Advanced search



 
 80% of the records
 
 20.0 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumdupilumabDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

2904 results (please see below)  Sort:    
1

Journal Club 2026 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2026/03





6

Osteopathic Manipulation to Increase Lactation Quantity: The OMILQ Study Protocol
Conaway, E. M., O'Donnell, A. E.
The AAO Journal, 2026/03

7

Effects of osteopathic manipulative treatment on cardiovascular function: a systematic review and meta-analysis
Johnston, K., Chow, R., Rubinstein, M., Burtner, M., Hollander, S., Humm, A., Chen, L., DeArmond, M., Koshy-Chenthittayil, S., Hightower, C.
International Journal of Osteopathic Medicine, 2026/03

8

Setting the osteopathic research agenda: consensus, context, controversy, and capacity
Hohenschurz-Schmidt, D., Draper-Rodi, J., Thomson, O., Vaucher, P., Vogel, S.
International Journal of Osteopathic Medicine, 2026/03

9

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01

10

The Diverse Landscape of Fascial Manual Medicine
Bordoni, B.
Cureus, 2026/01
Free full text



13

A.T. Stills „Finding health …“ – Ad fontes!
Dippon, M.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01


15

Im Gespräch mit … Christian Schwartzkopf
(In dialog with Christian Schwartzkopf)
Mihajlovic, Z., Schwartzkopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01


17

Wann kann man ein Ausfallhonorar berechnen?
(When can you charge a cancellation fee?)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

18

Psychosoziale Aspekte chronischer Schmerzen aus interdisziplinärer Perspektive
Zöller, E., Feld, K.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

19

A Prospective Observational Cohort Study of a Standardized Osteopathic Maneuver for Chest Pain Relief
Gianneschi, G. B., Patel, S., Hinfey, P.
International Journal of Osteopathic Medicine, 2025/12
Free full text

20

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Sampath, K. K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/12

21

Palpation and its learning: A professionalization approach to acquiring a complex skill
Rosenzweig, F., Feruglio, R., Marin, T.
International Journal of Osteopathic Medicine, 2025/12




25

Journal Club 2025 – 3
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/12




29

Effects of Lymphatic Pump Treatment and Methotrexate in Arthritis Development and Behavior in Rats with Adjuvant-Induced Arthritis
Kafkis, C., Tamane, S., Manuel, M. J., Zanotti, B., Del Toro, R. M., Incrocci, R., Swanson-Mungerson, M., Volin, M. V.
Journal of Osteopathic Medicine, 2025/12




33

Fascial Counterstrain: A methodological advancement in indirect osteopathic manipulation
Tuckey, B.
International Journal of Osteopathic Medicine, 2025/12



36

The effect of exercise on fatigue in rheumatoid arthritis: a systematic review and meta-analysis of randomized controlled trials
Jiang, X., Yu, L., Yan, Y., Zhou, S., Zheng, Q.
International Journal of Osteopathic Medicine, 2025/12

37

Effectiveness of manual therapy vs conventional physical therapy with neuromuscular training in the management of knee osteoarthritis: A randomized clinical controlled trial
Pakkir Mohamed, S. H., Albalawi, H. F., Nambi, G., Shalabi, K. M., Albalawi, M. O.
International Journal of Osteopathic Medicine, 2025/12
Free full text

38

Gut-Brain Axis in Inflammatory Bowel Disease: Pathogenesis and Therapeutics
Perry, S., Pillarisetti, L., Gelfman, T., Agrawal, D. K.
Archives of Internal Medicine Research, 2025/12
Free full text


40

Original Thoughts on Cranial History and Glymphatics
Laughlin, P.
The AAO Journal, 2025/12

41

Autonomic Rehabilitation: Cardiovagal and Autonomic Impacts of Post Isometric Muscle Energy at the Upper Cervical Spine
Miller, A., Curran, C., Fanous, S., Nakashima, T., Yates, H., Johns, J., Fotopoulos, T., Gustin, D., Wilson, J., McAllister, J., Moon, J., Thornburgh, K., Wenner, A., Garg, R., Gharbo, R.
The AAO Journal, 2025/12

42

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12



45

Identifying somatic and social concerns that may suggest an underlying mental health condition in pediatric primary care
Shubrook, C., Breneisen, K., Pottenger, M.
Journal of Osteopathic Medicine, 2025/11
Free full text

46

Emergency department wait times in concordance with blood alcohol content and subsequent alcohol use disorder
Hayes, S., Mach, K., Briggs, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/11
Free full text

47

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11

48

Artificial intelligence and osteopathic medicine: preserving human-centered care in an era of technological advancement
Newhardt, R., O'Connell, M., Lin, M. S., Bray, N. N.
Journal of Osteopathic Medicine, 2025/10
Free full text

49

Diaphragm’s Role as a Systems-Connector Muscle: A Narrative Review
Bordoni, B., Morabito, B., Escher, A. R.
Cureus, 2025/10
Free full text

50

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10


52

Effect of osteopathic manipulative treatment on pain, flexibility, autonomic modulation of heart rate, energy and thermal profile in patients with chronic low back pain. blind randomized clