, L., Alburquerque, F.
Osteopatía Científica, 2009/05
3777

Impacto de las técnicas manuales usadas en osteopatía sobre los propioceptores musculares: revisión de la literatura científica
(Impact of manual osteopathic techniques on muscle proprioceptors: a literature review)
González, I.
Osteopatía Científica, 2009/05
3778

Estenosis foraminal con radiculopatía debida a hernia de disco cervical en un varón de 33 años tratado con manipulación de flexión-distracción de Cox de descompresión
(Foraminal stenosis with radiculopathy from a cervical disc herniation in a 33-year-old man treated with flexion distraction decompression manipulation)
Gudavalli, S., Kruse, R. A.
Osteopatía Científica, 2009/05
3779

Dolor y estrategias terapéuticas en osteopatía (III)
(Pain and therapeutic approaches in osteopathy (III))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/05
3780

Técnica semidirecta de thrust con kick para lesión de ilíaco anterior izquierdo
(Semidirect thrust kick technique in left anterior iliac dysfunction)
Mancha, J. A. D., Martín, C. O.
Osteopatía Científica, 2009/05
3781

Osteopatía basada en la evidencia
(Evidence-based osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/05
3782

Repercusiones sintomáticas de la técnica dog en extensión bilateral sobre D5/D6 en pacientes dispépticos
(Symptomatic impact of the bilateral extension dog technique on T5-T6 in dyspeptic patients)
Sánchez Jiménez, E., Díaz, J. R.
Osteopatía Científica, 2009/05
3783

Intent to “teach“ and pay to play in osteopathic medical education
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/04
Free full text
3784

Estimating cost of care for patients with acute low back pain: a retrospective review of patient records
Crow, W. T., Willis, D. R.
The Journal of the American Osteopathic Association, 2009/04
Free full text
3785

Modificaciones en la presión intraocular y la presión arterial en pacientes con diabetes mellitus tipo 1 tras la manipulación global occipucio-atlas-axis según Fryette. Ensayo clínico aleatorizado
(Modifications in intraocular and blood pressure in type I diabetics after Fryette's occiput-atlas-axis manipulation. A randomized clinical trial)
Díaz Cerrato, I., Martínez Loza, E., Martín-Ampudia Ugena, M. I.
Osteopatía Científica, 2009/04
3786

Spinal and sacroiliac assessment and treatment techniques used by osteopathic physicians in the United States
Fryer, G., Morse, C. M., Johnson, J. C.
Osteopathic Medicine and Primary Care, 2009/04
Free full text
3787

Dolor y estrategias terapéuticas en osteopatía (II)
(Pain and therapeutic approaches in osteopathy (II))
Hernández Xumet, J. E.
Osteopatía Científica, 2009/04
3788

Validez del test de deslizamiento posteroanterior cervical medio respecto a análisis radiológico dinámico
(Validity of the postero-anterior middle cervical spine gliding test with respect to dynamic radiological analysis)
Rey Eiriz, G., Alburquerque Sendín, F., Barrera Mellado, I., Martín Vallejo, F. J.
Osteopatía Científica, 2009/04
3789

La investigación, el desarrollo y la innovación en osteopatía
(Research, development and innovation in osteopathy)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2009/04
3790

Osteopatía en un trastorno grave de la deglución
(Osteopathic medicine in severe swallowing dysfunction)
Velasco Roldán, O., Pascual-Vaca, J. O., Solana Díaz, M. T., Outón Ruíz, L., Sebastián Rausell, J. M.
Osteopatía Científica, 2009/04
3791

Etudiant osteopathe en geriatrie
(Osteopathy student in geriatrics. Interview by Agnes Maillard)
Forget, S.
Soins. Gerontologie, 2009/03-04
3792

An investigation into the effects of manual technique targeted towards psoas major muscle on lumbar range of motion
Gabin, M.
Unpublished MSc thesis, 2009/03
Free full text
3793

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3794

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3795

Don't neglect the “art“ of medicine
Kleman, P. G.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3796

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3797

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques
Noll, D. R.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3798

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03
3799

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3800

Does osteopathic manipulative treatment (OMT) improves outcomes in patients who develop postoperative ileus: A retrospective chart review
Crow, W. T., Gorodinsky, L.
International Journal of Osteopathic Medicine, 2009/03
3801

Introducing the new masterclass section
Moran, R.
International Journal of Osteopathic Medicine, 2009/03
3802

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text
3803

Profile of members of the Australian Osteopathic Association: Part 1 - The practitioners
Orrock, P.
International Journal of Osteopathic Medicine, 2009/03
3804

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03
3805

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text
3806

The Use Of Heel Lifts and Custom Orthotics In Reducing Self-Reported Chronic Musculoskeletal Pain Scores
Lipton, J. A., Flowers-Johnson, J., Bunnell, M. T., Carter, L.
The AAO Journal, 2009/03
Free full text
3807

Comparison of osteopathy with manual therapy (according to the CRAFTA® concept) for the treatment of patients with craniomandibular dysfunctions (CMD)
Hörster, A.
Unpublished MSc thesis, 2009/03
Free full text
3808

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text
3809

Anamnesegesteuerte Palpation
(Anamnesis-guided palpation)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
3810

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text
3811

New horizons for research and education in osteopathic manipulative medicine
Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2009/02
Free full text
3812

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
3813

Professional satisfaction among new osteopathic family physicians: a survey-based investigation of residency-trained graduates
Simpson, C., Cutright, M., Heh, V., Simpson, M. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text
3814

Cranial palpation pressures used by osteopathy students: effects of standardized protocol training
Zegarra-Parodi, R., de Chauvigny de Blot, P., Rickards, L. D., Renard, E.O.
The Journal of the American Osteopathic Association, 2009/02
Free full text
3815

Osteopathic Medicine and Primary Care looks forward to 2009
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/02
Free full text
3816

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02
3817

Spracherwerb und osteopathische Gedanken zur Dyslalie
(Language acquisition and osteopathic thought in regards to dyslalia)
Riedel, M.
Osteopathische Medizin, 2009/02
3818

Abenteuer Osteopathie: Die Arbeit des Vereins Internationale Osteopathie e.V. (INO)
(The adventure of osteopathy: The work of the INO (Verein Internationale Osteopathie e.V.))
Ries, M., Bauer, C.
Osteopathische Medizin, 2009/02
3819

Fifth International Symposium on Advances in Osteopathic Research
Schwerla, F.
Osteopathische Medizin, 2009/02
3820

Manipulative therapy and clinical prediction criteria in treatment of acute nonspecific low back pain
Hallegraeff, J. M., de Greef, M., Winters, J. C., Lucas, C.
Perceptual and Motor Skills, 2009/02
3821

Osteopathy and pregnancy
Hyde, D.
The Practising Midwife, 2009/02
3822

Hat eine osteopathische Behandlung Einfluss auf den emotionalen Gefühlszustand?
(Does an osteopathic treatment have any influence on emotions?)
Dettling, C.
Unpublished MSc thesis, 2009/02
Free full text
3823

Einfluss der Osteopathie auf Uroflowmetrie, Miktionsbeschwerden und Lebensqualität bei Männern mit einer symptomatischen benignen Prostatahyperplasie
(Influence of Osteopathy on Uroflowmetry, Lower Urinary Tract Symptoms and Quality of Life in Men with Symptomatic Benign Prostatic Hyperplasia)
Gadringer, K.H.
Unpublished MSc thesis, 2009/02
Free full text
3824

Criteria to Determine Intervals of Treatment
Halasz, C.
Unpublished MSc thesis, 2009/02
Free full text
3825

Dissecting: how does it change the professional practice and the perspective of an osteopath?
Kober, E.
Unpublished MSc thesis, 2009/02
Free full text
3826

Osteopathy - the way from therapy to prevention
May, M.
Unpublished MSc thesis, 2009/02
Free full text
3827

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text
3828

Is the osteopathic treatment to be seen as an alternative method for treating and successfully supporting opiate addicts during withdrawal and detoxication?
Neuhold, G.
Unpublished MSc thesis, 2009/02
Free full text
3829

Is there an Unanimous Opinion on William Garner Sutherland’s Biodynamic Model among Osteopaths in Certain Parts of Germany?
Gehrmann, W.
Unpublished MSc thesis, 2009/02
Free full text
3830

The effect of osteopathic manipulative techniques on diaphragm movement and respiratory function in asymptomatic subjects
Hosking, S.
Unpublished MSc thesis, 2009/01
Free full text
3831

What is potency? Exploring practitioners’ experiences of the phenomenon of potency in osteopathy in the cranial field
Harrison, H.
Unpublished MSc thesis, 2009/01
Free full text
3832

An investigation of patient experiences of treatment in the cranial field of osteopathy
Greene, D.
Unpublished MSc thesis, 2009/01
Free full text
3833

Work related musculoskeletal disorders among osteopaths practicing in New Zealand: A national survey
Fitchew, G. J.
Unpublished MSc thesis, 2009/01
Free full text
3834

Preliminary prediction models for autonomic nervous system response to a cranial osteopathic technique
Collard, K.
Unpublished MSc thesis, 2009/01
Free full text
3835

Attitudes and beliefs of New Zealand osteopaths towards chronic pain
Carrington, A. L.
Unpublished MSc thesis, 2009/01
Free full text
3836

An investigation of the experience of osteopathically treating babies with breastfeeding problems
Carey, L.
Unpublished MSc thesis, 2009/01
Free full text
3837

Collaboration and excellence in osteopathic medical research
Manion, K. M.
The Journal of the American Osteopathic Association, 2009/01
Free full text
3838

A for-profit medical school
Mychaskiw, G., 2nd, Wiltshire
Academic Medicine, 2009/01
Free full text
3839

Ist die Osteopathie eine sinnvolle Maßnahme in Kombination mit Hippotherapie bei einem CP-Kind?
Is Osteopathy combined with Hippotherapy a Sensible Therapeutic Measure for the Treatment of Children with Cerebral Palsy?
Günter, P.
Unpublished MSc thesis, 2009/01
Free full text
3840

Osteopathen/innen und ihre eigene Gesundheit
(Osteopaths and their own health)
Hlucil, C.
Unpublished MSc thesis, 2009/01
3841

The Use of Osteopathic Manipulation in a Clinic and Home Setting to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
Unpublished PhD thesis, 2009/01
3842

Wie lassen sich osteopathische Techniken für die Behandlung von Kindern adaptieren? – Die Herangehensweise des Osteopathischen Zentrums für Kinder in Wien
(How Can Osteopathic Techniques Be Adapted for the Treatment of Children?)
Burian–Lang, E., Mückler, A., Urbanek, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3843

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
3844

Relationship of Osteopathic Manipulative Treatment During Labor and Delivery on Selected Maternal Morbidity Outcomes: A Randomized Controlled Trial
Keurentjes, A. E.
Unpublished PhD thesis, 2009/01
Free full text
3845

New Zealand osteopaths’ attitudes to ‘Evidence-based practice’ – development of a questionnaire and preliminary results
Wittwer Blaser, P.
Unpublished MSc thesis, 2009/01
Free full text
3846

An investigation of why osteopaths choose to leave the profession
Kleinbaum, A.
Unpublished MSc thesis, 2009/01
Free full text
3847

Healing Hands: Using Osteopathic Manipulative Treatment to Address Visceral Structures through Somatovisceral Reflexes: A Case Study in Gastroesophageal Reflux Disease
Branyon, B.
The AAO Journal, 2008/12
Free full text
3848

Contemplations on the Art of OMT After Thirty Years of Practice: 2008 Northup Lecture
Steele, K. M.
The AAO Journal, 2008/12
Free full text
3849

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text
3850

Test-dependent osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system: A pre-post pilot trial
Zorgman, M., Sauerburger, S., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12
3851

Exploring the use of exercise therapy in UK osteopathic practice
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2008/12
3852

Service delivery characteristics of UK osteopaths – a cross sectional survey
Vogel, S., Herrick, R.
International Journal of Osteopathic Medicine, 2008/12
3853

Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with chronic rhino sinusitis (CRS)? A randomized controlled trial
Steinbauer, U., Roos, S., Amann, P., Schwerla, F., Resch, K. L.
International Journal of Osteopathic Medicine, 2008/12
3854

A randomised controlled trial on the effectiveness of osteopathic manipulative treatment of chronic low back pain
Mandara, A., Fusaro, A., Musicco, M., Bado, F.
International Journal of Osteopathic Medicine, 2008/12
3855

The assessment of clinical practice in osteopathic education: Is there a need to define a gold standard?
London, S.
International Journal of Osteopathic Medicine, 2008/12
3856

Attitudes towards research in Australian and New Zealand osteopaths
Gosling, C., Moran, R., Vogel, S.
International Journal of Osteopathic Medicine, 2008/12
3857

How do patients feel post-treatment? pilot study at a UK osteopathic teaching clinic of self-reported adverse events
Froud, R., Rajendran, D., Fossum, C., Collins, P., Mullinger, B.
International Journal of Osteopathic Medicine, 2008/12
3858

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12
3859

Multisensory integration in an osteopathic clinical examination setting
Esteves, J. E., Geake, J., Spence, C.
International Journal of Osteopathic Medicine, 2008/12
3860

Research underpins the evidence base for osteopathic medicine
Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12
Free full text
3861

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12
3862

Three pathways to a physician career: applicants to U.S. MD and DO schools and U.S. Citizen applicants to international medical schools
Jolly, P., Garrison, G., Boulet, J. R., Levitan, T., Cooper, R. A.
Academic Medicine, 2008/12
3863

Assessing clinical competence in osteopathic education: Analysis of outcomes of different assessment strategies at the British School of Osteopathy
Abbey, H.
International Journal of Osteopathic Medicine, 2008/12
3864

Mathematical analysis of applied loads on skeletal muscles during manual therapy
Chaudhry, H., Bukiet, B., Findley, T.
The Journal of the American Osteopathic Association, 2008/12
Free full text
3865

Response: Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Fitzgerald, M.
The Journal of the American Osteopathic Association, 2008/12
Free full text
3866

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text
3867

Cambios en la presión arterial y frecuencia cardíaca después de una presión sobre la válvula aórtica en sujetos con hipertensión arterial esencial
(Changes in arterial pressure and cardiac frequency after pressure on the aortic valve in patients with essential hypertension)
Benito, M. M., Marín, R. C.
Osteopatía Científica, 2008/12
3868

Eficacia de una técnica de thrust para la disfunción glenohumeral en superioridad
(Efficacy of a thrust technique for upward glenohumeral dysfunction)
García Vila, S. F., Sánchez, C. C.
Osteopatía Científica, 2008/12
3869

Dolor y estrategias terapéuticas en osteopatía (I)
(Pain and therapeutic approaches in osteopathy (I))
Hernández Xumet, J. E.
Osteopatía Científica, 2008/12
3870

Eficacia del tratamiento osteopático en la rinosinusitis crónica del adulto
(Efficacy of osteopathic treatment in adult chronic rhinosinusitis)
Méndez Sánchez, R.
Osteopatía Científica, 2008/12
3871

La osteopatía como método científico
(Osteopathy as a scientific method)
Rodríguez Blanco, C., Almazán Campos, G., Ricard, F.
Osteopatía Científica, 2008/12
3872

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text
3873

Eine Annäherung an die Craniosacral-Arbeit in der Kinderkrankenpflege.
(Familiarity with craniosacral nursing in pediatric nursing)
Potzinger, S.
Kinderkrankenschwester, 2008/12
3874

Spinal and sacroiliac joint assessment and treatment within the American osteopathic profession
Fryer, G., Morse, C., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12
3875

The introduction of a novel approach to the teaching and assessment of osteopathic manipulative medicine assessment skills
Fossum, C., Snider, E., Fryer, G., Gillette, N., Degenhardt, B.
International Journal of Osteopathic Medicine, 2008/12
3876

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12
3877

The hands of the osteopaths. Thinking fingers. Their special training
Hansak, S.
Unpublished MSc thesis, 2008/11
Free full text
3878

How often are thrust techniques used in practice
Pingitzer, T.
Unpublished MSc thesis, 2008/11
Free full text
3879

Neurobiologische Aspekte eines Knackgeräusches im Rahmen einer HVLA Technik
(Neurobiological aspects of a cracking noise within the framework of an HVLA technique)
Beck, M.
Osteopathische Medizin, 2008/11
3880

Osteopathie zur Optimierung des Golfschwunges
(Osteopathy for the optimization of the golf swing)
Marcucci, S.
Osteopathische Medizin, 2008/11
3881

Kalzifikation der Supraspinatussehne- ein osteopathischer Ansatz?
(Calcification of the Supraspinatus muscle - an osteopathic approach?)
Schwarz, H.
Unpublished MSc thesis, 2008/11
Free full text
3882

Mobility and other parameters of the musculoskeletal system before and after an osteopathic treatment of the eye and its directly connected structures with patients having myopia, hyperopia and/or astigmatism
Pesendorfer, M.
Unpublished MSc thesis, 2008/11
Free full text
3883

Osteopathie in der Pädiatrie, Teil 4: Sakrum und Os sphenoidale
(Osteopathy in Pediatrics Part 4: Sacrum and Os Sphenoidale)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3884

Der Einfluss osteopathischer Behandlungsmethoden bei craniomandibulären Dysfuntionen
(The influence of osteopathic treatment on temporomandibular disorders)
Radosai, F.
Unpublished MSc thesis, 2008/11
Free full text
3885

Can osteopathic treatments improve the overall picture of the patient with a common migraine?
Spannbauer, M.
Unpublished MSc thesis, 2008/11
Free full text
3886

Die Wirksamkeit einer osteopathischen Intervention bei Patienten mit einem einseitigen Tinnitus-aurium
(The effectiveness of osteopathic intervention at patients with a single-sided tinnitus aurium)
Twigt, P.
Unpublished MSc thesis, 2008/11
Free full text
3887

Is Sacral Listening Applied in a Uniform Way?
Krapp, B.
Unpublished MSc thesis, 2008/11
Free full text
3888

Modern Reception of A.T.Still´s TRIUNE MAN in Germany
Kaiser, F.
Unpublished MSc thesis, 2008/11
Free full text
3889

The living matrix: a model for the primary respiratory mechanism
Lee, R. P.
Explore (NY), 2008/11
3890

The Influence of a Mobilisation of the Lesser Omentum on the Capacity of the Portal Vein, Measured with Echo-Doppler
Halbeisen, H.
Unpublished MSc thesis, 2008/11
Free full text
3891

Spastische Diparese
(Spastic paresis)
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3892

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3893

Functional gestational problems and osteopathy
Steinbauer, S.
Unpublished MSc thesis, 2008/11
Free full text
3894

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3895

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11
3896

Patient perception of osteopathic manipulative treatment in a hospitalized setting: a survey-based study
Pomykala, M., McElhinney, B., Beck, B. L., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3897

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text
3898

Manuelle Medizin an der Halswirbelsäule: Atraumatische Weichtechnik der Chirotherapie und HVLA-Technik der Osteopathie im Synergismus
(Manuel medicine targeting the cervical spine: Synergies between atraumatic chiropractic techniques and osteopathy's HLVA-technique)
Stahlhofer, H.
Osteopathische Medizin, 2008/11
3899

Haben osteopathische Behandlungen einen Einfluss auf die Artikulationsfähigkeit bei Vorschulkindern mit Sigmatismus / Schetismus? Eine randomisierte kontrollierte Studie
(Can osteopathic treatments improve the capability of articulation and speech of children between four and six years suffering from speech disorders (Dyslalia). A randomized controlled trial)
Beckewitz-Hübner, M., Kraus, M.
Unpublished D.O. thesis, 2008/10
3900

Osteopathische Behandlungen von Patienten mit Miktionsbeschwerden (LUTS) bei benigner Prostatahyperplasie
(Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia)
Conrad, U., Scheuer, K.
Unpublished D.O. thesis, 2008/10
3901

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10
3902

Der Einfluss der osteopathischen Behandlung bei funktioneller Stimmstörung. Eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment in Functional Vocal Dysfunction. A randomized controlled trial)
Fleischer, F., Weese, P.
Unpublished D.O. thesis, 2008/10
3903

Empathie und Osteopathie. Eine Begriffsbestimmung der Empathie und eine Untersuchung der Empathiefähigkeit und deren Bedeutung im Therapeuten-Patienten-Verhältnis derzeit tätiger Osteopathen
(Empathy and Osteopathy. A systematic review and cross-sectional survey)
Hähn-Jakobs, C.
Unpublished D.O. thesis, 2008/10
3904

Patients' perceptions and satisfaction with treatment in a UK osteopathic training clinic
Strutt, R., Shaw, Q., Leach, J.
Manual Therapy, 2008/10
3905

Osteopathische Behandlung des Icterus neonatorum bei gesunden Neugeborenen. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of the neonatal jaundice of the healthy newborn. A randomised controlled trial)
Kenter, A., Schmieder, S.
Unpublished D.O. thesis, 2008/10
3906

Die osteopathische Behandlung von Frauen mit Descensus uteri
(Osteopathic treatment of women with uterine prolapse. A randomized controlled trial)
Kocheise-Miller, B, Quell, K.
Unpublished D.O. thesis, 2008/10
3907

Die osteopathische Behandlung von kindlichen und juvenilen Wachstumsschmerzen. Eine randomisierte kontrollierte Studie
(The osteopathic treatment of infantile and juvenile growing pains. A randomized controlled trial)
Löhr, M., Treinies, T.
Unpublished D.O. thesis, 2008/10
3908

Die osteopathische Behandlung von Säuglingen zwischen dem 4. und 12. Lebensmonat mit kongenitaler Tränenwegsstenose. Eine randomisierte kontrollierte Studie
(The osteopathic treatment in infants (4 to 12 month) with congenital nasolacrimal duct obstruction. A randomized controlled trial)
Heinisch, M., Oberhuber, H.
Unpublished D.O. thesis, 2008/10
3909

Osteopathische Behandlung bei somatoformen autonomen Funktionsstörungen des Herz- und Kreislaufsystems
(Osteopathic treatment of patients with cardiovascular somatoform autonomic dysfunctions (SAD). A randomized controlled trial)
Mühlen, N.
Unpublished D.O. thesis, 2008/10
3910

Können osteopathische Behandlungen einen Beitrag zur Verbesserung der Symptomatik chronischer funktioneller Obstipation leisten?
(Can Osteopathic treatments afford a contribution to improve the symptoms of chronic functional constipation?)
Schulz, P., Servatius, C.
Unpublished D.O. thesis, 2008/10
3911

Intra- and Inter-Rater Reliability of the Test: Anteromedial Position of the Talus in the Talocrural Joint
Dornieden, R.
Unpublished MSc thesis, 2008/10
Free full text
3912

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text
3913

Supporting and promoting osteopathic medicine through community-based family practice preceptorships: a survey-based study
Aguwa, M. I., Monson, C. L., Liechty, D. K., Fowler, L. V., Kost, M. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3914

Effectiveness of osteopathy in the cranial field and myofascial release versus acupuncture as complementary treatment for children with spastic cerebral palsy: a pilot study
Duncan, B., McDonough-Means, S., Worden, K., Schnyer, R., Andrews, J., Meaney, F. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3915

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3916

Osteopathische Behandlung von Patienten mit Tinnitus und craniomandibulären Dysfunktionen
(Test-dependent osteopathic treatment of patients suffering from craniomandibular disorders (CMD) and tinnitus. A pre-post pilot trial)
Kronau, J. S., Moshövel, N.
Unpublished D.O. thesis, 2008/10
3917

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3918

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text
3919

OsteopathInnen in Österreich Bestandsaufnahme 2011 (Vollerhebung), Vergleich mit internationalen Daten und Untersuchung der Entwicklung des Berufsbildes und –standes seit 2003
(Osteopaths in Austria, 2011 extensive survey, comparison with international data and examination of the osteopathic profession's development since 2003)
Graf, B.
Unpublished MSc thesis, 2008/10
Free full text
3920

The influence of osteopathic treatments on the flexibility, technique and performance of juvenile high performance swimmers and high performance triathletes
Kattnig, W.
Unpublished MSc thesis, 2008/09
Free full text
3921

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text
3922

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text
3923

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
3924

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09
3925

Osteopathic support for a survivor of gastric cancer: A case report
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/09
3926

Osteopathen/innen und Ärzte/innen - ein Spannungsfeld ?
(Osteopaths and Physicians - An area of conflict?)
Lammer, M.
Unpublished MSc thesis, 2008/09
Free full text
3927

Aetiology of idiopathic scoliosis. Current biomedical research and osteopathic theories
Lüftinger, M.
Unpublished MSc thesis, 2008/09
Free full text
3928

The Meaning of Tensegrity Principles in Osteopathic Medicine
Pflüger, C.
Unpublished MSc thesis, 2008/09
Free full text
3929

Osteopathic treatment during immobilization of conservatively treated radial fractures in patients older than 45 years
Martschini, G.
Unpublished MSc thesis, 2008/09
Free full text
3930

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text
3931

Back to basic science: time for another Flexner report
Weissmann, G.
FASEB Journal, 2008/09
3932

W.G.Sutherland - Seine Bedeutung in der Osteopathie einst und jetzt
William Garner Sutherland, The Founder of Cranial Osteopathy
Geppert, G.
Unpublished MSc thesis, 2008/09
Free full text
3933

Will the ‘real’ osteopathy please speak up?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/09
Free full text
3934

Commentary on ‘Is there a place for science in the definition of osteopathy’?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09
3935

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text
3936

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3937

One hundred thousand cases of influenza with a death rate of one-fortieth of that officially reported under conventional medical treatment
Dery, M.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3938

Osteopathic manipulation: promise for infantile colic
Friedman, S. J.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3939

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3940

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text
3941

Can back pain caused by symptom-giving sacroiliac joint relaxation during pregnancy be reduced by applying osteopathic treatment?
Aspalter, W.
Unpublished MSc thesis, 2008/09
Free full text
3942

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3943

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3944

Bedeutung der Haut im Umgang mit Säuglingen
(Significance of the Skin when Dealing with Infants)
Kuhlmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3945

Atopische Dermatitis: (osteopathische) Hand anlegen!
(Atopic dermatitis: (osteopathic) hands on!)
Oezbay, I., Reckwerth, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3946

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3947

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3948

12. Europäisches Symposium der traditionellen Osteopathie – Februar 2008 auf Frauenchiemsee
(12th European Symposium of Traditional Osteopathy - February 2008 at Frauenchiemsee)
Torres, I. L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3949

ED physicians beware when using OMT for patients with motor vehicle injuries
Fletcher, S. A.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3950

Therapie über die Körperoberfläche – Anatomische und physiologische Aspekte der neurolymphatischen Reflexpunkte am Beispiel der Augen– und Ohrzonen
(Therapy via the Body Surface – Anatomical and Physiological Aspects of the Neurolymphatic Reflex Points by the Example of Eye and Ear Zones)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
Free full text
3951

Unterhautblutung
(Subcutaneous hemorrhage)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3952

Erste Ansätze in der osteopathischen Behandlung der Haut
(First Approaches in the Osteopathic Treatment of the Skin)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08
3953

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3954

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3955

Técnica combinada de articulación y thrust para disfunción de cóndilo posterior
(The combined articular thrust technique for posterior condyle dysfunction)
Guirao Cano, D.
Osteopatía Científica, 2008/08
3956

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3957

Dolor craneofacial, craneomandibular y craneocervical. Diseño de caso único
(Craniofacial, craniocervical and/or craniomandibular pain: a single case design)
Hernández Xumet, J. E.
Osteopatía Científica, 2008/08
3958

Efectos de un protocolo secuenciado de terapia manual en los puntos gatillo latentes miofasciales de los maseteros
(Effects of a protocol of two manual techniques on latent myofascial trigger points of the masseter muscle)
Ibáñez García, J., Alburquerque Sendín, F.
Osteopatía Científica, 2008/08
3959

Posible manifestación de disfunción de la articulación temporomandibular en los estudios radiológicos quiroprácticos de las vértebras cervicales
(Possible manifestation of temporomandibular joint dysfunction on chiropractic cervical X-ray studies)
Knutson, G. A., Jacob, M.
Osteopatía Científica, 2008/08
3960

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3961

Efecto de la manipulación de la charnela occipito-atlo-axoidea en la apertura de la boca
(Effect of upper cervical spine manipulation on mouth opening)
Mansilla Ferragud, P., Boscá Gandia, J. J.
Osteopatía Científica, 2008/08
3962

Sistema estomatognático, osteopatía y postura
(The stomatognathic system, osteopathy and posture)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C.
Osteopatía Científica, 2008/08
3963

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3964

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3965

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3966

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text
3967

Manuelle Medizin in der Pädiatrie: ein osteopathischer Ansatz: Auszüge aus dem neuen Buch: Pediatric Manual Medicine: an osteopathic approach
(Pediatric manual medicine: An osteopathic approach)
Carreiro, J. E.
Osteopathische Medizin, 2008/07
3968

Behandlung der Enuresis nocturna in der Osteopathie
(Treatment of noctural enuresis in osteopathy)
Liem, T.
Osteopathische Medizin, 2008/07
3969

Osteopathic treatment of patients with chronic non-specific neck pain: a randomised controlled trial of efficacy
Schwerla, F., Bischoff, A., Nurnberger, A., Genter, P., Guillaume, J.P., Resch, K.L.
Forschende Komplementärmedizin, 2008/07
3970

Rediscovering the classic osteopathic literature to advance contemporary patient-oriented research: A new look at diabetes mellitus
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2008/07
3971

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3972

Inpatient osteopathic structural examinations: is “red tape“ getting in the way of personalized patient care?
Fennig Jr., G. A., Shubrook Jr., J. H.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3973

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3974

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3975

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3976

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3977

DOs need to define value of osteopathic medicine
Snow, R. J., Seffinger, M. A., McGill, S. L., Vincent, R. A.
The Journal of the American Osteopathic Association, 2008/07
Free full text
3978

Use of inappropriate titles by New Zealand practitioners of acupuncture, chiropractic, and osteopathy
Gilbey, A.
The New Zealand Medical Journal, 2008/07
3979

Role of exercise therapy in osteopathic education, treatment and management
Zamani, J. M.
Unpublished PhD thesis, 2008/07
Free full text
3980

Teaching critical thinking in osteopathy – Integrating craft knowledge and evidence-informed approaches
Fryer, G.
International Journal of Osteopathic Medicine, 2008/06/01/
3981

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06
3982

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text
3983

An Osteopathic Approach to Visceral Disease: A Case of Recurrent Urinary Tract Infection
Lerma, C., Mesisca, M., Hruby, R. J.
The AAO Journal, 2008/06
Free full text
3984

Criticality, research, scholarship and teaching: Osteopaths as educators – what makes a good teacher?
Wallace, S. S.
International Journal of Osteopathic Medicine, 2008/06
3985

Due thanks, moving forward, and valuing the journey
Vogel, S.
International Journal of Osteopathic Medicine, 2008/06
Free full text
3986

Consistency of standing and seated posture of asymptomatic male adults over a one-week interval: A digital camera analysis of multiple landmarks
Pownall, P. J., Moran, R. W., Stewart, A. M.
International Journal of Osteopathic Medicine, 2008/06
3987

Educating osteopaths to be researchers - what role should research methods and statistics have in an undergraduate curriculum?
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2008/06
Free full text
3988

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text
3989

Place de l’ostéopathie dans la correction des déformations crâniennes du nouveau-né et du jeune enfant
(Cranial osteopathy as a complementary treatment of postural plagiocephaly)
Amiel-Tison, C., Soyez-Papiernik, E.
Archives de Pédiatrie, 2008/06
3990

Solitary fibrous pleural tumor
Jenkins, L. A., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2008/06
Free full text
3991

Saying what you mean and meaning what you say
Rogers, F. J.
The Journal of the American Osteopathic Association, 2008/06
Free full text
3992

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text
3993

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05
3994

Osteopathische Medizin und ihre Anpassung an das Älterwerden
(Osteopathic medicine and its adjustment to aging patients)
Hruby, R.
Osteopathische Medizin, 2008/05
3995

Der Befundungsprozess in der Osteopathie
(The diagnostic process in osteopathy)
Abpfolter, M.
Unpublished MSc thesis, 2008/05
3996

Constraints to caring: service to medically indigent patients by allopathic and osteopathic physicians
Chirayath, H. T., Wentworth, A. L.
Journal of Health Care for the Poor and Underserved, 2008/05
3997

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
3998

Modified Muncie technique: osteopathic manipulation for eustachian tube dysfunction and illustrative report of case
Channell, M. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
3999

Immediate effects of osteopathic manipulative treatment in elderly patients with chronic obstructive pulmonary disease
Noll, D. R., Degenhardt, B. F., Johnson, J. C., Burt, S. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4000

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4001

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4002

Osteopathic manipulative treatment for postoperative nausea and vomiting
Schrick-Senasac, S. L.
Unpublished MSc thesis, 2008/05
4003

Practice patterns of osteopathic physicians providing end-of-life care: a survey-based study
Mason, D. C., McElrath, S., Penn-Erskine, C., Kramer-Feeley, V., Pomerantz, S. C., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4004

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text
4005

Osteopathische Diaphragmen und Wandlungsphasen
(Osteopathic diaphragms and transformation phases)
Wendling, D.
KIM - Komplementare und Integrative Medizin, Ärtztezeitschrift fur Naturheilverfahren, 2008/04
4006

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04
4007

Osteopathie in der Pädiatrie, Teil 3: Das Os temporale
(Osteopathy in Pediatrics, Part 3: The Temporal Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4008

Expression of the endocannabinoid system in fibroblasts and myofascial tissues
McPartland, J. M.
Journal of Bodywork and Movement Therapies, 2008/04
4009

A randomized controlled trial of the effectiveness of osteopathy-based manual physical therapy in treating pediatric dysfunctional voiding
Nemett, D. R., Fivush, B. A., Mathews, R., Camirand, N., Eldridge, M. A., Finney, K., Gerson, A. C.
Journal of Pediatric Urology, 2008/04
Free full text
4010

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4011

Karpaltunnelsyndrom
(Carpal tunnel syndrome)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04
4012

A.T. Still would not be proud
Fisher, C. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4013

Repercusiones sobre los niveles de glucosa en sangre venosa periférica, tras la manipulación con thrust del segmento vertebral T8T9 en sujetos sanos
(Effects of T8 and T9 vertebras HVT manipulations on glycemic 8 levels in peripheral venous blood in healthy people)
Durá Soler, A. M., Boscá Gandía, J. J.
Osteopatía Científica, 2008/04
4014

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4015

Embrace evidence...with both eyes open
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/04
Free full text
4016

Características de los movimientos intervertebrales y los cambios de presión intradiscal durante la manipulación de la columna lumbar: estudio de viabilidad
(Highlighting of intervertebral movements and variations of intradiskal pressure during lumbar spine manipulation: a feasibility study)
Maigne, J.Y., Guillon, F.
Osteopatía Científica, 2008/04
4017

Dolor del miembro superior, disfunción somática y deslizamiento neural
(Arm pain, somatic dysfunction and nerve movement)
Oliva Pascual-Vaca, Á.
Osteopatía Científica, 2008/04
4018

Relación entre las referencias de diagnóstico radiológico de las disfunciones osteopáticas de la cabeza humeral en el plano frontal
(Relation between diagnostic radiologic landmarks of somatic dysfunction of the humeral head in the frontal plane)
Oliva Pascual-Vaca, Á., Rodríguez Blanco, C., Solana Díaz, M. T., Rosety Rodríguez, M., Ordóñez Muñoz, F. J.
Osteopatía Científica, 2008/04
4019

Un caso de pelviespondilitis atípica
(A case of atypical pelvispondylitis)
Ricard, F.
Osteopatía Científica, 2008/04
4020

Técnica semidirecta de thrust para torsión anterior derecha del sacro: TDD
(Indirect thrust manipulation for right anterior torsion of the sacrum on a right oblique axis)
Rodríguez Blanco, C.
Osteopatía Científica, 2008/04
4021

OSTEOPAThic Health outcomes in chronic low back pain: The OSTEOPATHIC Trial
Licciardone, J. C., King, H. H., Hensel, K. L., Williams, D. G.
Osteopathic Medicine and Primary Care, 2008/04
4022

Osteopathic manipulation & its use for low back pain
Wolf, C. J.
Missouri Medicine, 2008/03-04
4023

Estimation of instantaneous and cumulative loads on the low back and neck of osteopaths while performing the pre-thrust positioning for a high velocity, low amplitude thrust technique applied to the thoracic spine
Stewart, M. D.
Unpublished MSc thesis, 2008/03
Free full text
4024

Migraine and OMT
Batchelor, K., Gamber, R.
The AAO Journal, 2008/03
Free full text
4025

Osteopathic Manipulative Treatment in Pregnancy and Augmentation of Labor: A Case Report
Jones, A. L., Lockwood, M. D.
The AAO Journal, 2008/03
Free full text
4026

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text
4027

Towards an osteopathic understanding of evidence
Leach, J. M. C.
International Journal of Osteopathic Medicine, 2008/03
Free full text
4028

Reliability of physical examination to assess asymmetry of anatomical landmarks indicative of pelvic somatic dysfunction in subjects with and without low back pain
Kmita, A., Lucas, N. P.
International Journal of Osteopathic Medicine, 2008/03
4029

A short questionnaire to identify patient characteristics indicating improved compliance to exercise rehabilitation programs: A pilot investigation
Howard, D. B., Gosling, C. M. R.
International Journal of Osteopathic Medicine, 2008/03
4030

“Even though you’re choking on it, it’s all in your mind” – an osteopathic perspective on Globus Hystericus
Comeaux, Z. J.
The AAO Journal, 2008/03
Free full text
4031

Osteopathy: In Good Hands (and I don’t mean Allstate®): 2007 Northup Lecture
King, H. H.
The AAO Journal, 2008/03
Free full text
4032

Osteopathic manipulative treatment (OMT) effects on mandibular kinetics: kinesiographic study
Monaco, A., Cozzolino, V., Cattaneo, R., Cutilli, T., Spadaro, A.
European Journal of Paediatric Dentistry, 2008/03
Free full text
4033

10 Years of research in the journal: What's next?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2008/03
Free full text
4034

Clinical inquiries. Is osteopathic manipulation effective for headaches?
Keays, A. C., Neher, J. O., Safranek, S., Webb, C. W.
The Journal of Family Practice, 2008/03
4035

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4036

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4037

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03
4038

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4039

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text
4040

A prospective study of patients with chronic back pain randomised to group exercise, physiotherapy or osteopathy
Chown, M., Whittamore, L., Rush, M., Allan, S., Stott, D., Archer, M.
Physiotherapy, 2008/03
Free full text
4041

Does osteopathic treatment influence the hormone level of hyperandrogenaemic infertile women?
Heim, S.
Unpublished MSc thesis, 2008/02
Free full text
4042

The impact of osteopathic treatment on intraocular hypertension – an experimental study
Kuhmann, O.
Unpublished MSc thesis, 2008/02
Free full text
4043

The Use of Visceral Techniques in the Osteopathic Practices in Austria
Stemeseder, H.
Unpublished MSc thesis, 2008/02
Free full text
4044

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4045

Touch – Perception – Communication In the Context of Osteopathic Treatment
Schuster, K.
Unpublished MSc thesis, 2008/02
Free full text
4046

Health economic evaluation - An option for osteopathy?
Perndl, M.
Unpublished MSc thesis, 2008/02
Free full text
4047

Effect of osteopathic treatment on premature infants with regulation problems
Rajchl, E.
Unpublished MSc thesis, 2008/02
Free full text
4048

Communication Concept for the Austrian Osteopathic Association and the Individual Osteopath
Rüscher, M.
Unpublished MSc thesis, 2008/02
Free full text
4049

The Phenomenon Spondylolisthesis from an Osteopathic Point of View
Schiener, M.
Unpublished MSc thesis, 2008/02
Free full text
4050

Osteopathie in der Pädiatrie, Teil 2: Intraossäre Läsionen des Os occipitale
(Osteopathy in Pediatrics, Part 2: Intraosseus Lesions of the Occipital Bone)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4051

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text
4052

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text
4053

Visceral Motility. Which osteopathic approaches are there, and how are they implemented?
Behrens, A.
Unpublished MSc thesis, 2008/02
Free full text
4054

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4055

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4056

Für Durchblutung sorgen - Die Behandlung von Arterien
(Providing blood circulation - The treatment of arteries)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4057

Ignorance in high places
Ha, L.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4058

Behandlung der intramuralen Gefäße der Viszera am Beispiel des Magens
(Treatment of the Intramural Vessels of the Viscera Using the Stomach as an Example)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4059

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02
4060

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4061

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4062

Debt control for young DOs
Wagner, E.
The Journal of the American Osteopathic Association, 2008/02
Free full text
4063

Doctors’ knowledge of osteopathy in the district of Bregenz
Seewald, S.
Unpublished MSc thesis, 2008/02
Free full text
4064

Efficacy of the ‘Still technique’ on dorsiflexion at the talocrural joint in patients with a history of ankle injury
Taylor, N.
Unpublished MSc thesis, 2008/01
Free full text
4065

The role of osteopaths in the recognition of melanoma: attitudes, knowledge and practices in melanoma screening within the osteopathic community
Friedlander, T.
Unpublished MSc thesis, 2008/01
Free full text
4066

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01
4067

Osteopathic manipulative medicine and the athlete
Gunnar Brolinson, P., McGinley, S. M., Kerger, S.
Current Sports Medicine Reports, 2008/01
4068

Female osteopathic medical students: When the minority become the majority
Johnson, K. D.
Unpublished PhD thesis, 2008/01
4069

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text
4070

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text
4071

„Attentionality”: Osteosophische Basisschritte zur sensorischen Körper-Spiritualität in der osteopathischen Medizin
('Attentionality': Basic osteosophic steps towards a sensory spirituality of the body in osteopathic medicine)
Beuckels, J. M.
Osteopathische Medizin, 2008/01
4072

Osteopathie und Musikermedizin
(Osteopathy in musician's medicine)
Ridder, P.H.
Osteopathische Medizin, 2008/01
4073

Identification, assessment and management of mood disorders in clients by osteopathic practitioners in New Zealand
Sampath, K.
Unpublished MSc thesis, 2008/01
Free full text
4074

Quantifying Structural Changes with the Application of Osteopathic Manual Medicine (OMM) in Tegucigalpa, Honduras
Hardee, A. B.
Unpublished PhD thesis, 2008/01
Free full text
4075

Current legal framework governing manual-therapeutic osteopathic work by physiotherapists in Austria. An analysis from the perspective of self-employed physical therapists
Panovits, V.
Unpublished MSc thesis, 2007/12
Free full text
4076

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text
4077

Who are our guests?
Sumesgutner, A.
Unpublished MSc thesis, 2007/12
Free full text
4078

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text
4079

Understanding and Treating Fatigue and Gait Instability in Persons with Multiple Sclerosis: An Osteopathic Approach
Hatter, A., Williams, S.
The AAO Journal, 2007/12
Free full text
4080

Attitudes and Confidence Levels of Second-Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T. A., Fotopoulos, T. J., Best, M. A.
The AAO Journal, 2007/12
Free full text
4081

Osteopathic Manipulative Medicine and Acupuncture Combined: A Retrospective case study to determine if order of treatment makes a difference in outcome for acute mechanical low back pain
Stager, W. H.
The AAO Journal, 2007/12
Free full text
4082

Gibt es bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung somatische Dysfunktionen
(Do somatic dysfunctions occur in patients with renal or primary hypertension accompanied by kidney damage)
Gögel, F.
Unpublished MSc thesis, 2007/12
Free full text
4083

Self-reported health behaviors of osteopathic physicians
McNerney, J. P., Andes, S., Blackwell, D. L.
The Journal of the American Osteopathic Association, 2007/12
Free full text
4084

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12
4085

Is there a place for science in the definition of osteopathy?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/12
4086

Using the concept of ideomotor therapy in the treatment of a patient with chronic neck pain: A single system research design
McCarthy, S., Rickards, L. D., Lucas, N. P.
International Journal of Osteopathic Medicine, 2007/12
4087

Analysis of exercise content in undergraduate osteopathic education – A content analysis of UK curricula
Zamani, J., Vogel, S., Moore, A., Lucas, K.
International Journal of Osteopathic Medicine, 2007/12
4088

How and in what context do osteopathic medical students learn about interprofessional practice
Head French, J.
Unpublished Dissertation, 2007/12
Free full text
4089

Empathy as part of the perception process in osteopathy
Felder, R.
Unpublished MSc thesis, 2007/12
Free full text
4090

Relaxed Vision: A Clinical Study
Fitzinger, S.
Unpublished MSc thesis, 2007/12
Free full text
4091

Relationships between clinical rotation subscores, COMLEX-USA examination results, and school-based performance measures
Cope, M. K., Baker, H. H., Foster, R. W., Boisvert, C. S.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4092

Applying osteopathic principles to formulate treatment for patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4093

Evolution of osteopathic graduate medical education: integration of osteopathic principles and practice in postdoctoral training
Lemley, W. W., Steele, K. M., Shires, W. E., McMahan, R. M.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4094

Andrew Taylor Still (1828-1917): founder of osteopathic medicine
Tan, S. Y., Zia, J. K.
Singapore Medical Journal, 2007/11
4095

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text
4096

Schmerzsyndrome in der Regio Inguinalis
(Pain syndroms of the inguinal region)
Beck, M.
Osteopathische Medizin, 2007/10
4097

Kann mit osteopathischen Behandlungen eine Einflussnahme auf das Beschwerdebild bei Patienten mit Hyperakusis erreicht werden?
(Can osteopathic treatment influence the symptoms of patients with hyperacusis?)
Burkhardt, D., Schuff, I., Mahler, R.
Unpublished D.O. thesis, 2007/10
4098

Das Craniomandibuläre System und seine Effekte auf die Körperhaltung - Teil 3
(The craniomandibular system and its effects on the posture - Part III: Etiology, diagnosis and treatment of disorders of the CMS)
Honikel, M.
Osteopathische Medizin, 2007/10
4099

Manuelle Medizin wirkt auf schmerzhemmende Systeme!
(Manual medicine acts on pain inhibitory systems)
Locher, H., Sell, K.
Osteopathische Medizin, 2007/10
4100

Osteopathische Behandlung von Frauen mit Harninkontinenz nach Verletzung des Perineums unter der Entbindung. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women suffering from urinary incontinence as a result of an injury to the perineum during delivery. A randomized controlled trial)
Gerhardt, K., Montag, G.
Unpublished D.O. thesis, 2007/10
4101

The influence of an Osteopathic treatment on the performance of a high - performance athlete
Böhmüller, E.
Unpublished MSc thesis, 2007/10
Free full text
4102

Ist eine funktionelle Verbindung zwischen Diaphragma und Cranium palpierbar? Versuch der Deutung mittels des Tensegrity-Modells
(Is a functional connection between diaphragm and cranium palpatable? Attempt to interpret by means of the Tensegrity Model)
Koschella, S.
Unpublished D.O. thesis, 2007/10
4103

Survey, Systematisation and Comparison of Professional, Advanced and Continuing Training Programs for Osteopathy available in Austria in the Winter Term 2006/2007
Wilfling, E.
Unpublished MSc thesis, 2007/10
Free full text
4104

Frühkindliche Hinweise auf Lernstörungen und osteopathische Behandlungsansätze
(Signs of Learning Disorders in Early Childhood and Osteopathic Treatment Approaches)
Bierent-Vass, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4105

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4106

Behandlung eines Kindes mit Morbus Hirschsprung
(Treatment of a child with Hirschsprung's disease)
Helsmoortel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4107

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4108

Osteopathische Behandlung von Frauen mit primärer Dysmenorrhoe. Eine randomisierte kontrollierte Studie
(Osteopathic treatment of women with primary dysmenorrhoea. A randomized controlled trial)
Pinter-Haas, A., Schach-Hirte, J., Wirthwein, P.
Unpublished D.O. thesis, 2007/10
4109

Hat die osteopathische Behandlung einen positiven Effekt bei Frauen mit persistierenden Rückenschmerzen post partum? Eine randomisierte kontrollierte Studie
(Study on the effectiveness of osteopathic treatment for women with persistent post partum back pain. A randomized controlled trial)
Recknagel, C., Roß, J.
Unpublished D.O. thesis, 2007/10
4110

Spina bifida
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4111

Osteopathische Begleitung bei frühkindlichen Fehlbildungen
(Osteopathic treatment for infantile malformations)
Mückler, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10
4112

Nonprofit and for-profit COMs: investing in the future of osteopathic medicine
Ajluni, P. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4113

Lake Erie College of Osteopathic Medicine's preclinical problem-based learning pathway program: an alternative medical school curriculum design
Ferretti, S. M., Krueger, W. A., Gabel, L. L., Curry, J. J.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4114

Stellt die osteopathische Behandlung von Patienten mit chronischer Zervikalgie eine wirksame Alternative zur Physiotherapie dar? Eine randomisierte kontrollierte Studie
(Osteopathy as an efficient treatment alternative to physical therapy for patients suffering from chronic non specific neck pain? A randomized controlled trial)
Steffen, S., Tempel, R.
Unpublished D.O. thesis, 2007/10
4115

Systematische Analyse der anatomischen Verbindungen der cranialen Gefäßabgänge des Aortenbogens mit Strukturen der oberen Thorax-apertur sowie der experimentellen Überprüfung ihrer mechanischen Abhängigkeit
(Systematically research of the anatomic links of the supraaortic arteries with thoracic outlet structures and an experimental testing of their mechanical dependence)
Vogt, R.
Unpublished D.O. thesis, 2007/10
4116

Effektivität der osteopathischen Behandlung bei Patienten mit Patellofemoralen Schmerzsyndrom. Eine randomisierte kontrollierte Studie
(Effectiveness of osteopathic treatment in patients with patellofemoral pain syndrome. A randomized controlled trial)
Wendel, J., Rudisch, B., Berger, G.
Unpublished D.O. thesis, 2007/10
4117

RVUCOM: striving to meet the needs of the osteopathic medical profession
Martin, R. B.
The Journal of the American Osteopathic Association, 2007/10
Free full text
4118

Surgical workforce since the 1975 study of surgical services in the United States: an update
Sheldon, G. F.
Annals of Surgery, 2007/10
4119

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text
4120

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text
4121

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text
4122

The Establishment of a Neuromusculoskeletal-Osteopathic Manipulative Medicine Service in a 700 Allopathic Physician Practice
Richards, T. M.
The AAO Journal, 2007/09
Free full text
4123

A three-year accelerated medical school curriculum designed to encourage and facilitate primary care careers
Bell, H. S., Ferretti, S. M., Ortoski, R. A.
Academic Medicine, 2007/09
4124

Role of osteopathic manipulative treatment in altering pain biomarkers: a pilot study
Degenhardt, B. F., Darmani, N. A., Johnson, J. C., Towns, L. C., Rhodes, D. C., Trinh, C., McClanahan, B., DiMarzo, V.
The Journal of the American Osteopathic Association, 2007/09
Free full text
4125

Treatment of irritable bowel syndrome with osteopathy: results of a randomized controlled pilot study
Hundscheid, H. W., Pepels, M. J., Engels, L. G., Loffeld, R. J.
Journal of Gastroenterology and Hepatology, 2007/09
Free full text
4126

Chiropractic through the eyes of physiotherapists, manual therapists, and osteopaths in the Netherlands
Langworthy, J. M., Smink, R. D.
The Journal of Alternative and Complementary Medicine, 2007/09
4127

The influence of the osteopathic treatment on the vegetative neural system.The technique “Compression of the 4th ventricle“ influences brain activity, bloodpressure, heart rate and respiration rate
Brandstötter, L., Winkler, W.
Unpublished MSc thesis, 2007/09
Free full text
4128

Zusammenhanh zwischen Kraniosakralen Techniken und Emotionaler Befindlichkeit
(Relationship between craniosacral techniques and emotional states)
Bolt, J.
Osteopathische Medizin, 2007/08
4129

Die Rolle des Ösophagus bei der Entstehung einer Plagiocephalie beim Säugling
(Role of the esophagus in the development of plagiocephaly in infants)
Kaiser, F.
Osteopathische Medizin, 2007/08
4130

Treating the cause
Stimson, N.
British Dental Journal, 2007/08
4131

Emotionale Diagnose und Behandlung nach J.P. Barral
(Diagnosis and Treatment of Emotional Problems according to Barral)
Klein Lossing, M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4132

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4133

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4134

Orthopädie und Psyche nach Verkehrsunfall
(Orthopedics and psyche after traffic accident)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4135

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4136

Im Gespräch mit...-Jean-Pierre Barral
(In dialog with Jean-Pierre Barral)
Seider, R., Barral, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07
4137

Hope for larger study on otitis media
Galgano, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4138

Getting “beyond the barriers“ in reforming osteopathic medical education
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4139

Reported prevalence rates of somatic dysfunction raise an... Heel?
Kotoske, D. E.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4140

Emphasizing research in osteopathic medical education
Martin, K. D.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4141

COM Accreditation: the Flexner Report revisited
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4142

Study on recurrent otitis media: potential value vs actual value of OMT
Orenstein, R.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4143

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07
4144

Trichotillomania: a rare but serious disorder
Rodos, J. J.
The Journal of the American Osteopathic Association, 2007/07
Free full text
4145

Osteopathic manipulative treatment for pandemic influenza: many questions, few answers
Sanderlin, B. W., Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2007/07
Free full text
4146

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text
4147

Ehlers Danlos Syndrome: A Case Report
Kumar, A., Stoll, S. T., Hensel, K.
The AAO Journal, 2007/06
Free full text
4148

Alleviating Atypical Tender Points Through the Use of Myofascial Release of Scar Tissue
Thomas, B. P.
The AAO Journal, 2007/06
Free full text
4149

Is estimating USMLE performance useful?
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2007/06
Free full text
4150

An observational study of motion induced in the lumbar–pelvic complex during ‘harmonic’ technique: A preliminary investigation
Waugh, J. L., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/06
4151

Should your GP be an osteopath? Patients' views of an osteopathy clinic based in primary care
Westmoreland, J. L., Williams, N. H., Wilkinson, C., Wood, F., Westmoreland, A.
Complementary Therapies in Medicine, 2007/06
Free full text
4152

Reply to “The flawed cranial model”
Hartman, S. E.
International Journal of Osteopathic Medicine, 2007/06
4153

Researching osteopathy: Who is responsible?
Lucas, N. P., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/06
4154

The flawed cranial model
Maddick, A. F.
International Journal of Osteopathic Medicine, 2007/06
4155

Manuscript preparation and publication for would-be writers: An aid to disseminating osteopathic research
Mullinger, B.
International Journal of Osteopathic Medicine, 2007/06
4156

Optimising the psychological benefits of osteopathy
Williams, N. H.
International Journal of Osteopathic Medicine, 2007/06
4157

The effects of high-velocity, low-amplitude manipulation and muscle energy technique on suboccipital tenderness
Hamilton, L., Boswell, C., Fryer, G.
International Journal of Osteopathic Medicine, 2007/06
4158

Eine Einführung in die Harmonischen Techniken
(An introduction to Harmonic Technique)
Lederman, E.
Osteopathische Medizin, 2007/05
4159

Harmonische Techniken - Ausgewählte Beispiele
(Harmonic technique - Selected examples of Eyal Lederman)
Lederman, E.
Osteopathische Medizin, 2007/05
4160

Symposium der traditionellen Osteopathie
(Symposium of traditional osteopathy)
Prediger, G.
Osteopathische Medizin, 2007/05
4161

Step forward to stop bird flu
Austin, D. L.
The Journal of the American Osteopathic Association, 2007/05
Free full text
4162

Repatriating DOs with MD-affiliated residencies
Forte, T. E.
The Journal of the American Osteopathic Association, 2007/05
Free full text
4163

Promoting an osteopathic medical research culture
Lee, R. P.
The Journal of the American Osteopathic Association, 2007/05
Free full text
4164

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05
4165

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text
4166

Irresistible indexes for somatic dysfunction
Sucher, B. M.
The Journal of the American Osteopathic Association, 2007/05
Free full text
4167

Osteopathic focus in the biomedical sciences: A survey of biomedical science faculty at osteopathic medical schools in the United States
Ebert, D. E.
Unpublished MSc thesis, 2007/05
4168

Integration of osteopathic manipulative medicine into differential diagnosis training: A study evaluating teaching strategies and their influence on student learning
Irvine-Moore, L. R.
Unpublished MSc thesis, 2007/05
4169

Latino success stories in higher education: A qualitative study of recent graduates from a health science center
Colley, K. L.
Unpublished PhD thesis, 2007/05
Free full text
4170

Die Stille nutzen - Auszug aus der Korrespondenz zwischen Rollin Becker und Anne Wales aus den frühen Siebziger Jahren
(Using the Stillness - Excerpt from the Correspondence between Rollin Becker and Anne Wales from the Early Seventies)
Becker, R. E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
Free full text
4171

Epicondylitis humeri radialis
(Lateral epicondylitis)
Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
4172

Das 11. Europäische Symposium der traditionellen Osteopathie
(The 11th European Symposium of Traditional Osteopathy)
Prediger, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
4173

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
4174

Der verletzte Ellbogen - Überlegungen aus orthopädischer und osteopathischer Sicht
(Elbow Trauma - Considerations from an orthopedic and osteopathic point of view)
Schleusener, R., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
4175

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04
4176

Treatment of Primary Raynaud`s Syndrome with Osteopathy
Kalcakosz-Takacs, T.
Unpublished MSc thesis, 2007/03
Free full text
4177

Infantile postural asymmetry and osteopathic treatment: A randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2007/03
Free full text
4178

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
4179

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text
4180

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text
4181

The Immediate Influence of Osteopathic Treatment on the Parametres of Bodyplethysmography in Patients Suffering From Cystic Fibrosis
Neuhaus, S.
Unpublished MSc thesis, 2007/03
Free full text
4182

Local Listening - a General Diagnostic Tool? An Experimental Examination of its Reliability
Podlesnic, W.
Unpublished MSc thesis, 2007/03
Free full text
4183

Klinische Osteopathie Bestandsaufnahme und Stellenwert der klinischen Arbeit in der Osteopathie
(Clinical Osteopathy)
Mayer-Fally, E.
Unpublished MSc thesis, 2007/03
Free full text
4184

The effects of the craniosacral work on the notochord on the right-left strain and the forefeet-heel strain in an upright position
Neubauer, C.
Unpublished MSc thesis, 2007/03
Free full text
4185

Cervicobrachialgia. Efficiency and Effectiveness of Osteopathic Treatment in Comparison with Conventional Ultrasound Therapy
Rumer, H.
Unpublished MSc thesis, 2007/03
Free full text
4186

A Case Study on the Osteopathic Approach to Chronic Low Back Pain and Radiculopathy
Schmied, A.
Unpublished MSc thesis, 2007/03
Free full text
4187

The Influence of Osteopathic Treatment on Postpuncture Complaints
Stephanides, A.
Unpublished MSc thesis, 2007/03
Free full text
4188

Matched-Controlled Pilot-Study: Influence of Osteopathic Treatment (Diagnostic Touch Technique) on Fatigue in a Working Population
Tremel, A.
Unpublished MSc thesis, 2007/03
Free full text
4189

Wie kommen sie eigentlich zu uns? Eine quantitative Sozialstudie über die Wege, wie Patienten zu osteopathischen Behandlungen kommen
How do they end up coming to us? A quantitative social study of the journeys people take to get to osteopathy treatment
Wagner-Scheidel, B.
Unpublished MSc thesis, 2007/03
Free full text
4190

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text
4191

Teaching Osteopathic Principles in an Allopathic Environment: Osteopathic Guerrilla Warfare: 2006 Northup Lecture
Cantieri, M. S.
The AAO Journal, 2007/03
Free full text
4192

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text
4193

Management of Peptic Ulcer Disease Using Osteopathic Manipulation
Morris, H. D., Dickey, J. L.
The AAO Journal, 2007/03
Free full text
4194

The effect of cranial-sacral membrane and fluid balance technique on the autonomic nervous system using pulse rate, breathing frequency and blood pressure as indicators
Schneider, R.
Unpublished MSc thesis, 2007/03
Free full text
4195

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text
4196

Is it possible to intensify the effect of an osteopathic treatment through automobilisation (in a structural and visceral way), regarding success of treatment and long-term result instancing chronic low back pain patients?
Bilgeri, E.
Unpublished MSc thesis, 2007/03
Free full text
4197

What is the significance of Dr. A.T. Still’s principles and philosophy in the work of Austrian osteopaths today?
Holzheu, N.
Unpublished MSc thesis, 2007/03
Free full text
4198

Osteopathy is not only a job, it is a vocation!
Forthuber, K.
Unpublished MSc thesis, 2007/03
Free full text
4199

The Influence of Osteopathic Treatment on the Performance of Hobby Runners. A Comparative Study using Osteopathic Treatment to Enhance the Performance of Hobby Runners
Haberl, F.J.
Unpublished MSc thesis, 2007/03
Free full text
4200

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text
4201

The Influence of Osteopathy on ADHD
Hubmann, B.
Unpublished MSc thesis, 2007/03
Free full text
4202

Influencing Lung Function by Osteopathy in Idiopathic Parkinson's Syndrome
Rupp, G.
Unpublished MSc thesis, 2007/03
4203

Osteopathic medical education in 2007: plumbing the depths with the questions we ask
Shannon, S. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text
4204

Osteopathic treatment versus “relaxation“ for tension-type headache
Smitherman, T. A., Nicholson, R. A., Penzien, D. B.
Headache: The Journal of Head and Face Pain, 2007/03
4205

Practice patterns among osteopathic dermatologists in the United States
Yoo, J. Y., Lee, H., Kimball, A. B.
Journal of the American Academy of Dermatology, 2007/03
4206

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text
4207

Craniosacral Osteopathy: “Personal Perspectives of Osteopaths with several years of professional experience”
Wojna, S.
Unpublished MSc thesis, 2007/03
Free full text
4208

Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03
4209

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03
4210

Beyond spinal manipulation
McClune, T.
International Journal of Osteopathic Medicine, 2007/03
4211

Physiological effects of a CV4 cranial osteopathic technique on autonomic nervous system function: A preliminary investigation
Milnes, K., Moran, R. W.
International Journal of Osteopathic Medicine, 2007/03
4212

Reply to Comments on “Spinal manipulation in patients with disc herniation: A critical review of risk and benefit”
Snelling, N. J.
International Journal of Osteopathic Medicine, 2007/03
4213

The Impact of Osteopathic Treatment on Increased Intraocular Pressure in Primary Chronic Open-Angle Glaucoma
Bilgeri, S.
Unpublished MSc thesis, 2007/03
Free full text
4214

Osteopathic Treatment and Stress Incontinence, in Combination with Biofeedback
Brix, S.
Unpublished MSc thesis, 2007/03
Free full text
4215

Knowing the body and embodying knowledge: an ethnography of student practitioner experiences in osteopathy and homeopathy
Gale, N. K.
Unpublished PhD thesis, 2007/03
Free full text
4216

(The 3rd International Symposium on the progress in osteopathic research, October 7, 2006 in Schlangenbad)
Franke, H.
Osteopathische Medizin, 2007/02
Free full text
4217

Mechanical Link. Ein osteopathisches Diagnose- und Behandlungskonzept
(The mechanical link: An osteopathic diagnosis and treatment concept)
Somody-Neplaz, I., Chauffour, P., Prat, E.
Osteopathische Medizin, 2007/02
4218

Osteopathie in Kenia: Ein Projekt von Care Highway International
(Osteopathy in Kenya: A project of Care Highway International)
Soriano, L. C.
Osteopathische Medizin, 2007/02
4219

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2007/02
Free full text
4220

The Decrease Of High Blood Pressure Using a Lateral Fluid Drive Techique With Concentration On the Ossa Temporalia
Krasser, W.
Unpublished MSc thesis, 2007/01
Free full text
4221

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text
4222

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text
4223

A Questionnaire to evaluate the Professional Field of Osteopathy in Austria
Krönke, K.
Unpublished MSc thesis, 2007/01
Free full text
4224

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text
4225

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text
4226

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text
4227

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text
4228

Osteopathy. Sensing and Philosophy
Weber, K.H.
Unpublished MSc thesis, 2007/01
Free full text
4229

Das Mediastinum und Intrathorakales Fasziales Release
(The mediastinum and intrathoracal fascial release)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
4230

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
4231

Mediastinum
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
4232

Das Mediastinum - der Raum zwischen den Lungenflügeln
(The mediastinum - the space between the lungs)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
4233

Das Herz: Allgemeine osteopathische Überlegungen und spezielle Ansätze in der Kinderosteopathie
(The Heart: General osteopathic reflections and special applications in pediatric osteopathy)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01
4234

The significance of osteopathic interventions in the treatment of congenital hip dysplasia (Type IIa/IIb)
Ellmerer, H.
Unpublished MSc thesis, 2007/01
Free full text
4235

Manual therapy for temporomandibular disorders: A review of the literature
Kalamir, A., Pollard, H., Vitiello, A. L., Bonello, R.
Journal of Bodywork and Movement Therapies, 2007/01
4236

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text
4237

Osteopathic degrees overseas
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2007/01
Free full text
4238

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text
4239

The influence of osteopathic treatment during gestation onto the course of delivery - a comparative study on the frequency of medical intervation during child birth
Ruspeckhofer, M.
Unpublished MSc thesis, 2007/01
Free full text
4240

Teaching “doctoring“: a model curriculum for family medicine
Wilson, M. A., Blondefield, P. J.
The Journal of the American Osteopathic Association, 2007/01
Free full text
4241

A woman with the problem of Infertility receiving osteopathic treatment has an increased chance of becoming pregnant
Kirchmayr, M.
Unpublished MSc thesis, 2007/01
Free full text
4242

Do 3-months-old babies who have been examined osteopathically immediately after birth and / or have been treated osteopathically as a result show different patterns of behaviour considering sleep, crying fits and digestion than 3-months-old babies having had no such treatment
Urbanek, B.
Unpublished MSc thesis, 2007/01
Free full text
4243

Changing the practice of osteopaths, chiropractors and musculoskeletal physiotherapists in relation to the management of low back pain
Evans, D. W.
Unpublished PhD thesis, 2007/01
4244

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text
4245

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text
4246

OMT for Post-mastectomy Lymphedema and Rib Pain: Case Report
Bradshaw, D., Snider, K.
The AAO Journal, 2006/12
Free full text
4247

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text
4248

Do any treatments work for irritable bowel syndrome?
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/12
4249

The effectiveness of non-invasive treatments for active myofascial trigger point pain: A systematic review of the literature
Rickards, L. D.
International Journal of Osteopathic Medicine, 2006/12
4250

Pelvic Pain Due to Placement of the Vaginal Cuff after Hysterectomy: Case Report and Osteopathic Manipulative Approach to Treatment
Pasquarello, G. J.
The AAO Journal, 2006/12
Free full text
4251

Erratum to “Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation” [International Journal of Osteopathic Medicine 2006;9(1):46]
McFarlane, S., Standen, C., Roy, D., McPartland, J. M.
International Journal of Osteopathic Medicine, 2006/12
4252

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text
4253

Cranial osteopathy and licensing exams: Rejoinder to Maddick and Korth
Hartman, S. E.
International Journal of Osteopathic Medicine, 2006/12
4254

Non-Operative Management of Spinal Stenosis
Greenman, P. E.
The AAO Journal, 2006/12
Free full text
4255

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text
4256

Craniosacral Therapy: The Effects of Cranial Manipulation on Intracranial Pressure and Cranial Bone Movement
Downey, P. A., Barbano, T., Kapur-Wadhwa, R., Sciote, J. J., Siegel, M. I., Mooney, M. P.
Journal of Orthopaedic & Sports Physical Therapy, 2006/11
Free full text
4257

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11
4258

Interests in research electives among osteopathic medical students
Pheley, A. M., Lois, H., Strobl, J.
The Journal of the American Osteopathic Association, 2006/11
Free full text
4259

Teaching critical appraisal: a pilot randomized controlled outcomes trial in undergraduate osteopathic medical education
Krueger, P. M.
The Journal of the American Osteopathic Association, 2006/11
Free full text
4260

Craniosacral therapy and professional responsibility
Flynn, T. W., Cleland, J. A., Schaible, P.
The Journal of Orthopaedic and Sports Physical Therapy, 2006/11
Free full text
4261

Studie zur Patientenzufriedenheit mit der osteopathischen Behandlung. Eine Fragebogenaktion der ÖGO
(A study on patient satisfaction with osteopathic treatment)
Weber, K.H., Woisetschläger, G.
Osteopathische Medizin, 2006/10
4262

Kieferorthopädie im Kindes- und Jugendalter. Zahnmedizinische und osteopathische Grundlagen. Basis eines interdisziplinären Dialoges.
(Orthodontics in infancy and adolescence. Dental and osteopathic fundamentals. Basis for an interdisciplinary dialogue)
von Tümpling, U.
Unpublished D.O. thesis, 2006/10
4263

Osteopathische Behandlung von Frauen mit Rückenschmerzen während der Schwangerschaft. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of women with low back pain during pregnancy. A randomized controlled trial)
van der Linde, M., Peters, R.
Unpublished D.O. thesis, 2006/10
4264

Nitric oxide and anandamide in OMT research
Stefano, G. B., Salamon, E. J.
The Journal of the American Osteopathic Association, 2006/10
Free full text
4265

Folgen des intrauterinen Gefängnis: Fußdeformitäten
(Consequences of intrauterine imprisonment: Deformities of the Foot)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
4266

Können osteopathische Behandlungen die Symptomatik des Kopfschmerzes bzw. des Kopfdrucks bei Patienten mit chronischer Rhinosinusitis (CRS) verbessern? Eine randomisierte kontrollierte Studie
(Do osteopathic treatments improve the symptoms of headache and/or sinus pressure in patients with Chronic Rhino sinusitis (CRS)? A randomized controlled trial)
Roos, S., Steinbauer, U., Amann, P.
Unpublished D.O. thesis, 2006/10
4267

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10
4268

Osteopathische Behandlung bei frühkindlichem Innenschielen. Eine randomisierte kontrollierte Studie.
(Osteopathic treatment of congenital and infantile esotropia)
Reimann, B., Schiedt, R.
Unpublished D.O. thesis, 2006/10
4269

Mechanisms of change: animal models in osteopathic medical research
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/10
Free full text
4270

Osteopathische Intervention bei Kindern mit sprachassoziierten Wahrnehmungsstörungen
(Can osteopathic treatment improve language associated perception disorders in infants?)
Nollmann, R., Sturhahn, F.
Unpublished D.O. thesis, 2006/10
4271

Osteopathische Behandlung bei gastroösophagealem Reflux. Eine Beobachtungsstudie
(The osteopathic treatment of gastroesophageal reflux disease (GERD) - a observational study)
Nerreter, A., Ruf, S., Höly, B.
Unpublished D.O. thesis, 2006/10
4272

Unspezifische, pseudoradikuläre Schmerzen nach lumbaler Bandscheibenoperation
(Nonspecific, pseudoradicular low back pain after lumbar nucleotomy)
Müller, P.
Unpublished D.O. thesis, 2006/10
4273

Fußschmerzen bei einem Kleinkind
(Foot pain in a young child)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10
4274

Das Kiefergelenk – zahnärztliche und osteopathische Methoden im interdisziplinären Austausch. Eine systematische Literaturarbeit und Leitfaden für die osteopathische Praxis
(The temporomandibular joint: Interdisciplinary exchange between dental and osteopathic methods. A systematic review and a guideline for the osteopathic practice)
Hippel, H.
Unpublished D.O. thesis, 2006/10
4275

The effectiveness of a holistic osteopathic treatment in subacute low back pain. A randomized controlled trial
Heinze, G.
Unpublished D.O. thesis, 2006/10
4276

Incidence of iatrogenesis associated with osteopathic manipulative treatment of pediatric patients
Hayes, N. M., Bezilla, T. A.
The Journal of the American Osteopathic Association, 2006/10
Free full text
4277

Bewusstheit für Bewegung - Die minimale Hebeltechnik und das Behandlungskonzept von Laurie Hartman
(Awareness for movement)
Franke, H.
Osteopathische Medizin, 2006/10
4278

Larsen’s Syndrome - A Case Report
Burkett, D., Gamber, R. G.
The AAO Journal, 2006/09
Free full text
4279

A comparison of selected osteopathic treatment and relaxation for tension-type headaches
Anderson, R. E., Seniscal, C.
Headache, 2006/09
4280

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text
4281

Spinal manipulation in patients with disc herniation: A critical review of risk and benefit
Snelling, N. J.
International Journal of Osteopathic Medicine, 2006/09
4282

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text
4283

Response to Hartman's “Should osteopathic licensing examinations test for knowledge of cranial osteopathy?”
Maddick, A. F., Korth, S. B.
International Journal of Osteopathic Medicine, 2006/09
4284

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09
4285

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
4286

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text
4287

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text
4288

Palpatory Evidence for Viscero-somatic Influence upon the Musculoskeletal System
Eland, D. C.
The AAO Journal, 2006/09
Free full text
4289

The Effects of Manipulation on Ligaments and Fascia from a Fluids Model Perspective
Crow, W. T.
The AAO Journal, 2006/09
Free full text
4290

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
4291

Merilyn Johnston Brooks über ihren Vater William L. Johnston: “Er engagierte bis zu seinem Tode für das Leben“
(Merilyn Johnston Brooks about her father William L. Johnston: “He committed himself to life until his death“)
Brooks, M. J.
Osteopathische Medizin, 2006/08
4292

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text
4293

AOA certifying boards are credible and capable
Reeves, R. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text
4294

Blinding protocols, treatment credibility, and expectancy: methodologic issues in clinical trials of osteopathic manipulative treatment
Licciardone, J. C., Russo, D. P.
The Journal of the American Osteopathic Association, 2006/08
Free full text
4295

Funktionelle Technik
(Functional technique)
Johnston, W. L.
Osteopathische Medizin, 2006/08
4296

Einleitung in die Biodynamik der kranialen Osteopathie: Ein Interview mit James Jealous, Auckland, Neuseeland
(Introduction into biodynamics of osteopathy in the cranial region: An interview with James Jealous, Auckland, New Zealand)
Jealous, J.
Osteopathische Medizin, 2006/08
4297

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08
4298

Funktionelle Technik in der Praxis
(Functional technique in practice)
Franke, H., Schmidt, S.
Osteopathische Medizin, 2006/08
4299

Changes in active mouth opening following a single treatment of latent myofascial trigger points in the masseter muscle involving post-isometric relaxation or strain/counterstrain
Blanco, C. R., de las Penas, C. F., Xumet, J. E., Algaba, C. P., Rabadan, M. F., de la Quintana, M. C.
Journal of Bodywork and Movement Therapies, 2006/07
4300

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4301

“Circle turns round“ to “allopathic osteopathy“
Wisnioski, S. W.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4302

Proof-of-concept learning: acrylic templates as empiric evidence
White, J. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4303

Nervus vestibulocochlearis (VIII.)
(Vestibulocochlear nerve)
Toth, A. B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
4304

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4305

Tracing the decline of OMT in patient care
Richardson, M. E.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4306

Behandlung eines temporomandibulären Problems bessert langfristig Tinnitus-Symptome
(Treatment of a temporomandibular problem improves tinnitus symptoms in the long term)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
4307

Akuter Tinnitus: Selbstheilungskräfte dominieren
(Acute tinnitus: self-healing powers dominate)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
4308

Osteopathische Therapie des chronischen Schwindels: Nutzen offen
(Osteopathic therapy of chronic vertigo: benefit unknown)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
4309

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4310

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07
4311

Cochrane Library's summary of review on manipulative treatment misleading, cheats readers
Michaud, R. G.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4312

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text
4313

The osteopathic approach in the treatment of asymmetric infant
Kollingbaum-Fabian, S.
Unpublished MSc thesis, 2006/07
Free full text
4314

Post Operative Osteopathic Manipulative Protocol for Delivery by Students in an Allopathic Environment
Clark, R. C., McCombs, T. M.
The AAO Journal, 2006/06
Free full text
4315

Suggestions and questions for osteopathic medical education
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4316

In a vacuum or in a s(l)ide show: OPP in osteopathic CME programming
Beaman, R. T.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4317

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4318

Sciatic Neuritis: A Research Study
Beal, M. C.
The AAO Journal, 2006/06
Free full text
4319

Craniosacral manipulation question
Benor, D. J.
Explore (NY), 2006/06
4320

Was ist der „kraniosakrale Rhythmus“?
(What is the craniosacral rhythm? An article on employing craniosacral osteopathy (CSO))
von Heymann, W., Kohrs, C.
Manuelle Medizin, 2006/06
4321

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4322

Crohn’s Disease: A Case Report including the most recent Theories and Treatment Principles
Mitchell, D., Dickey, J. L.
The AAO Journal, 2006/06
Free full text
4323

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text
4324

Manipulation of Adhesive Capsulitis under Anesthesia
Hurrell, J., Speece, A. J., Williams, S. F.
The AAO Journal, 2006/06
Free full text
4325

Front-line osteopathic medicine
Hayes, D. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4326

Osteopathic manipulative treatment of a 27-year-old man after anterior cruciate ligament reconstruction
Gugel, M. R., Johnston, W. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4327

Factors affecting the intra-examiner and inter-examiner reliability of palpation for supine medial malleoli asymmetry
Fryer, G.
International Journal of Osteopathic Medicine, 2006/06
4328

Osteopathic evaluation and manipulative treatment in reducing the morbidity of otitis media: a pilot study
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2006/06
Free full text
4329

Manipulative treatment for idiopathic impotence in a 24-year-old water polo player
Crow, W. T.
International Journal of Osteopathic Medicine, 2006/06
4330

Manual therapies
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/05
4331

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4332

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4333

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4334

Will the last DO turn off the lights?
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4335

Consider osteopathic manipulation in next positional plagiocephaly research
Mills, M. V.
The Journal of Pediatrics, 2006/05
Free full text
4336

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05
4337

Immediate effects of osteopathic manipulative treatment on immune function in a healthy population: A pilot study
John, J. T.
Unpublished MSc thesis, 2006/05
4338

Osteopathic manipulative treatment of a 26-year-old woman with Bell's palsy
Lancaster, D. G., Crow, W. T.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4339

Does osteopathic manipulative treatment improve dyspnea and exercise tolerance in subjects with stable chronic obstructive pulmonary disease?
Pickett, C.
Unpublished MSc thesis, 2006/05
4340

Osteopathic physicians and disaster relief
Kloss, B., Levy, M. J.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4341

The immediate effect of OMT on a COPD population: A pilot study
Som, M.
Unpublished MSc thesis, 2006/05
4342

A preliminary assessment of the impact of cranial osteopathy for the relief of infantile colic
Hayden, C., Mullinger, B.
Complementary Therapies in Clinical Practice, 2006/05
Free full text
4343

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4344

Osteopathic manipulative treatment is for all DOs
Cummings, C. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text
4345

Continuity of thought and tradition in the discipline supported by ongoing AOA efforts
Crosby, J. B.
The Journal of the American Osteopathic Association, 2006/04
Free full text
4346

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text
4347

Was die Osteopathie „Golden Girls” zu bieten hat
(What osteopathy has to offer „Golden Girls”)
Tettambel, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4348

Sind strukturelle Veränderungen behandelbar? - Pro und Contra
(Are structural changes treatable? - Pros and cons)
Seider, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4349

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4350

Whole person medicine: a definition articulated osteopathically
Rosen, M. E.
The Journal of the American Osteopathic Association, 2006/04
Free full text
4351

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4352

Polymyalgia rheumatica
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4353

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4354

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04
4355

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04
4356

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4357

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4358

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03
4359

An initial investigation into the possible influence of reactive oxygen species (ROS) in chronic nerve compression injuries and the effects of osteopathic manipulative therapy (OMT)
Andrews, M. A. W.
International Journal of Osteopathic Medicine, 2006/03
4360

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03
4361

Attitudes to back pain amongst musculoskeletal practitioners: differences and similarities between professional groups and practice settings using the Attitudes to Back Pain Scale—Musculoskeletal Practitioners (ABS-mp)
Vogel, S., Pincus, T., Foster, N. E., Breen, A. C., Underwood, M.
International Journal of Osteopathic Medicine, 2006/03
4362

Multidisciplinary approach to treatment in a 38-year-old female, restrained driver following injuries sustained in a rear-end collision
Rook, J. L., Auburn, A. M.
The AAO Journal, 2006/03
Free full text
4363

Faith without works
Patterson, M. M.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4364

Postmastectomy lymphedema: a call for osteopathic medical research
Ota, K. S.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4365

Manipulation in the presence of cervical spinal cord compression: a case series
Murphy, D. R., Hurwitz, E. L., Gregory, A. A.
Journal of Manipulative and Physiological Therapeutics, 2006/03
4366

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text
4367

Patient perception of practitioner intention in osteopathy in the cranial field – A preliminary investigation
McFarlane, S., Standen, C., Roy, D.
International Journal of Osteopathic Medicine, 2006/03
4368

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text
4369

Does osteopathic treatment have an influence on the symptoms of patients with chronic prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial
Marx, S.
International Journal of Osteopathic Medicine, 2006/03
4370

The correction of vertebral joint dysfunctions changes cerebrovascular and cerebrospinal fluid functional parameters improving some Primary Respiratory Mechanism parameters
Mandara, A., Moskalenko, Y., Musicco, M.
International Journal of Osteopathic Medicine, 2006/03
4371

The temporal effect of a high velocity thrust technique to the lumbar spine on cutaneous blood flow in the lower limb, comparing smokers and non-smokers
Howard, J.
International Journal of Osteopathic Medicine, 2006/03
4372

Beyond OMT: time for a new chapter in osteopathic medicine?
Hansen, G. P.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4373

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03
4374

Center or periphery? The future of osteopathic principles and practices
Gevitz, N.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4375

Solving clinical problems osteopathically
Feeko, K. J.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4376

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03
4377

What If? Thomas L. Northup Lecture, 2005
Dowling, D. J.
The AAO Journal, 2006/03
Free full text
4378

In vitro biophysical strain model for understanding mechanisms of osteopathic manipulative treatment
Dodd, J. G., Good, M. M., Nguyen, T. L., Grigg, A. I., Batia, L. M., Standley, P. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text
4379

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text
4380

A myofascial trigger point on the skull: Treatment improves peak flow values in acute asthma patients
Crow, W. T., Kasper, D.
The AAO Journal, 2006/03
Free full text
4381

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text
4382

Osteopathic medical education in 2006: charting a course for the future
Shannon, S. C.
The Journal of the American Osteopathic Association, 2006/02
Free full text
4383

Ein Interview mit Jane Carreiro, D.O.; Osteopathisch-Richtlinien für die WHO
(An interview with Jane Carreiro, D.O.; Osteopathic guidelines for the WHO)
Schmidt, S.
Osteopathische Medizin, 2006/02
4384

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text
4385

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02
4386

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text
4387

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text
4388

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text
4389

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text
4390

Das Berufsbild Osteopathie im Großraum Bodensee
(The osteopathic profession in the region of Lake Constance)
Feurstein, D.
Unpublished MSc thesis, 2006/02
Free full text
4391

Ethische Überlegungen zur Anwendung manipulativer Therapien in Altenpflegeheimen
(Ethical considerations for the use of manipulative therapy in nursing homes for the elderly)
Buckler, D., Strait, B.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
4392

The Treatment of the Subacromial Impingement Syndrome of the Shoulder by Ostheopathic Therapy or by Self-training: Results of a prospective randomised study
Anderl, E.
Unpublished MSc thesis, 2006/01
Free full text
4393

Computer animation and improved student comprehension of basic science concepts
Thatcher, J. D.
The Journal of the American Osteopathic Association, 2006/01
Free full text
4394

Hüft-Operation und Demenz
(Hip surgery and dementia)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
4395

Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial
Philippi, H., Faldum, A., Schleupen, A., Pabst, B., Jung, T., Bergmann, H., Bieber, I., Kaemmerer, C., Dijs, P., Reitter, B.
Developmental Medicine & Child Neurology, 2006/01
Free full text
4396

Osteopathie bei älteren Menschen und der derzeitige Stand der klinischen Forschung
(Osteopathy in the elderly and the current state of clinical research)
Noll, D. R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
4397

Plans for new conjoint certificate of added qualifications in hospice and palliative medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2006/01
4398

A phenomenological single case study of African American medical students in a predominantly White college of osteopathic medicine
Brown, T. A. Sr.
Unpublished PhD thesis, 2006/01
4399

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01
4400

Navigation in neurologic localization: web site launch
Hoegerl, C.
The Journal of the American Osteopathic Association, 2006/01
Free full text
4401

Treatment of urinary incontinence (stress-incontinence of urine) at a descensus of vagina and bladder
Gabriel, R.
Unpublished MSc thesis, 2006/01
Free full text
4402

Cranial State of Mind - Does cranial osteopathy influence the patient's state of consciousness?
Engel, R.
Unpublished MSc thesis, 2006/01
Free full text
4403

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12
4404

Osteopathic manipulative treatment of somatic dysfunction among patients in the family practice clinic setting: a retrospective analysis
Licciardone, J. C., Nelson, K. E., Glonek, T., Sleszynski, S. L., Cruser, des Anges
The Journal of the American Osteopathic Association, 2005/12
Free full text
4405

Osteopathie gestern und morgen - Medizin des 21. Jahrhunderts
(Osteopathy of the past and the present - medicine in the 21st century)
Gritsch, J.
Unpublished MSc thesis, 2005/12
4406

Use of osteopathic manipulative treatment for iliotibial band friction syndrome
Pedowitz, R. N.
The Journal of the American Osteopathic Association, 2005/12
Free full text
4407

Women in Osteopathy. A Synopsis of the Journals “DO” and “Osteopathic Medicine”
Schmid, A.
Unpublished MSc thesis, 2005/12
Free full text
4408

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12
4409

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text
4410

Osteopathic Care of Children: 2005 Scott Memorial Lecture
Steele, K. M.
The AAO Journal, 2005/12
Free full text
4411

Immediate changes in radiographically determined lateral flexion range of motion following a single cervical HVLA manipulation in patients presenting with mechanical neck pain: A case series
Fernández-de-las-Peñas, C., Downey, C., Miangolarra-Page, J. C.
International Journal of Osteopathic Medicine, 2005/12
4412

Should osteopathic licensing examinations test for knowledge of cranial osteopathy?
Hartman, S. E.
International Journal of Osteopathic Medicine, 2005/12
4413

To what should we attribute the effects of OMT?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/12
4414

The effect of training on the inter-examiner and intra-examiner reliability of the seated flexion test and assessment of pelvic anatomical landmarks with palpation
Fryer, G., McPherson, H. C., O'Keefe, P.
International Journal of Osteopathic Medicine, 2005/12
4415

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
4416

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text
4417

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text
4418

Osteopathic manipulative treatment out of a horse and buggy
Tessien, R. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text
4419

Allopathic family medicine residents can learn osteopathic manipulation techniques in a 1-month elective
Leiber, J. D.
Family Medicine, 2005/11
Free full text
4420

Haben osteopathische Behandlungen einen Effekt bei Patienten mit Gonarthrose im Vergleich zu physikalischer und medikamentöser Therapie? Eine randomisierte kontrollierte Studie
(How effective are osteopathic treatments to patients with gonarthritis in comparison to the two most current forms of treatment namely physiotherapy and medication. A randomized controlled trial)
Auracher, M.
Unpublished D.O. thesis, 2005/10
4421

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4422

(The Effectiveness of Muscle Energy Technique (MET). A systematic review)
Bergold-Meier, S., Franke, H.
Unpublished D.O. thesis, 2005/10
4423

Systematic review of effects of manual therapy in infants with kinetic imbalance due to suboccipital strain (KISS) syndrome
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Journal of Manual and Manipulative Therapy, 2005/10
4424

Cost-effective osteopathic manipulative medicine: a literature review of cost-effectiveness analyses for osteopathic manipulative treatment
Gamber, R., Holland, S., Russo, D. P., Cruser d, A., Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4425

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4426

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4427

Mobilität der Niere: Überprüfung eines osteopathischen Tests mittels Ultraschall
(Mobility of the Kidney: Evaluation of an osteopathic test with sonography)
Dillinger, W., Wülfing, M.
Unpublished D.O. thesis, 2005/10
4428

Das Menschenbild von A. T. Still:: „MAN IS TRIUNE“. Eine Untersuchung des Ursprungs von „MAN IS TRIUNE“
(A. T. Still´s Idea of Man: „MAN IS TRIUNE“. A Research of the Origin of „MAN IS TRIUNE“)
Dippon, M.
Unpublished D.O. thesis, 2005/10
4429

Osteopathische Behandlung bei Patienten mit sekundären Lymphödemen zusätzlich zur Standardtherapie. Eine Pilotstudie.
(Osteopathic treatment of patients with secondary Lymphedema in addition to standard therapy)
Dufner, B., Lacina, H.P., Lottermoser, B.
Unpublished D.O. thesis, 2005/10
4430

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4431

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung
(Osteopathic versus Orthopedic Interventions for Chronic Epicondylopathia humeri radialis: A randomized controlled trial)
Geldschläger, S.
Unpublished D.O. thesis, 2005/10
4432

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4433

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4434

Haben osteopathische Techniken der Nieren und deren Umgebung einen Einfluss auf den Blutdruck bei Patienten mit renaler Hypertonie oder essentieller Hypertonie mit begleitender Nierenschädigung? Eine Pilotstudie.
(Does osteopathic treatment of the kidneys and the surrounding tissue have an effect on blood pressure in patients with renal hypertension or essential hypertension with concomitant renal impairment? A pilot study)
Gögel, F., Mauder, C.
Unpublished D.O. thesis, 2005/10
4435

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4436

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text
4437

Effektivität der osteopathischen Behandlung von Patienten mit chronischer Achilles-Tendinopathie. Eine randomisierte kontrollierte Studie
(Can osteopathic treatments effectively influence symptoms of patients with chronic achillotendinitis? A randomized controlled trial)
Hölscher, M., Notarius, R.
Unpublished D.O. thesis, 2005/10
4438

Haben osteopathische Behandlungen einen Einfluss auf die Symptome bei Patienten mit chronischer abakterieller Prostatitis/chronischem Beckenschmerzsyndrom ? Eine randomisierte kontrollierte Studie
(Does an osteopathic treatment have an influence on the symptoms of patients with a chronic abacterial prostatitis/chronic pelvic pain syndrome (CPPS)? A randomized controlled trial)
Marx, S.
Unpublished D.O. thesis, 2005/10
4439

Wirksamkeit osteopathischer Behandlungen bei kongenitalem Torticollis im Säuglingsalter. Eine randomisierte kontrollierte Interventionsstudie
(Have osteopathic treatments a positive affect on the extent of the pathology of a congenital, muscular torticollis on infants? A randomized controlled trial)
Niggemeier, H., Wilke, H.
Unpublished D.O. thesis, 2005/10
4440

Die therapeutische Wirksamkeit osteopathischer Behandlungen bei Säuglingen und Kindern mit Atopic Dermatitis. Eine randomisierte, kontrollierte Studie.
(The therapeutic effectiveness of osteopathic treatments of babies and children with atopic dermatitis. A randomized controlled trial)
Özbay, I., Reckwerth, M.
Unpublished D.O. thesis, 2005/10
4441

Der Einfluss der osteopathischen Behandlung beim chronischen Vertigo – eine randomisierte kontrollierte Studie
(The Influence of Osteopathic Treatment at chronic Vertigo. A randomized controlled trial)
Recknagel, A., Koop, C.
Unpublished D.O. thesis, 2005/10
4442

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10
4443

Die osteopathische Medizin im Dilemma zwischen Tradition und Moderne
(Osteopathic medicine in the dilemma between tradition and modern approach)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
4444

Muskel Energie Techniken - Three visions - Ein Workshop
(Muscle energy techniques - Three visions - A workshop)
Beck, M., Unverricht, R.
Osteopathische Medizin, 2005/10
4445

Osteopathie bei somatoformen autonomen Funktionsstörung des Herz- und Kreislaufsystems. Eine kontrollierte klinische Studie.
(Osteopathic treatment of somatoform autonomic dysfunction of the cardiovascular system)
Sauerburger, S., Zorgman, M.
Unpublished D.O. thesis, 2005/10
4446

Prospektive Studie zu den Nebenwirkungen nach osteopathischer Behandlung an der European School of Osteopathy
(A prospective study on the side-effects following osteopathic treatment at the European School of Osteopathy)
Fossum, C., Mullinger, B., Rajendran, D.
Osteopathische Medizin, 2005/10
4447

Geschichte, Modell und Wirksamkeit der MuskelEnergieTechnik: Teil 3: Wirksamkeit der MET - Eine systematische übersichtsarbeit
(History, model and effectiveness of MuscleEnergyTechnique. Part 3: The effectiveness of MET - A systematic review)
Franke, H.
Osteopathische Medizin, 2005/10
4448

Akkomodationsfähigkeit der Augen und ihre Beeinflussung durch osteopathische Behandlung bei Presbyopie – eine randomisierte kontrollierte Studie
(Accommodative ability of the eyes and its impact by a series of osteopathic treatments in presbyopia. A randomized controlled trial)
Stelzer, F.
Unpublished D.O. thesis, 2005/10
4449

Osteopathische Behandlung von Patienten mit chronischem Asthma bronchiale – eine kontrollierte klinische Pilotstudie
(Osteopathic treatment of patients with chronic bronchial asthma. A controlled clinical pilotstudy)
Zielinski, J.
Unpublished D.O. thesis, 2005/10
4450

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4451

Der fasziale Test und die Behandlung der Articulatio coxae
(The fascial test and treatment of the articulatio coxae)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4452

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4453

Bewegungsabhängige Schmerzen über dem Hüftgelenk
(Movement-dependent pain above the hip joint)
Profanter, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4454

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4455

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4456

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10
4457

Der Einfluss der osteopathischen Behandlung auf Blasenentleerungsstörungen bei Frauen. Eine kontrollierte klinische Studie
(The influence of osteopathic treatment on voiding dysfunction of female patients)
Alberts, B., Eckmann, K., Mertens, B.
Unpublished D.O. thesis, 2005/10
4458

Pelvic postural asymmetry revisited
Davidson, S. M., Juhl, J. H.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4459

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4460

Osteopathie als Chance bei Kindern mit ADS/ADHS
“Osteopathy as an opportunity for children with ADD/ADHD“
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
4461

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4462

Teacher, heal thyself
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/09
4463

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4464

Evidence base presented--and expanding--for investment in tobacco dependence curricula for osteopathic medical education
Montalto, N. J., Priester, T. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4465

Loyalty to the profession, not the AOA: evidence base necessary for member support of association policies
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4466

Attention applicants: please submit emotional intelligence scores
Sefcik, D. J.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4467

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4468

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text
4469

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text
4470

Lower Extremity Edema: A Case Report
DeLaughter, J. P., Gamber, R. G.
The AAO Journal, 2005/09
Free full text
4471

Osteopathie als Chance für Kinder mit ADS/ADHS?
(Osteopathy as an opportunity for children with ADD/ADHD?)
Bierent-Vass, A.
Osteopathische Medizin, 2005/09
4472

Somatische Dysfunktion - Reflektion über die Anwendung des Begriffs in der osteopathischen Praxis
(Somatic dysfunction - Reflection on the use of the term in osteopathic practice)
Comeaux, Z.
Osteopathische Medizin, 2005/09
4473

Muscle energy technique: Geschichte, Modell und Wirksamkeit, Teil 2 - Das Modell
(Muscle energy technique. History, model and effectiveness, part 2 - The model)
Franke, H.
Osteopathische Medizin, 2005/09
4474

Biologische Basis des osteopathischen Konzeptes
(Biological basis of osteopathic concepts)
Korr, I. M.
Osteopathische Medizin, 2005/09
4475

Effectiveness of cervical spine manipulation and prescribed exercise in reduction of cervicogenic headache pain and frequency: A single case study experimental design
Eldridge, L., Russell, J.
International Journal of Osteopathic Medicine, 2005/09
4476

The short term effect of atlanto-axial high velocity low amplitude manipulation with cavitation on Edge Light Pupil Cycle Time
Gosling, C. M. R., Kinross, T., Gibbons, P., Holmes, M.
International Journal of Osteopathic Medicine, 2005/09
4477

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09
4478

Osteopathy in the cranial field – moving towards evidence for causality and effectiveness
Moran, R. W.
International Journal of Osteopathic Medicine, 2005/09
4479

Osteopathic manipulative treatment for low back pain: a systematic review and meta-analysis of randomized controlled trials
Licciardone, J. C., Brimhall, A. K., King, L. N.
BMC Musculoskeletal Disorders, 2005/08
Free full text
4480

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text
4481

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text
4482

Testing the effectiveness of an innovative information package on practitioner reported behaviour and beliefs: the UK Chiropractors, Osteopaths and Musculoskeletal Physiotherapists Low back pain ManagemENT (COMPLeMENT) trial
Evans, D. W., Foster, N. E., Underwood, M., Vogel, S., Breen, A. C., Pincus, T.
BMC Musculoskeletal Disorders, 2005/07
Free full text
4483

Osteopathische Narbenbehandlung
(Osteopathic cicatrice treatment)
Mayer, J.
Osteopathische Medizin, 2005/07
4484

Zum Thema der “osteopathischen Dreifaltigkeit“
(Osteopathic trinity 2)
Meert, G. F.
Osteopathische Medizin, 2005/07
4485

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07
4486

Osteopathic International Alliance: Vereinigung des Osteopathischen Berufstandes
(The Osteopathic International Alliance)
Wickless, L.
Osteopathische Medizin, 2005/07
4487

Das stomatognathe System aus osteopathischer Sicht
(The Stomatognathic System from an Osteopathic Aspect)
Amigues, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4488

Zusammenarbeit von Zahnarzt und Osteopath bei Kiefergelenksbeschwerden
(Collaboration between dentist and osteopath for temporomandibular joint disorders)
Fiedler, S.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4489

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4490

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4491

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07
4492

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text
4493

Preoperative intravenous morphine sulfate with postoperative osteopathic manipulative treatment reduces patient analgesic use after total abdominal hysterectomy
Goldstein, F. J., Jeck, S., Nicholas, A. S., Berman, M. J., Lerario, M.
The Journal of the American Osteopathic Association, 2005/06
Free full text
4494

Cannabimimetic effects of osteopathic manipulative treatment
McPartland, J. M., Giuffrida, A., King, J., Skinner, E., Scotter, J., Musty, R. E.
The Journal of the American Osteopathic Association, 2005/06
Free full text
4495

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text
4496

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text
4497

American Academy of Osteopathy® Consensus Statement for Osteopathic Manipulation of Somatic Dysfunction under Anesthesia and Conscious Sedation
Governors, AAO Board of
The AAO Journal, 2005/06
Free full text
4498

Be Careful with this Kind of Case!
MacDonald, R. C.
The AAO Journal, 2005/06
Free full text
4499

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text
4500

Psychosocial factors in osteopathic practice: To what extent should they be assessed?
Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/06
4501

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06
4502

Dissection of the thoracic paraspinal region – implications for osteopathic palpatory diagnosis: A case study
Fryer, G., Johnson, J.
International Journal of Osteopathic Medicine, 2005/06
4503

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06
4504

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4505

IM ketorolac versus OMT: was agent at peak analgesic effect in JAOA study?
Coston, J. L., McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4506

Sources of bias in reviews of spinal manipulation for back pain
Canter, P. H., Ernst, E.
Wiener Klinische Wochenschrift, 2005/05
4507

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4508

Taking osteopathic distinctiveness seriously: historical and philosophical perspectives
Osborn, G. G.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4509

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text
4510

Physiologic and anatomic changes in carpal tunnel syndrome: Is osteopathic manipulative treatment an effective non-surgical alternative therapy?
White, H. D.
Unpublished MSc thesis, 2005/05
4511

Facilitated oscillatory release - a dynamic method of neuromuscular and ligamentous/articular assessment and treatment
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/04
4512

Systematisch literatuuronderzoek naar de effecten van behandeling bij zuigelingen met 'kopgewrichteninvloed bij storingen in de symmetrie' ('KISS-syndroom')
(Systematic review of the effects of therapy in infants with the KISS-syndrome (kinetic imbalance due to suboccipital strain))
Brand, P. L. P., Engelbert, R. H. H., Helders, P. J. M., Offringa, M.
Nederlands Tijdschrift voor Geneeskunde, 2005/04
Free full text
4513

Das okulo-vestibulo-zervikale Funktionsmodell in der osteopathischen Praxis
(The oculo-vestibulo-cervico function model in the osteopathic practice)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4514

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4515

Nystagmus
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4516

Der Einfluss der osteopathischen Behandlung auf die Verkrümmung der Cornea
(The influence of osteopathic treatment on corneal curvature)
Haase, A.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4517

Tränenkanalstenose und andere Augenbeschwerden bei Kindern
(Lacrimal duct stenosis and other eye disorders in children)
Heinisch, M., Oberhuber, H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4518

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4519

Osteopathische Pilotstudie zum Offenwinkelglaukom
(Osteopathic pilot study on open-angle glaucoma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04
4520

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4521

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4522

Faith versus evidence: the real question in osteopathic medicine?
Juhl, J. H., Ostrow, G. L.
The Journal of the American Osteopathic Association, 2005/03
4523

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4524

Same as it ever was
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4525

Still keeping the faith
Rubinstein, L.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4526

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03
4527

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4528

Osteopathic medical training revisited: developing tomorrow's physicians
Innes, K.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4529

The Case of a Patient with Persistent Urinary Urgency
Clark, R. C.
The AAO Journal, 2005/03
Free full text
4530

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text
4531

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03
4532

Where Do We Go From Here? 2004 Thomas L. Northup Lecture
Glover, J. C.
The AAO Journal, 2005/03
Free full text
4533

Medical Coverage for the American Team at the World 24-hour Championship Race in Brno Czech Republic
Lovy, A.
The AAO Journal, 2005/03
Free full text
4534

Acute Intermittent Porphyria Mimic of Guillain-Barré Syndrome: A Case Report with the Use of Osteopathic Manipulation for Management of Pain
McClennen, E. R., Gamber, R.
The AAO Journal, 2005/03
Free full text
4535

Rolfing und Osteopathie: Form und Funktion aus der Sicht des Rolfing
(Rolfing and osteopathy: Form and function from the viewpoint of rolfing)
Flury, H.
Osteopathische Medizin, 2005/03
4536

Qualität in der Osteopathiepraxis
(Quality in osteopathy practice)
Hafen, F.
Osteopathische Medizin, 2005/03
4537

Wo steht die Osteopathische Medizin? Stand und Zukunft der Osteopathischen Medizin aus Sicht des EROP
(What is the position of osteopathic medicine? Current state and future of osteopathic medicine from the viewpoint of the European Register for Osteopathic Physicians (EROP))
Mayer, J.
Osteopathische Medizin, 2005/03
4538

Palpation und Forschung
(Palpation and research in osteopathy)
Muzzi, D.
Osteopathische Medizin, 2005/03
4539

Wie ein Osteopath die Rolfingmethode sieht
(How an osteopath looks upon the rolfing method)
Proby, J.
Osteopathische Medizin, 2005/03
4540

The effect of osteopathy in the treatment of chronic low back pain – a feasibility study
Kirk, L., Underwood, M., Chappell, L., Martins-Mendez, M., Thomas, P.
International Journal of Osteopathic Medicine, 2005/03
4541

Attitudes towards prescribing rights: a qualitative focus group study with UK osteopaths
Grundy, M., Vogel, S.
International Journal of Osteopathic Medicine, 2005/03
4542

Welcome to IJOM
Moore, A. P.
International Journal of Osteopathic Medicine, 2005/03
4543

IJOM: An international journal for an international readership
Moran, R. W., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/03
4544

An account of the development of the conceptual basis of osteopathy course at the British School of Osteopathy
Nash, K., Tyreman, S.
International Journal of Osteopathic Medicine, 2005/03
4545

Intramuscular ketorolac versus osteopathic manipulative treatment in the management of acute neck pain in the emergency department: a randomized clinical trial
McReynolds, T. M., Sheridan, B. J.
The Journal of the American Osteopathic Association, 2005/02
Free full text
4546

Cranial manipulation can alter sleep latency and sympathetic nerve activity in humans: a pilot study
Cutler, M. J., Holland, B. S., Stupski, B. A., Gamber, R. G., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2005/02
4547

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text
4548

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text
4549

The effect of manual therapy and a home exercise program on cervicogenic headaches: A case report
Hanten, W. P., Olson, S. L., Lindsay, W. A., Lounsberry, K. A., Stewart, J. K.
Journal of Manual and Manipulative Therapy, 2005/01
4550

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01
4551

Chronic low back pain: osteopaths' attitudes and management
Griffiths, L.
Unpublished MSc thesis, 2005/01
Free full text
4552

Rebuttal regarding the “hardship exception“
Steier, K. J.
The Journal of the American Osteopathic Association, 2005/01
4553

Osteopaths' views on prescription rights: a qualitative pilot study
Burns, R.
Unpublished MSc thesis, 2005/01
Free full text
4554

A pilot study investigating professional standardisation and harmonisation in osteopathic institutions within Europe and Australia
Hristov, A.
Unpublished MSc thesis, 2005/01
Free full text
4555

The effect of mobilisation on pressure pain thresholds in the lumbar spine
Medle, M.
Unpublished MSc thesis, 2005/01
Free full text
4556

Occupational stress and job satisfaction in recently qualified Australian osteopaths
Salter, J.
Unpublished MSc thesis, 2005/01
Free full text
4557

A study into osteopathic treatment of pregnant women in NSW and Queensland
Smith, S.
Unpublished MSc thesis, 2005/01
Free full text
4558

Sexual harassment of male osteopaths in the workplace: evidence and effect
Stone, M.
Unpublished MSc thesis, 2005/01
Free full text
4559

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4560

An observational study of student osteopaths' measurement of arterial blood pressure by sphygmomanometry and auscultation
Tye-Smith, A.
Unpublished MSc thesis, 2005/01
Free full text
4561

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4562

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4563

Subakuter Rückenschmerz: Osteopathie als nützliche und kosteneffektive Ergänzung der Routinebehandlung
(Subacute spinal pain: Osteopathy as a useful and cost effecticve add-on to usual care)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4564

Effects of osteopathic manipulative treatment on pediatric patients with asthma: a randomized controlled trial
Guiney, P. A., Chou, R., Vianna, A., Lovenheim, J.
The Journal of the American Osteopathic Association, 2005/01
Free full text
4565

Spondylodiszitis
(Spondylodiscitis)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01
4566

Cognitive bias in back pain patients attending osteopathy: testing the enmeshment model in reference to future thinking
Read, J., Pincus, T.
European Journal of Pain, 2004/12
4567

Don’t Raise Your Hand – Put it on the Patient
Dowling, D. J.
The AAO Journal, 2004/12
Free full text
4568

A Case Study of Left Adhesive Capsulitis Presumably Resulting from Previous Treatment with Protease Inhibitors
Lipton, J. A., Neil, M.
The AAO Journal, 2004/12
Free full text
4569

Case Study: An Osteopathic Resolution of a Neurocardiogenic Syncope
Somoano, Y., Hagopian, S.
The AAO Journal, 2004/12
Free full text
4570

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text
4571

Cost-utility analysis of osteopathy in primary care: results from a pragmatic randomized controlled trial
Williams, N. H., Edwards, R. T., Linck, P., Muntz, R., Hibbs, R., Wilkinson, C., Russell, I., Russell, D., Hounsome, B.
Family Practice, 2004/12
Free full text
4572

Relationship of Medical Students' Pre-Matriculate Clinical Experience to Step I Medical Board Examination Scores
Laster, B. B.
Unpublished MSc thesis, 2004/12
Free full text
4573

Blagrave-Technik zur Halswirbelsäulenbehandlung
(The Blagrave procedure for the treatment of the cervical spine)
Blagrave, P.
Osteopathische Medizin, 2004/11
4574

Die sensomotorische Entwicklung des Kindes
(The sensomotoric development of the child)
Darraillans, B.
Osteopathische Medizin, 2004/11
4575

Inter- und Intratester-Reliabilität der Palpation des “Primären Respiratorischen Mechanismus“ innerhalb des “Cranialen Konzeptes“
(Interexaminer and intraexaminer reliability of palpation of the primary respiratory mechanism within the cranial concept)
Sommerfeld, P., Kaider, A., Klein, P.
Osteopathische Medizin, 2004/11
Free full text
4576

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4577

F. X. Mayr-Diagnostik -Therapie und Osteopathie
(F.X. Mayr diagnosis and therapy and osteopathy)
Wilde, W.
Osteopathische Medizin, 2004/11
4578

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4579

Geburtstraumatisch bedingtes Zephalhämatom
(Birth trauma-related cephalohematoma)
Fuhrmann, M., Münster, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4580

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11
4581

Osteopathischer Dachverband endlich gegründet
(Osteopathic umbrella organization finally founded)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4582

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text
4583

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4584

Intraossäre Läsion des Sphenoids und Os temporale - Ansichten und Vorgehen von Viola Frymann
(Intraosseus lesion of the sphenoid and temporalis. Views and Procedures from Viola Frymann)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4585

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text
4586

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11
4587

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text
4588

Einigung über Curriculum in Frankfurt
(Agreement on curriculum for osteopathic training in Germany
Schmidt, S.
Osteopathische Medizin, 2004/11
4589

The relation between thoracic paraspinal tissues and pressure sensitivity measured by a digital algometer
Fryer, G., Gibbons, P., Morris, T.
Journal of Osteopathic Medicine, 2004/10
4590

Kann die Osteopathie einen spezifischen Beitrag in der Behandlung von Kindern mit Aufmerksamkeitsstörungen ohne Hyperaktivität und mit Hyperaktivität – ADS/ADHS leisten? Eine randomisierte kontrollierte Studie
(Osteopathic treatment of children with attention deficit disorders, with or without hyperactivity (ADD/ADHD) - is there any effect? A randomized controlled trial)
Bierent-Vass, A., Lang, J., Neumann, N.
Unpublished D.O. thesis, 2004/10
4591

Kann eine osteopathische Behandlung die Dyspareunie beeinflussen?
(Can patients, suffering from Dyspareunia, expect improvement from an osteopathic treatment? A controlled and prospective trial)
Hoffmann, A., Band, I.
Unpublished D.O. thesis, 2004/10
4592

Osteopathische Behandlungen bei intramuralen Uterusmyomen – eine randomisierte klinische Studie
Osteopathic treatment for uterine leiomyomas: a randomized controlled clinical trial
Kaschowitz, G., Besse, J.P., Schwering, G.
Unpublished D.O. thesis, 2004/10
4593

Die osteopathische Behandlung von Patienten mit Coxarthrose
(The osteopathic treatment of patients with coxarthritis)
Kießling, G., Trantenroth, M.
Unpublished D.O. thesis, 2004/10
4594

Knochen und Suturen im nasomaxillären Bereich des Schädels. Entwicklung, Ossifikation, Wachstum und Mobilität
(Bones and sutures within the nasomaxillary region of the cranium: Development, ossification, growth and mobility of those bones)
Lippmann, C.
Unpublished D.O. thesis, 2004/10
4595

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text
4596

More about the use of OMT during influenza epidemics
Magoun, H. I.
The Journal of the American Osteopathic Association, 2004/10
Free full text
4597

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text
4598

The effectiveness and efficiency of a primary care osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
4599

Effectiveness and efficiency of a primary care based osteopathy clinic for spinal pain
Williams, N. H.
Unpublished PhD thesis, 2004/10
Free full text
4600

The influence of contraction duration in muscle energy technique applied to the atlanto-axial joint
Fryer, G., Ruszkowski, W.
Journal of Osteopathic Medicine, 2004/10
4601

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09
4602

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09
4603

Am I a carer and do I care? An exploration of the concept of care as applied to osteopathic practice
Barnes, A.
Medicine, Health Care and Philosophy, 2004/09
4604

Influenza epidemic or pandemic? Time to roll up sleeves, vaccinate patients, and hone osteopathic manipulative skills
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/09
Free full text
4605

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text
4606

Chronic Fatigue Syndrome: The Misunderstood Disease
Gregg, T., Williams, S. F.
The AAO Journal, 2004/09
Free full text
4607

The Effect of Osteopathic Manipulative Treatment on Gait Disturbance in Multiple Sclerosis Patients
Mann, J. M., Steele, K. M.
The AAO Journal, 2004/09
Free full text
4608

Lymphatic Manipulative Pump Research: A Brief Review of Literature
McMillan, S., Crow, W. T., Greene, C. H.
The AAO Journal, 2004/09
Free full text
4609

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text
4610

Chronic Pelvic Pain Syndrome
Rossi, P. J., Dickey, J. L.
The AAO Journal, 2004/09
Free full text
4611

A review of King HH and Lay EM, “Osteopathy in the Cranial Field,“ in Foundations for Osteopathic Medicine, 2nd ed
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2004/09
4612

Kurzinterview: Silvio Castagna
(A short interview with Silvio Castagna)
Schmidt, S., Castagna, S.
Osteopathische Medizin, 2004/08
4613

Wirksamkeit der Manipulation bei der Behandlung von Lumbago: Die Gültigkeit der Schlussfolgerungen bei Metaanalysen
(Effectiveness of manipulation in the treatment of low back pain: Validity of the conclusions in metaanalyses)
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Osteopathische Medizin, 2004/08
4614

Das Selbstverständnis eines Osteopathen
(Self-image of an osteopath)
Dräger, K.
Osteopathische Medizin, 2004/08
4615

Einführung in die Aquatische Osteopathie
(Introduction to aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
4616

Fulkren in der Aquatischen Osteopathie
(Fulcrum in aquatic osteopathy)
Dufresne, M.
Osteopathische Medizin, 2004/08
4617

Der gastro-ösophagale Übergang in der Diagnostik und Behandlung (Teil 2)
(The esophagogastric junction in diagnosis and treatment (Part 2))
Helsmoortel, J., Hirth, T., Kleßen, H.
Osteopathische Medizin, 2004/08
4618

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08
4619

Ganz ganzheitlich als osteopathisch tätiger Physiotherapeut
(Completely comprehensive as osteopathic physiotherapist)
Meert, G. F.
Osteopathische Medizin, 2004/08
4620

Osteopathie- ein viel versprechender Ansatz zur Verbesserung der Lebensqualität bei Panikattacken
(Osteopathy - A very promising approach to improve the quality of life in persons suffering from panic attacks)
Michaud, C.
Osteopathische Medizin, 2004/08
4621

Einheitliche Ausbildungsrichtlinien für Osteopathen Einigung in greifbarer Nähe
(Standardized educational guidelines for osteopaths)
Schmidt, S.
Osteopathische Medizin, 2004/08
4622

Interview: Jane Stark
(An interview with Jane Stark)
Stark, J.
Osteopathische Medizin, 2004/08
4623

Ganz ganzheitlich: Ganzheitlichkeit der Osteopathie?
(Completely comprehensive: Comprehensiveness of osteopathy?)
Wührl, P.
Osteopathische Medizin, 2004/08
4624

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4625

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4626

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4627

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4628

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text
4629

Interview: Bernhard Hartwig, DROM e.V.
(An inteview with Bernhard Hartwig, DROM e.V.)
Schmidt, S.
Osteopathische Medizin, 2004/08
4630

Interview: Marina Fuhrmann, VOD e.V.
(An interview with Marina Fuhrmann, VOD e.V.)
Schmidt, S., Fuhrmann, M.
Osteopathische Medizin, 2004/08
4631

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4632

The effect of osteopathic manipulative treatment on immune response to the influenza vaccine in nursing homes residents: a pilot study
Noll, D. R., Degenhardt, B. F., Stuart, M. K., Werden, S., McGovern, R. J., Johnson, J. C.
Alternative Therapies In Health And Medicine, 2004/07
4633

Osteopathy in Idiopathic Parkinson Syndrome
Pelzl, R.
Unpublished MSc thesis, 2004/07
Free full text
4634

Globale integrierte Myofasziale Osteopathische Therapie (GIMFOT)
(Global integrated myofascial osteopathic therapy (GIMFOT))
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4635

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text
4636

Fasziales Thoraxkompressionstrauma
(Fascial thoracic compression trauma)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4637

Mobilisation der Rippen - in die ein geschränkte oder in die freie Richtung? Pro und Contra
(Mobilization of the ribs - in the restricted or in the free direction? Pros and cons)
Küttner, T., Geldschläger, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4638

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text
4639

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
4640

Performance on the American Osteopathic Board of Internal Medicine certifying examination 1986-2002 of various demographic groups and the impact of AOA reentry resolutions on allopathic-trained candidates taking the examination
Slick, G. L.
The Journal of the American Osteopathic Association, 2004/07
Free full text
4641

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text
4642

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text
4643

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text
4644

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text
4645

Health Promotion and Disease Prevention (HPDP) Programs of Osteopathic Hospitals: A Comparative Analysis Abstract
Sinay, T., Geletta, S.
The AAO Journal, 2004/06
Free full text
4646

Osteopathische versus orthopädische Behandlung der chronischen Epicondylopathia humeri radialis: Eine randomisiert kontrollierte Untersuchung.
[Osteopathic versus orthopedic treatments for chronic epicondylopathia humeri radialis: a randomized controlled trial]
Geldschlager, S.
Forschende Komplementärmedizin, 2004/05
4647

Osteopathie und Senkung der Arbeitsunfähigkeitszeit
(Osteopathy and disability reduction)
Hack, A.
Manuelle Medizin, 2004/05
4648

Pseudokrupp
(Pseudo Croup)
Angerer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4649

Die Entwicklung und osteopathische Behandlung von Kindern
(The development and osteopathic treatment of children)
Beinborn, B.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4650

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4651

8. Europäisches Symposium der traditionellen Osteopathie
(8th European Symposium of Traditional Osteopathy)
Frühwein, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4652

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text
4653

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text
4654

Infantile Schluckstörungen - in die Hand des Osteopathen
(Infantile swallowing disorder: To the hands of osteopaths)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4655

Dreimonatskolik: Osteopathie klinisch klar überlegen
(Colic children: Osteopathy markedly superior)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4656

Das Okziput - ein wichtiger Aspekt der kraniosakralen Osteopathie bei Säuglingen
(Occiput: An important aspect of craniosacral osteopathy in infants)
Schwerdtner, H.P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
4657

Osteopathie auf der Intensivstation
(Osteopathy in the intensive care unit)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05
Free full text
4658

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text
4659

Preliminary trial of a survey instrument to detect outcomes of curriculum reform in osteopathic manipulative medicine
von Lindeman, A.
Unpublished MSc thesis, 2004/05
4660

Parental perceptions of the therapeutic effect from osteopathic manipulation or acupuncture in children with spastic cerebral palsy
Duncan, B., Barton, L., Edmonds, D., Blashill, B. M.
Clinical Pediatrics, 2004/05
4661

The effect of manipulation and mobilisation on pressure pain thresholds in the thoracic spine
Fryer, G., Carub, J., McIver, S.
Journal of Osteopathic Medicine, 2004/04
4662

DO relates positive experience with use of integrated neuromusculoskeletal release
Connolly, T. P.
The Journal of the American Osteopathic Association, 2004/04
Free full text
4663

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text
4664

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text
4665

The effect of osteopathic manipulative medicine on pulmonary function and lung volumes in healthy adults
Bradbury, J. A.
Unpublished MSc thesis, 2004/04
4666

A presentation of stiff and painful shoulder — a case based commentary
Chemeris, A. I., Clive, B., Lathey, D., Niel-Asher, C. S.
Journal of Osteopathic Medicine, 2004/04
4667

The use of cranial osteopathy in the treatment of infants with breast feeding problems or sucking dysfunction
Wescott, N.
The Australian Journal of Holistic Nursing, 2004/04
4668

Methods used by members of the Australian osteopathic profession to assess the sacroiliac joint
Peace, S., Fryer, G.
Journal of Osteopathic Medicine, 2004/04
4669

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text
4670

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03
4671

Effectiveness of a sham protocol and adverse effects in a clinical trial of osteopathic manipulative treatment in nursing home patients
Noll, D. R., Degenhardt, B. F., Stuart, M., McGovern, R., Matteson, M.
The Journal of the American Osteopathic Association, 2004/03
Free full text
4672

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text
4673

Interdisciplinary approach to teaching medication adherence to pharmacy and osteopathic medical students
Singla, D. L., MacKinnon, G. E., 3rd, MacKinnon, K. J., Younis, W., Field
The Journal of the American Osteopathic Association, 2004/03
Free full text
4674

Cystic Fibrosis: A Case History
Back, H. D., Gamber, R. G.
The AAO Journal, 2004/03
Free full text
4675

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text
4676

A Case of Right First Rib Somatic Dysfunction Diagnosed and Treated
Lipton, J. A., Neil, M., Drew, B., McCarty, C.
The AAO Journal, 2004/03
Free full text
4677

Inter- and intraexaminer reliability in palpation of the “primary respiratory mechanism” within the “cranial concept”
Sommerfeld, P., Kaider, A., Klein, P.
Manual Therapy, 2004/02
4678

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4679

Sturzgeburt und fasziales System
(Precipitate labor and fascial system)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4680

Das Meeting der World Osteopathic Health Organisation (WOHO)
(The meeting of the World Osteopathic Health Organisation (WOHO))
Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4681

AOA membership and board certification of residency graduates: comparison of three programs accepting osteopathic physicians--implications for graduate medical education
Hayes, O. W.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4682

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4683

Strength in collaboration
Quinn, A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4684

Die Bedeutung der Faszien in der manuellen Therapie
(The importance of fasciae in manual therapy)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4685

Wie viel Intensität braucht die Behandlung des Fasziengewebes? Pro und Contra
(How much intensity does the treatment of fascial tissue need? Pros and cons)
Schwind, P., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02
4686

Outpatient osteopathic single organ system musculoskeletal exam form: training and certification
Sleszynski, S. L., Glonek, T., Kuchera, W. A.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4687

Let's learn from the influenza epidemic
Richardson, M. E.
The Journal of the American Osteopathic Association, 2004/02
Free full text
4688

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text
4689

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01
4690

Osteopathic treatment for the symtomatic relief of meniere's disease
Adamek, K.
Unpublished MSc thesis, 2004/01
Free full text
4691

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain
Alivizatos, J.
Unpublished MSc thesis, 2004/01
Free full text
4692

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text
4693

Analysis of co-pathologies in 1000 patients attending an osteopathic teaching clinic
Blajer, J.
Unpublished MSc thesis, 2004/01
Free full text
4694

The effect of osteopathic treatment on lung function in children with asthma: a case study
Esnouf, M.
Unpublished MSc thesis, 2004/01
Free full text
4695

Job satisfaction and occupational stress in experienced osteopaths
Flaherty, K.
Unpublished MSc thesis, 2004/01
Free full text
4696

Osteopathic treatment for the symtomatic relief of meniere's disease
Adamek, K.
Unpublished MSc thesis, 2004/01
Free full text
4697

Spirituality and osteopathy: a practitioners' views
Huggett, S.
Unpublished MSc thesis, 2004/01
Free full text
4698

The effect of osteopathic manipulative therapy applied to the lumbar spine on postural stability: a pilot study
Jones, D.
Unpublished MSc thesis, 2004/01
Free full text
4699

An investigation of the factors underlying the choice of treatment modalities used by students in the Victoria University Osteopathic clinic and practicing osteopaths
Kennedy, L.
Unpublished MSc thesis, 2004/01
Free full text
4700

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4701

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain
Lamaro, J.
Unpublished MSc thesis, 2004/01
Free full text
4702

The effect of training on the inter-examiner and intra-examiner reliability of static palpation for assessing pelvic landmarks
McPherson, H. C.
Unpublished MSc thesis, 2004/01
Free full text
4703

Identifying the major issues of rural osteopathic practice from the practitioner's perspective
Moritz, S.
Unpublished MSc thesis, 2004/01
Free full text
4704

Discussion and literature review of primary respiration
Mahal, J.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4705

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4706

The perceived effect that part-time work has on undergraduate and postgraduate osteopathic students
Nolle, C.
Unpublished MSc thesis, 2004/01
Free full text
4707

Inter-examiner and intra-examiner reliability of the seated flexion test
O'Keefe, P.
Unpublished MSc thesis, 2004/01
Free full text
4708

Osteopathic emergency physician training and use of osteopathic manipulative treatment
Ray, A. M., Cohen, J. E., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text
4709

Osteopathic treatment to patients with primary dysmenorrhea
Pirritano, R.
Unpublished MSc thesis, 2004/01
Free full text
4710

The effect of osteopathic treatment on the irritable bowel syndrome: a case series
Stasiuk, D.
Unpublished MSc thesis, 2004/01
Free full text
4711

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text
4712

The efficacy of the osteopathic manipulative medicine pre-doctoral fellowship program at the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center
McCurdy, E. N.
Unpublished MSc thesis, 2004/01
4713

Randomized osteopathic manipulation study (ROMANS): pragmatic trial for spinal pain in primary care
Williams, N. H., Wilkinson, C., Russell, I., Edwards, R. T., Hibbs, R., Linck, P., Muntz, R.
Family Practice, 2003/12
Free full text
4714

Review of integrated neuromusculoskeletal release and the novel application of a segmental anterior/posterior approach in the thoracic, lumbar, and sacral regions
Danto, J. B.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4715

Bedside cardiology skills training for the osteopathic internist using simulation technology
Issenberg, S. B., Gordon, M. S., Greber, A. A.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4716

Osteopathic manipulative treatment in prenatal care: a retrospective case control design study
King, H. H., Tettambel, M. A., Lockwood, M. D., Johnson, K. H., Arsenault, D. A., Quist, R.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4717

Support needed for clinical faculty in osteopathic emergency medicine residencies
Minor, S. K., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2003/12
Free full text
4718

Osteopathic physicians in primary care, Texas, 2003
Miller, T. L.
Unpublished MSc thesis, 2003/12
4719

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text
4720

Inclusion of evidence-based medicine in colleges of osteopathic medicine and suggestions for implementing evidence-based medicine into osteopathic medical school curricula
Cundari, A. D., Ker, N.
The Journal of the American Osteopathic Association, 2003/11
Free full text
4721

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text
4722

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text
4723

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11
4724

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text
4725

Osteopathie hilft bei Prävention & Reha
(Osteopathy helps in prevention and rehabilitation)
Schaa, J.
Pflege Aktuell, 2003/11
4726

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text
4727

Position-Assisted Combination Technique (PACT) in the Management of Type-II Impairment in the Thoracic and Lumbar Spine
Makofsky, H. W.
Journal of Manual and Manipulative Therapy, 2003/10
4728

The effect of muscle energy technique on hamstring extensibility: the mechanism of altered flexibility
Ballantyne, F., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/10
4729

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10
4730

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10
4731

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10
4732

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10
4733

A prospective study of osteopathic medical students' attitudes toward use of osteopathic manipulative treatment in caring for patients
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2003/10
Free full text
4734

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text
4735

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text
4736

Osteopathische Behandlung infantiler Schluckstörungen bei Kindern zwischen sieben und elf Jahren
(Osteopathic treatment of infantile swallowing for children between 7 and 11 years)
Bayer, S., Feldt, M.
Unpublished D.O. thesis, 2003/10
4737

Hat die osteopathische Behandlung bei Frauen mit menstrueller Migräne einen Effekt?
(The osteopathic treatment of menstrual migraine)
Ecker, H., Thomas, C.
Unpublished D.O. thesis, 2003/10
4738

Os sphenoidale und Os ethmoidale – Entwicklung, Verknöcherung und Frage nach der Möglichkeit einer Mobilität
(Sphenoid bone and Ethmoid bone – Development, Ossification and the Question of a possible Mobility)
Eser-Bindl, U.
Unpublished D.O. thesis, 2003/10
4739

Study to evaluate osteopathic treatment in late whiplash syndrome
(Study to evaluate osteopathic treatment in late whiplash syndrome)
Gietz, R., Kaiser, A., Kastner, K.
Unpublished D.O. thesis, 2003/10
4740

Die osteopathische Behandlung bei 3- Monatskolik im Vergleich zur konventionellen Therapie
(Osteopathic treatment of infantile colic)
Heber, U., Senger, A.
Unpublished D.O. thesis, 2003/10
4741

Pilotstudie zur Untersuchung der Wirksamkeit der osteopathischen Tuba auditiva Technik bei akuten Tinnituspatienten mit und ohne Hörstörungen
(Randomized clinical trial to investigate the efficacy of osteopathic tuba auditiva technique in acute tinnitus patients with and without hearing disorders - a pilot study.)
Mayer, M.
Unpublished D.O. thesis, 2003/10
4742

Osteopathie als Therapie der Säuglingsasymmetrie: Eine randomisierte kontrollierte Studie
(Infantile postural asymmetry and osteopathic treatment: a randomized therapeutic trial)
Pabst, B., Schleupen, A.
Unpublished D.O. thesis, 2003/10
4743

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10
4744

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4745

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4746

Osteopathische Begleitung während der Schwangerschaft
(Osteopathic support during pregnancy)
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4747

Osteopathie in der Schwangerschaft: Profitieren Mutter und Kind?
(Osteopathy in pregnancy: positive impact on mother and child?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4748

Osteopathie bei Zwillingsschwangerschaft
(Osteopathy in twin pregnancy)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4749

Behandlung von Symphysis pubis, knöchernem Becken und Beckenboden
(Treatment of symphysis pubis, bony pelvis and pelvic floor)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10
4750

Place de l’acupuncteur et du thérapeute manuel dans la prise en charge pluridisciplinaire des douloureux chroniques
(Place of acupuncturist and osteopath in multidisciplinary chronic pain management)
Meas, Y., Nizard, J., Rouxeville, Y., Lajat, Y.
Douleur et Analgesie, 2003/09
4751

Muscle energy technique in patients with acute low back pain: a pilot clinical trial
Wilson, E., Payton, O., Donegan-Shoaf, L., Dec, K.
Journal of Orthopaedic & Sports Physical Therapy, 2003/09
4752

Osteopathic manipulative treatment in the emergency department for patients with acute ankle injuries
Eisenhart, A. W., Gaeta, T. J., Yens, D. P.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4753

Principles from evolutionary biology and psychology will further strengthen tenets and profession
Pohlod, C. A.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4754

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4755

Development of the Attitudes Toward Osteopathic Principles and Practice Scale (ATOPPS): preliminary results
Russo, D. P., Stoll, S. T., Shores, J. H.
The Journal of the American Osteopathic Association, 2003/09
Free full text
4756

Objectively and subjectively observed changes in patients diagnosed with primary coxarthrosis following osteopathic treatment with and without supplemental glucosaminosulfate and MSM
Bergthaler, H.
Unpublished MSc thesis, 2003/09
4757

Letters to the editor
Ehrenfeuchter, W. C., Kellam, R. T.
The AAO Journal, 2003/09
Free full text
4758

Facilitated Oscillatory Release - a method of dynamic assessment and treatment of Somatic Dysfunction
Comeaux, Z. J.
The AAO Journal, 2003/09
Free full text
4759

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text
4760

“The Energy cyst“: Its Ramifications and Use in Osteopathic Manipulative Management
MacDonald, R. C.
The AAO Journal, 2003/09
Free full text
4761

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text
4762

The use of osteopathic manipulative treatment as adjuvant therapy in children with recurrent acute otitis media
Mills, M. V., Henley, C. E., Barnes, L. L. B., Carreiro, J. E., Degenhardt, B. F.
Archives of Pediatrics & Adolescent Medicine, 2003/09
Free full text
4763

Osteopathic manipulation to prevent otitis media--does it work?
Pichichero, M. E.
Archives of Pediatrics & Adolescent Medicine, 2003/09
4764

Study raises important issues about the potential benefit of osteopathy in the cranial field to patients with Parkinson's disease
Boehm, K. M., Lawner, B. J., McFee, R. B.
The Journal of the American Osteopathic Association, 2003/08
Free full text
4765

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text
4766

Die Wirksamkeit des multimodalen (manualtherapeutischen, osteopathischen) Therapiekonzeptes bei Kindern mit infantiler Cerebralparese
(The effectiveness of multimodal therapy concepts in children with cerebral palsy)
Steingrube-Bradtke, E.
Kranken Gymnastik, 2003/08
4767

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text
4768

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07
4769

Do osteopathic physicians differ in patient interaction from allopathic physicians? An empirically derived approach
Carey, T. S., Motyka, T. M., Garrett, J. M., Keller, R. B.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4770

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4771

Osteopathic graduate medical education opportunities abound in south Florida
Silvagni, A. J.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4772

Osteopathic manipulative treatment for chronic low back pain: a randomized controlled trial
Licciardone, J. C., Stoll, S. T., Fulda, K. G., Russo, D. P., Siu, J., Winn, W., Swift, J.
Spine (Phila Pa 1976), 2003/07
4773

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text
4774

Cranial manipulation with possible neurovascular contact injury at the cerebello-pontine angle: a case report
Elliott, J. M., Jacobson, E. J., Centeno, C. J., Emerson, P. L.
Alternative Therapies in Health and Medicine, 2003/07
4775

ACO Risk Management for Chiropractors and Osteopaths: Imaging Guidelines for Conditions Commonly Seenin Practice
French, S., Walker, B. F., Cameron, M., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D., Comrie, D. A.
Australasian Chiropractic & Osteopathy, 2003/07
Free full text
4776

Schlüsselfunktionen des Peritoneums bei Rückenschmerzen
(Key functions of the peritoneum in back pain)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4777

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4778

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4779

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4780

Nackenschmerzen: Manualtherapie am günstigsten
(Cost-effectiveness of common treatments for neck pain)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4781

Die Viszera - Konsequenzen aus der Autonomie für die Osteopathie? Pro und Contra
(The viscera - consequences of autonomy for osteopathy? Pros and cons)
Wührl, P., Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07
4782

Osteopathic physicians provide quality care--with or without OMT
Crow, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4783

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4784

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4785

Awareness and use of osteopathic physicians in the United States: results of the Second Osteopathic Survey of Health Care in America (OSTEOSURV-II)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4786

OMT's effectiveness already proven
Tessien, R. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text
4787

Die Klavikula
(The clavicle. The key to the shoulder)
Hack, A.
Manuelle Medizin, 2003/06
4788

Osteopathic Manipulative Management of Herpes Zoster (Shingles} and the Prevention of Post Herpetic Neuralgia
Kellam, R. T.
The AAO Journal, 2003/06
Free full text
4789

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text
4790

OMT Relieves Jaw Pain
Pasquarello, G.
The AAO Journal, 2003/06
Free full text
4791

Somatovisceral response following osteopathic HVLAT: a pilot study on the effect of unilateral lumbosacral high-velocity low-amplitude thrust technique on the cutaneous blood flow in the lower limb
Karason, A. B., Drysdale, I. P.
Journal of Manipulative and Physiological Therapeutics, 2003/05
4792

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2003/05
Free full text
4793

Osteopathic manipulative treatment techniques preferred by contemporary osteopathic physicians
Johnson, S. M., Kurtz, M. E.
Journal of Osteopathic Medicine, 2003/05
Free full text
4794

The effect of muscle energy technique on gross trunk range of motion
Lenehan, K. L., Fryer, G., McLaughlin, P.
Journal of Osteopathic Medicine, 2003/04
4795

Research at US colleges of osteopathic medicine: a decade of growth
Guillory, V. J., Sharp, G.
The Journal of the American Osteopathic Association, 2003/04
Free full text
4796

Regarding the editorial on tobaccoism
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/04
4797

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04
4798

Praktische osteopathische Überlegungen zu den Nasennebenhöhlen
(Practical osteopathic considerations for the paranasal sinuses)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4799

Osteopathie bei chronischer Sinusitis
(Osteopathy for chronic sinusitis)
Häfner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4800

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4801

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4802

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4803

Wissenswertes zum Bereich von Hals, Nase und Ohren
(Things to know about the area of the throat, nose and ears)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4804

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4805

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04
4806

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text
4807

A proposal that benefits all
Bentley, E. M.
The Journal of the American Osteopathic Association, 2003/03
Free full text
4808

Tobaccoism revisited
Marino, R. V.
The Journal of the American Osteopathic Association, 2003/03
Free full text
4809

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03
4810

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text
4811

Characteristics of physicians disciplined by the State Medical Board of Ohio
Clay, S. W., Conatser, R. R.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4812

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4813

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text
4814

Spinal manipulation for low-back pain: a treatment package agreed to by the UK chiropractic, osteopathy and physiotherapy professional associations
Harvey, E., Burton, A. K., Moffett, J. K., Breen, A.
Manual Therapy, 2003/02
4815

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02
4816

Alternative treatments for neck sprain
Hogg, K., Morton, R.
Emergency Medicine Journal, 2003/01
4817

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01
4818

Results of a survey of inaugural class graduates of a college of osteopathic medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2003/01
Free full text
4819

Use of osteopathic manipulative treatment by Ohio osteopathic physicians in various specialties
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2003/01
Free full text
4820

A pilot study of the fundamental elements of osteopathic diagnosis as currently taught in the osteopathy course at Victoria University
Chisari, M.
Unpublished MSc thesis, 2003/01
Free full text
4821

Osteopathic treatments and the techniques used in the treatment of acute mechanical low back pain
Daskalou, D.
Unpublished MSc thesis, 2003/01
Free full text
4822

What is the relationship between indicators of stress and academic performance in third year university students: a follow up study
Flint, D.
Unpublished MSc thesis, 2003/01
Free full text
4823

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text
4824

A study of physiotherapists' and chiropractors' knowledge and opinions of osteopaths
Hough, N.
Unpublished MSc thesis, 2003/01
Free full text
4825

Sacroiliac joint assessment within the Australian osteopathic profession
Peace, S.
Unpublished MSc thesis, 2003/01
Free full text
4826

Re-discovery of self: the impact of osteopathic treatment on women who suffer from perimenstrual low backache
Lonergan, B.
Unpublished PhD thesis, 2003/01
4827

The impact of curricular reform on student opinions of their osteopathic manipulative medicine education
Niedzwecki, C. M.
Unpublished MSc thesis, 2003/01
4828

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text
4829

Evaluation de la frequence des accidents lies aux manipulations vertebrales a partir d'une enquete retrospective realisee dans quatre departements francais
(Complications following vertebral manipulation-a survey of a French region physicians)
Dupeyron, A., Vautravers, P., Lecocq, J., Isner-Horobeti, M. E.
Annales de Réadaptation et de Médecine Physique, 2003/01
4830

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01
4831

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4832

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4833

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4834

Kompensatorische Kniebeschwerden
(Compensatory knee pain)
Schallier, F., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4835

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01
4836

Perceptions of philosophic and practice differences between US osteopathic physicians and their allopathic counterparts
Johnson, S. M., Kurtz, M. E.
Social Science & Medicine, 2002/12
Free full text
4837

From the Archives: Untitled Talk
Sutherland, W. G.
The AAO Journal, 2002/12
Free full text
4838

Social Capital and Osteopathic Medicine in Transition
Ward, R. C.
The AAO Journal, 2002/12
Free full text
4839

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text
4840

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11
4841

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4842

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4843

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11
4844

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4845

Parameters of asthma and manipulation study questioned
Cali, G. E.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4846

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4847

Relationship of osteopathic medical licensure examinations with undergraduate admission measures and predictive value of identifying future performance in osteopathic principles and practice/osteopathic manipulative medicine courses and rotations
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4848

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4849

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4850

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4851

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11
4852

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text
4853

Die osteopathische Behandlung der chronischen Zervikalgie. Eine randomisierte kontrollierte Studie
(Osteopathy alleviates pain in chronic non-specific neck pain: A randomized controlled trial)
Bischoff, P., Nürnberger, A., Voigt, A.
Unpublished D.O. thesis, 2002/10
4854

Hat eine osteopathische Behandlung einen Effekt bei Kindern mit Hyperaktivität und/oder eines Aufmerksamkeits-Defizitsyndroms.
(Can osteopathic treatment have an effect on children with Attention Deficit Hyperactivity Disorder Syndrome (ADHD) and/or Attention Disorder Syndrome (ADD)? A randomized controlled trial.)
Haas, J, Käser, D, Werner, M
Unpublished D.O. thesis, 2002/10
4855

Studie zur osteopathischen Behandlung der Dranginkontinenz und der Kombination aus Stress- und Dranginkontinenz bei Frauen
(Study on osteopathic treatment of urge incontinence and the combination of stress and urge incontinence in women.)
Ernst, H., Osenstätter, H.
Unpublished D.O. thesis, 2002/10
4856

Kann durch osteopathische Techniken eine Senkung des Augeninnendrucks beim primärchronischen Offenwinkelglaukom bewirkt werden? [Pilotstudie]
(Is it possible through osteopathic techniques to get a reduction of intraocular pressure in primary open-angle glaucoma? (pilot study))
Esser, T.
Unpublished D.O. thesis, 2002/10
4857

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10
4858

Osteopathie und chronische Sinusitis: Eine randomisierte kontrollierte Pilotstudie
(Osteopathic treatment of chronic sinusitis: a randomized controlled pilot trial)
Häfner, S., Stadler, M.
Unpublished D.O. thesis, 2002/10
4859

Untersuchung der Reproduzierbarkeit osteopathischer Tests am Beispiel des Beckens
(Study of the reproducibility of osteopathic tests using the pelvis as an example.)
L, Monteiro-Ferreira J. Rößel-Bretschneider A. Thuillier
Unpublished D.O. thesis, 2002/10
4860

Einfluss osteopathischer Behandlungen auf Konzentrationsstörungen bei Kindern [Pilotstudie]
(Effect of osteopathic treatments on concentration disorders in children. A pilot study)
Lamberts, A.
Unpublished D.O. thesis, 2002/10
4861

Osteopathische Behandlung im Bereich des Caecums und die Wirkung auf den Rückfluss der Vena femoralis bei Patientinnen mit Venenproblemen
(Osteopathic treatment in the caecum and the effect on the reflux of the femoral vein in patients with venous problems)
Ritter-Kleinhans, M.
Unpublished D.O. thesis, 2002/10
4862

Die therapeutische Wirksamkeit einer osteopathischen Behandlung beim Reizdarmsyndrom: Eine randomisierte kontrollierte Studie
(Osteopathy as a promising short-term strategy for irritable bowel syndrome: randomized controlled trial)
Müller, A., Salomon, J., Stiedl, M.
Unpublished D.O. thesis, 2002/10
4863

Einfluss osteopathischer Techniken auf den Heilungsverlauf einer Hüftreifestörung (Dysplasie) im Säuglingsalter
(Influence of osteopathic techniques on the healing process of a hip maturation disorder (dysplasia) in infancy)
Remmele, R., Weiss, R.
Unpublished D.O. thesis, 2002/10
4864

Stellt die osteopathische Therapie bei der chronischer Tubenbelüftungsstörung von Kindern eine Alternative zur üblichen chirurgischen Behandlung dar? [Pilotstudie]
(Is osteopathic therapy an alternative to standard surgical treatment for chronic impaired tubal ventilation in children? A pilot study.)
Schiefer, B., Weis-Ayari, M.
Unpublished D.O. thesis, 2002/10
4865

An investigation into the electrical activity of tender, resting paraspinal muscles using surface electromyography: a pilot study
Hubbard, A., Fryer, G., Ball, K. T.
Journal of Osteopathic Medicine, 2002/10
4866

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text
4867

Conditions and diagnoses for which osteopathic primary care physicians and specialists use osteopathic manipulative treatment
Johnson, S. M., Kurtz, M. E.
The Journal of the American Osteopathic Association, 2002/10
Free full text
4868

A critical appraisal of an article comparing the effectiveness of osteopathic manipulation and chemonucleolysis in the management of symptomatic lumbar disc herniation
Legge, D.
Journal of Osteopathic Medicine, 2002/10
4869

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10
4870

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10
4871

A retrospective case report of symphysis pubis dysfunction in a pregnant woman
Cassidy, I., Jones, C.
Journal of Osteopathic Medicine, 2002/10
4872

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text
4873

Re: Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
McGovern, J. J., McGovern, R. J., Lemley, W. W.
The AAO Journal, 2002/09
Free full text
4874

Post-traumatic Headache of Cervical Origin
Mitra, M. M., Stoll, S. T.
The AAO Journal, 2002/09
Free full text
4875

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text
4876

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text
4877

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text
4878

Rating interest in clinical research among osteopathic medical students
Licciardone, J. C., Fulda, K. G., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/08
Free full text
4879

A retrospective study of cranial strain patterns in patients with idiopathic Parkinson's disease
Rivera-Martinez, S., Wells, M. R., Capobianco, J. D.
The Journal of the American Osteopathic Association, 2002/08
Free full text
4880

Osteopathy in pregnancy and childbirth. Interview by Jenny Green
Sandler, S., Korth, S.
The Practising Midwife, 2002/07
4881

Quantifiable effects of osteopathic manipulative techniques on patients with chronic asthma
Bockenhauer, S. E., Julliard, K. N., Lo, K. S., Huang, E., Sheth, A. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4882

Good guys and practice guidelines: osteopathic medicine's role
Harper, D. L.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4883

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4884

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text
4885

Therapeutische Ergebnisse mit der Muscle energy technique nach Mitchel beim Bandscheibenvorfall der Lendenwirbelsäule
(Results after treatment with Mitchel's muscle energy technique in disk prolapse in the lumbar spine)
Hack, A.
Manuelle Medizin, 2002/06
4886

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text
4887

A Discussion of Spirituality and the Teaching of Spirituality in an Osteopathic Medical Curriculum
Lemley, W. W.
The AAO Journal, 2002/06
Free full text
4888

DO questions need for proposed new tenets of osteopathic medicine
Clark, R. C.
The Journal of the American Osteopathic Association, 2002/06
Free full text
4889

Osteopathic manipulative treatment in conjunction with medication relieves pain associated with fibromyalgia syndrome: results of a randomized clinical pilot project
Gamber, R. G., Shores, J. H., Russo, D. P., Jimenez, C., Rubin, B. R.
The Journal of the American Osteopathic Association, 2002/06
Free full text
4890

Mechanisms and effects of spinal high-velocity, low-amplitude thrust manipulation: previous theories
Evans, D. W.
Journal of Manipulative and Physiological Therapeutics, 2002/05
4891

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text
4892

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4893

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4894

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4895

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4896

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text
4897

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04
4898

In response
Sanders, G.
Journal of Osteopathic Medicine, 2002/04
4899

Student and patient perspectives on the interaction between supervisors, students and patients during the clinical teaching experience at a university out-patient clinic: a descriptive pilot study
Robertson, A., Gibbons, P., Carter, A.
Journal of Osteopathic Medicine, 2002/04
4900

Unity between osteopathic and allopathic medicine only answer to preserving osteopathic uniqueness
Wagner, E. E.
The Journal of the American Osteopathic Association, 2002/04
Free full text
4901

Editorial
Lucas, N., Moran, R.
Journal of Osteopathic Medicine, 2002/04
4902

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03
4903

Unrelenting Abdominal Pain of Elusive Origin: A Case Study
Chapello, I. A., Templin, M. A.
The AAO Journal, 2002/03
Free full text
4904

Search Words: Osteopath, Osteopathy, Osteopathic
Chila, A. G.
The AAO Journal, 2002/03
Free full text
4905

Osteopathy: A Noun Not Just An Adjective
Habenicht, A. L.
The AAO Journal, 2002/03
Free full text
4906

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text
4907

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text
4908

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text
4909

Osteopathic philosophy must be the foundation of osteopathic medical education
Beals-Becker, L.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4910

Quality of life in referred patients presenting to a specialty clinic for osteopathic manipulative treatment
Licciardone, J. C., Gamber, R. G., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4911

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4912

Need for objective measures to prove clinical outcome
Oleski, S. L., Kim, M. D.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4913

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text
4914

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02
4915

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text
4916

Interexaminer reliability and cranial osteopathy
Hartman, S. E., Norton, J. M.
The Scientific Review of Alternative Medicine, 2002/01
4917

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text
4918

An Investigation into the Efficacy of an Osteopathic/Naturopathic Treatment Regime on the Symptoms of Irritable Bowel Syndrome
Mitchell, S.
Unpublished Dissertation, 2002/01
4919

Osteopathic philosophy in comparison with other spiritual philosophical sytems
Feiel-Schmidt, G.
Unpublished MSc thesis, 2002/01
Free full text
4920

An alert regarding Canada's financial aid for an osteopathic medical education
Campbell, A.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4921

End-of-life care focus critical to a complete medical education
Gaber, R.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4922

Patient satisfaction and clinical outcomes associated with osteopathic manipulative treatment
Licciardone, J., Gamber, R., Cardarelli, K.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4923

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text
4924

Osteopathic approach may be helpful in war on terrorism
Rogers, F. J.
The Journal of the American Osteopathic Association, 2002/01
Free full text
4925

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4926

Introduction to the Texas College of Osteopathic Medicine at the University of North Texas Health Science Center at Fort Worth
Aylett, K., Squires, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4927

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4928

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text
4929

Is there any osteopathy in the specialty training of osteopathic residents?
Glover, J. C.
The AAO Journal, 2001/12
Free full text
4930

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4931

Pre-Doctoral Fellowship Program in the Osteopathic Manipulative Medicine Program at the Texas College of Osteopathic Medicine
Slicho, T., Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4932

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4933

Research Accomplishments of the Department of Osteopathic Manipulative Medicine of the Texas College of Osteopathic Medicine
Stoll, S. T.
The AAO Journal, 2001/12
Free full text
4934

Neuromusculoskeletal Medicine and Osteopathic Manipulative Treatment Residency Programs at the Osteopathic Medical Center of Texas
Stoll, S. T., Carnes, M., Brooks, L.
The AAO Journal, 2001/12
Free full text
4935

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4936

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4937

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4938

A Fact: The Medical Industry Doesn't Support Hands-On CME!
Noone, S. J.
The AAO Journal, 2001/12
Free full text
4939

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text
4940

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text
4941

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text
4942

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text
4943

Effektivität einer osteopathischen Behandlung bei chronischem Knieschmerz
(Effectiveness of an osteopathic treatment in patients with chronic knee pain)
Bachem, U., Salzmann, S., Schwartz, I.
Unpublished D.O. thesis, 2001/10
4944

Systematische Untersuchung osteopathischer Befunde bei primärer Dysmenorrhoe
(Systematic study of osteopathic findings in primary dysmenorrhea)
Hellmann, C.
Unpublished D.O. thesis, 2001/10
4945

Hands on care
Turney, J.
Nursing Standard, 2001/10
4946

Mobilization with movement applied to the elbow affects shoulder range of movement in subjects with lateral epicondylalgia
Abbott, J. H.
Journal of Osteopathic Medicine, 2001/10
4947

The initial effects of an elbow mobilization with movement technique on grip strength in subjects with lateral epicondylalgia
Abbott, J. H., Patla, C. E., Jensen, R. H.
Journal of Osteopathic Medicine, 2001/10
4948

Short-term effects of cervical manipulation on edge light pupil cycle time: a pilot study
Gibbons, P., Gosling, C. M., Holmes, M.
Journal of Osteopathic Medicine, 2001/10
4949

Thoracic spine dysfunction in upper extremity complex regional pain syndrome type I
Menck, J. Y., Requejo, S. M., Kulik, K.
Journal of Osteopathic Medicine, 2001/10
4950

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10
4951

Erstellen eines Methodenhandbuchs: Die Evaluation des Faktors „Kosten” bei vergleichenden Studien in der Osteopathie
(To compile of a method manual: The evaluation of the factor “cost“ in comparative studies in osteopathy.)
Schrauder, A.
Unpublished D.O. thesis, 2001/10
4952

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text
4953

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10
4954

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10
4955

Efficacy of spinal manipulation for chronic headache: A systematic review
Bronfort, G.
Journal of Manipulative and Physiological Therapeutics, 2001/09
4956

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09
4957

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4958

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4959

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4960

Has our profession become its own worst enemy?
Fettig, L. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4961

Adjunctive osteopathic manipulative treatment in women with depression: a pilot study
Plotkin, B. J., Rodos, J. J., Kappler, R., Schrage, M., Freydl, K., Hasegawa, S., Hennegan, E., Hilchie-Schmidt, C., Hines, D., Iwata, J., Mok, C., Raffaelli, D.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4962

Osteopathic manipulative treatment of low back pain during labor
Carpenter, S., Woolley, A.
The AAO Journal, 2001/09
4963

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text
4964

More on allopathic medical credentialing
Allee, B. A.
The Journal of the American Osteopathic Association, 2001/08
Free full text
4965

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text
4966

Diminished use of osteopathic manipulative treatment and its impact on the uniqueness of the osteopathic profession
Johnson, S. M., Kurtz, M. E.
Academic Medicine, 2001/08
Free full text
4967

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4968

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4969

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4970

Characteristics, satisfaction, and perceptions of patients receiving ambulatory healthcare from osteopathic physicians: a comparative national survey
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4971

Applications of manipulative techniques
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text
4972

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text
4973

Beschwerden der oberen Wirbelsäule. Teil 3: Behandlungsergebnisse mit der Muscle energy Technique nach Mitchel bei Beschwerden, die von der oberen Wirbelsaule ausgehen
(Symptoms originating from the upper spine. Part 3: Results of Mitchel's Muscle Energy Technique in symptoms originating from the upper spine)
Hack, A.
Manuelle Medizin, 2001/06
4974

DOs question intent of challenge
Zorski, K. C., Woeller, K. N., Galin, C. M., Nani, S., Myers, G. P., Greenfield, J. R., Sendzicki, B., Haltof, A. H.
The Journal of the American Osteopathic Association, 2001/06
Free full text
4975

Sinusitis in children: the importance of diagnosis and treatment
Shrum, K. M., Grogg, S. E., Barton, P., Shaw, H. H., Dyer, R. R.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4976

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4977

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4978

Letter that questions OCF requires no response
MacDonald, R. C.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4979

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text
4980

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text
4981

Pain management in osteopathic medicine: The efficacy of flotation REST as an adjunct to spinal manipulation for acute non-specific low back pain. A case report
Rogan, A., Morris, T., Gibbons, P.
Journal of Osteopathic Medicine, 2001/04
4982

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
4983

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text
4984

The decrease of the cranial rhythmic impulse during maximal physical exertion: an argument for the hypothesis of venomotion?
Farasyn, A., Vanderschueren, F.
Journal of Osteopathic Medicine, 2001/04
4985

The Interdisciplinary Generalist Curriculum Project at Nova Southeastern University College of Osteopathic Medicine
Blavo, C., Steinkohl, D. C.
Academic Medicine, 2001/04
Free full text
4986

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text
4987

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text
4988

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text
4989

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text
4990

Going global with osteopathic medicine
Smith, D. A.
The Journal of the American Osteopathic Association, 2001/03
Free full text
4991

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03
4992

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4993

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4994

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text
4995

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text
4996

Snapshot Survey
General Osteopathic Council, 2001
Free full text
4997

Osteopathic medicine in the treatment of low back pain
Newswanger, D. L., Patel, A. T., Ogle, A.
American Family Physician, 2000/12
Free full text
4998

Shortness of breath and hypoxia following exploratory laparotomy
Ettlinger, H. M.
The AAO Journal, 2000/12
Free full text
4999

A practitioner survey of osteopathic manipulative treatment (OMT) techniques for specific body regions
Song, S. H.
The AAO Journal, 2000/12
Free full text
5000

Low back pain: Cost and treatment
Swords, W. J.
The AAO Journal, 2000/12
Free full text
5001

Benefits of osteopathic manipulative treatment for hospitalized elderly patients with pneumonia
Noll, D. R., Shores, J. H., Gamber, R. G., Herron, K. M., Swift, J.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5002

Questioning of OCF should rouse osteopathic response
Norton, J. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5003

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text
5004

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5005

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5006

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5007

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11
5008

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5009

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5010

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5011

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5012

Enrollment management strategies and practices at colleges of osteopathic medicine
Guidry, B. S.
Unpublished Dissertation, 2000/11
5013

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5014

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text
5015

Galbreath technique: a manipulative treatment for otitis media revisited
Pratt-Harrington, D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5016

Osteopathic Treatment of Idiopathic Scoliosis with Emphasis on the Fascial System
Mandl-Weber, U.
Unpublished MSc thesis, 2000/10
5017

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text
5018

Schließung und Mobilität der Synchondrosis sphenobasilaris
(Closure and mobility of the spheno-occipital synchondrosis)
Schalkhaußer, A.
Unpublished D.O. thesis, 2000/10
5019

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5020

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5021

Individualizing treatment plan and combining approaches key to pain management and holistic care: a student's perspective
Lawlor, T. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text
5022

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10
5023

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5024

Osteopathy and heavy metals- demonstrated by copper secretion in urine
Wutzl, C.
Unpublished MSc thesis, 2000/09
5025

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text
5026

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5027

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text
5028

How effective is the expansion of the third ventricle (E. V. III) in its influence on the neuroendocrine system?
Burjan-Lang, E.
Unpublished MSc thesis, 2000/09
5029

Effects of a structured curriculum in osteopathic manipulative treatment (OMT) on osteopathic structural examinations and use of OMT for hospitalized patients
Shubrook, J. H., Jr., Dooley
The Journal of the American Osteopathic Association, 2000/09
Free full text
5030

Patients' satisfaction with osteopathic and GP management of low back pain in the same surgery
Pincus, T., Vogel, S., Savage, R., Newman, S.
Complementary Therapies in Medicine, 2000/09
5031

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09
5032

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08
5033

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5034

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5035

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text
5036

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5037

Use of a computer-assisted clinical case (CACC) SOAP note exercise to assess students' application of osteopathic principles and practice
Chamberlain, N. R., Yates, H. A.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5038

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text
5039

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5040

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06
5041

Osteopathic manipulative treatment and Down syndrome
Funk, S. L.
The AAO Journal, 2000/06
Free full text
5042

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text
5043

Osteopathic manipulative treatment in prenatal care: Evidence supporting improved outcomes and health policy implications
King, H. H.
The AAO Journal, 2000/06
Free full text
5044

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5045

Another great article on osteopathic manipulative treatment
Zorski, K. C.
The Journal of the American Osteopathic Association, 2000/06
Free full text
5046

Letters to the Editor
Cummings, C. H., Norton, J. M., Nelson, K. E.
The AAO Journal, 2000/06
Free full text
5047

Single-blind randomised controlled trial of chemonucleolysis and manipulation in the treatment of symptomatic lumbar disc herniation
Burton, A. K., Tillotson, K. M., Cleary, J.
European Spine Journal, 2000/06
5048

Progressive inhibition of neuromuscular structures (PINS) technique
Dowling, D. J.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5049

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05
5050

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5051

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text
5052

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text
5053

National study of the impact of managed care on osteopathic physicians
Horan, J.
The Journal of the American Osteopathic Association, 2000/04
Free full text
5054

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04
5055

Osteopathic treatment of low back pain
Sweetman, B. J.
The New England Journal of Medicine, 2000/03
5056

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text
5057

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text
5058

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text
5059

Brain Wave Pattern Changes in Children with ADD/ADHD following Osteopathic Manipulation: A Pilot Study
Blood, S. D., Hurwitz, B. A.
The AAO Journal, 2000/03
Free full text
5060

Case Study: OMT and Chronic Cephalgia
Brown, C. S.
The AAO Journal, 2000/03
Free full text
5061

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text
5062

Lift Treatment in Naval Special Warfare (NSW) Personnel: A Retrospective Study
Lipton, J. A., Brooks, J. S., Hickey, M. J., Drew, B. G., Eggleston, M. T., Gemmer, C. H.
The AAO Journal, 2000/03
Free full text
5063

Case Study of a 42-year-old patient with Systemic Lupus Erythematosus
Zucker, N.
The AAO Journal, 2000/03
Free full text
5064

Refractory torticollis after a fall
Kaprow, M. G., Sandhouse, M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
5065

Multiple sclerosis article ignores conventional and osteopathic treatment options
Schreier, E. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text
5066

Research on OPP/OMT is Critical to the Profession's Future
Noone, S. J.
The AAO Journal, 2000/03
Free full text
5067

Letters to the Editor
Friedman, H. D., McMillin, D. L., Richards, D. G., Mein, E. A., Nelson, C. D., Kellam, R. T., Patriquin, D. A., Clark, R. C.
The AAO Journal, 2000/03
Free full text
5068

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03
5069

Osteopathic treatment of low back pain
Cherkin, D.
The New England Journal of Medicine, 2000/03
5070

Osteopathic treatment of low back pain
Foster, D., Johnson, M. D., Harrelson, A.
The New England Journal of Medicine, 2000/03
5071

Osteopathic treatment of low back pain
Oppenheim, J. S.
The New England Journal of Medicine, 2000/03
5072

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
5073

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02
5074

Inter-examiner and intra-examiner agreement for assessing sacroiliac anatomical landmarks using palpation and observation: pilot study
O'Haire, C., Gibbons, P.
Manual Therapy, 2000/02
5075

Importance of empiricism in medicine
Hartman, S. E.
The Journal of the American Osteopathic Association, 2000/02
Free full text
5076

Paradox answered
Parker, C.
The Journal of the American Osteopathic Association, 2000/02
Free full text
5077

Physician recalls unforgettable evening in her early career
Wales, A. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text
5078

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02
5079

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01
5080

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text
5081

Craniosacral therapy in pediatric occupational therapy
Herman-Rosen, S. A., Kohn-Dembitzer, R.
Unpublished MSc thesis, 2000/01
5082

Take the time to teach to ensure the legacy and future of our profession
Steier, K. J.
Journal of Osteopathic Medicine, 1999/12
Free full text
5083

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12
5084

Importance of OMT cannot be overemphasized
Abend, D. S.
Journal of Osteopathic Medicine, 1999/12
Free full text
5085

Evaluierung und kritische Bewertung von in der europaischen Literatur veroffentlichten, osteopathischen Studien im klinischen Bereich und im Bereich der Grundlagenforschung.
(Evaluation and critical review published in the European literature on osteopathic studies in the clinical field and in the area of fundamental research)
Schwerla, F., Hass-Degg, K., Schwerla, B.
Forschende Komplementärmedizin, 1999/12
5086

Assessing the impact of complementary therapy on health status: a service evaluation of the benefits of acupuncture, homoeopathy and osteopathy using the SF-36 health survey and a waiting list control group
Richardson, J.
Unpublished PhD thesis, 1999/12
Free full text
5087

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11
5088

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text
5089

A comparison of osteopathic spinal manipulation with standard care for patients with low back pain
Andersson, G. B., Lucente, T., Davis, A. M., Kappler, R. E., Lipton, J. A., Leurgans, S.
The New England Journal of Medicine, 1999/11
Free full text
5090

New hypothesis for the origin of cranio-sacral motion
Farasyn, A.
Journal of Bodywork and Movement Therapies, 1999/10/01/
5091

ABC of complementary medicine. The manipulative therapies: osteopathy and chiropractic
Vickers, A., Zollman, C.
The BMJ, 1999/10
5092

Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
(Inter rater reliability of the Downing test regarding leg length discrepancy)
Hösele, K.
Unpublished D.O. thesis, 1999/10
5093

Osteopathic unity must continue
Ross, K. E.
Journal of Osteopathic Medicine, 1999/10
Free full text
5094

Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
(Intracranial membrane tension release of children with hyperactive disorder)
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
5095

(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Osteopathische Behandlung der chronischen Lumbalgie
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
5096

(Inter rater reliability of the Downing test regarding leg length discrepancy)
Interrater Zuverlässigkeit des Beinlängentests und des Downing Test
Hösele, K.
Unpublished D.O. thesis, 1999/10
5097

(Intracranial membrane tension release of children with hyperactive disorder)
Die Entspannung der intracranialen Membranen bei Kindern mit hyperaktivem Verhaltenssyndrom
Röh, N., Rütz, M.
Unpublished D.O. thesis, 1999/10
5098

Osteopathische Behandlung der chronischen Lumbalgie
(Osteopathic treatment of chronic low back pain. A randomized controlled trial)
Adorjàn-Schaumann, A., Höhrhan, G., Wille, H., Wolff, A.
Unpublished D.O. thesis, 1999/10
5099

DOs need more training in diagnosing and treating addiction
Goldstein, F. J.
Journal of Osteopathic Medicine, 1999/09
Free full text
5100

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text
5101

Osteopathic medical education in the 21st century--translating educational challenges into professional opportunities
Kasovac, M.
Journal of Osteopathic Medicine, 1999/08
Free full text
5102

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text
5103

Remember the DO difference
Rossi, P. C.
Journal of Osteopathic Medicine, 1999/07
Free full text
5104

Training osteopathic geriatric academicians: impact of a model geriatric residency program
Cavalieri, T. A., Basehore, P., Perweiler, E., Chopra, A.
Journal of Osteopathic Medicine, 1999/07
Free full text
5105

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text
5106

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text
5107

DO's approach to patient is 'wholistic'--not holistic
Gotfried, R.
Journal of Osteopathic Medicine, 1999/05
Free full text
5108

The Effectiveness of CV-4 and Resting Position Techniques on Subjects with Tension-Type Headaches
Hanten, William P., Olson, Sharon L., Hodson, Jennifer L., Imler, Vickie L., Knab, Virginia M., Magee, Jennifer L.
Journal of Manual & Manipulative Therapy, 1999/04/01
5109

Support programs for minority students at Ohio University College of Osteopathic Medicine
Thompson, H. C., Weiser, M. A.
Academic Medicine, 1999/04
5110

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text
5111

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text
5112

1998 Louisa Burns Memorial Lecture: can teaching and research coexist?
Yorio, T.
Journal of Osteopathic Medicine, 1999/03
Free full text
5113

Adjunctive osteopathic manipulative treatment in the elderly hospitalized with pneumonia: a pilot study
Noll, D. R., Shores, J., Bryman, P. N., Masterson, E. V.
Journal of Osteopathic Medicine, 1999/03
Free full text
5114

Chiropractic and osteopathic education at Royal Melbourne Institute of Technology. A student perspective
French, S. D., Marshall, S. J., Webb, M., Tucker, C.
Australasian Chiropractic & Osteopathy, 1999/03
Free full text
5115

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text
5116

Seize opportunity to foster osteopathic pride
Bahrami, P.
Journal of Osteopathic Medicine, 1999/03
Free full text
5117

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text
5118

Time to tell the world about osteopathic medicine
Oliveri, E. A., Osborn, G. C.
Journal of Osteopathic Medicine, 1999/02
Free full text
5119

Revisiting the role of osteopathic manipulation in primary care
Hopp, R. J.
Journal of Osteopathic Medicine, 1999/02
Free full text
5120

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text
5121

Comparison of the scope of allopathic and osteopathic medical school health promotion programs for students
Hooper, J., Cox, C. C., Cambre, K., Wilburn, D., Webster, M., Wolf, T.
American Journal of Health Promotion, 1999/01
5122

Widespread confusion prevails over 'osteopathy'
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/12
Free full text
5123

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament
Sucher, B. M., Hinrichs, R. N.
Journal of Osteopathic Medicine, 1998/12
Free full text
5124

The evolution of professional identity: the case of osteopathic medicine
Miller, K.
Social Science & Medicine, 1998/12
5125

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text
5126

AOA continuing medical education
Rodgers, D. J.
Journal of Osteopathic Medicine, 1998/11
Free full text
5127

Osteopathic graduate medical education
Swallow, C. S., Bronersky, V. M., Falbo, P. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
5128

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
5129

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text
5130

Osteopathic medical education in 1998 prepares for the future
Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
5131

Research programs of the AOA and their role in osteopathic medical education
McGill, S. L., Retz, K. C.
Journal of Osteopathic Medicine, 1998/11
Free full text
5132

Income and expenditures of osteopathic medical colleges
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text
5133

Dual approval of a residency program: ten years' experience and implications for postdoctoral training
Hayes, O. W.
Journal of Osteopathic Medicine, 1998/11
Free full text
5134

Comparison of personality styles between students enrolled in osteopathic medical, pharmacy, physical therapy, physician assistant, and occupational therapy programs
Hardigan, P. C., Cohen, S. R.
Journal of Osteopathic Medicine, 1998/11
Free full text
5135

Undergraduate osteopathic medical education
Kowert, C.
Journal of Osteopathic Medicine, 1998/11
Free full text
5136

Evaluierung und kritische Bewertung von Studien der Osteopathie im klinischen Bereich und im Bereich der Grundlagenforschung in der europäischen Literatur
(Evaluation and Critical Review of Clinical and Fundamental Research Studies on Osteopathy Published in the European Literature)
Schwerla, B., Hass-Degg, F., Schwerla, F.
Unpublished D.O. thesis, 1998/10
5137

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text
5138

Die osteopathische Behandlung für Kinder mit Down-Syndrom mit Schwerpunkt auf dem Os Occipitale
(The osteopathic treatment for children with Down syndrome with emphasis on the Os Occipitale)
Kasack, A.
Unpublished D.O. thesis, 1998/10
5139

Sinusitus Supplement missing osteopathic component
Dudley, G.
Journal of Osteopathic Medicine, 1998/10
5140

Correction to 'professional identity' article
Tettambel, M. A.
Journal of Osteopathic Medicine, 1998/09
Free full text
5141

Key to our survival lies in honesty
Olson, C. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
5142

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09
5143

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09
5144

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09
5145

Alternative therapies and complementary medicine: a mutiny in the making
Friedman, H. D.
Journal of Osteopathic Medicine, 1998/09
Free full text
5146

An 'apples-to-apples' comparison of training hours for DOs, PAs, NPs
Truthan, C. E.
Journal of Osteopathic Medicine, 1998/08
Free full text
5147

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text
5148

Study of attitudes and beliefs about obesity on second and third year osteopathic medical students
Bradley, C. A.
Unpublished MSc thesis, 1998/08
Free full text
5149

Environmental factors promoting the effective use of a computer-assisted clinical case for second-year osteopathic medical students
Baer, R. W., Chamberlain, N. R.
Journal of Osteopathic Medicine, 1998/07
Free full text
5150

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06
5151

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05
5152

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05
5153

Are D.O.s losing their unique identity?
Guglielmo, W. J.
Medical Economics, 1998/04
5154

Coming full circle: osteopathic manipulative treatment and immunity
Allen, T. W.
Journal of Osteopathic Medicine, 1998/04
5155

Partners for two decades: AOA and the National High Blood Pressure Education Program
Nickey, W. A., Lenfant, C.
Journal of Osteopathic Medicine, 1998/03
5156

Effect of lymphatic and splenic pump techniques on the antibody response to hepatitis B vaccine: a pilot study
Jackson, K. M., Steele, T. F., Dugan, E. P., Kukulka, G., Blue, W., Roberts, A.
Journal of Osteopathic Medicine, 1998/03
5157

Communication for osteopathic manipulative treatment (OMT): the language of lived experience in OMT pedagogy
Gaines, E., Chila, A. G.
Journal of Osteopathic Medicine, 1998/03
5158

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02
5159

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02
5160

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02
5161

Osteopathic versus allopathic care
Wakham, M.
Hospital Practice, 1998/01
5162

A compilation of the thoughts of George W. Northup, DO, on the philosophy of osteopathic medicine
Peterson, B.
Journal of Osteopathic Medicine, 1998/01
5163

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01
5164

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01
5165

Using heart variability to measure the effects of manual medicine on autonomic activity
Zullow, M.
Unpublished MSc thesis, 1997/10
5166

Efficacy of osteopathic manipulative treatment in improving clinical outcomes in patients with orthopedic diagnoses admitted to a hospital-based rehabilitation unit
Brittain, P. D.
Unpublished MSc thesis, 1997/06
5167

The utilization of craniosacral therapy among healthcare practitioners and its awareness among occupational therapists
Avallone, S., Belli, D.
Unpublished MSc thesis, 1997/01
5168

Predictors of Academic Difficulties of Osteopathic Medical Students in the Preclinical Curriculum
Cigelman, M. S.
Unpublished Dissertation, 1993/08
Free full text
5169

Low back pain: Evaluation of osteopathic manipulation therapy via integration and power spectrum of electromyography and psychophysical-physical analysis
Park, H. K.
Unpublished PhD thesis, 1993/01
5170

Lower back pain: Evaluation of osteopathic manipulation therapy via magnetic resonance imaging and biomechanical modeling
Sumer, A.
Unpublished PhD thesis, 1993/01
5171

The Effects of Problem-based Learning on National Board Scores, Clinical Evaluations and Residency Selection of Medical Students
Tomczak, R. L.
Unpublished Dissertation, 1991/11
Free full text
5172

The theory of reasoned action as applied to the intention to enroll in an osteopathic medical school
Burnett, P. A.
Unpublished PhD thesis, 1991/01
5173

The Historical Development of the Texas College of Osteopathic Medicine as a State Medical School, 1960-1975
Rafes, R. S.
Unpublished PhD thesis, 1990/12
Free full text
5174

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text
5175

Breastfeeding Opinions of Medical Students at the Oklahoma State University College of Osteopathic Medicine
Hoskins, J. A.
Unpublished MSc thesis, 1990/05
Free full text
5176

Low back pain: Evaluation of osteopathic manipulation therapy via biomechanical modeling, electromyography, muscle rigidity and pain quantification
Bolecek-Skeggs, C. M.
Unpublished PhD thesis, 1990/01
5177

An integrated osteopathic treatment approach in acute otitis media
Pintal, W. J., Kurtz, M. E.
The Journal of the American Osteopathic Association, 1989/09
Free full text
5178

Faculty Perception of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
5179

Faculty Perceptions of Institutional Needs and Goals in an Osteopathic Medical Education Program
Fazio, L. S.
Unpublished PhD thesis, 1984/05
Free full text
5180

Towards a conceptual framework for the continuum of clinical competence development in an undergraduate osteopathic medical education program: An exploratory study
Weaver, S. A.
Unpublished PhD thesis, 1984/01
5181

A Comparison of the Views of Chiropractors and Osteopathic Physicians in Western Oregon Regarding the Clinical Indications for and the Scientific Rationale Underlying Manipulative Treatment of the Low Back
Gordon, G. F.
Unpublished PhD thesis, 1982/01
5182

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01
5183

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12
5184

A study into the efficacy of osteopathic treatment of Irritable bowel syndrom
Brice, C., Mountford, R.
British Osteopathic Journal
 
 
 






  • Impressum • Legal notice • Datenschutz •


ostlib.de/advanced



Supported by

OSTLIB recommends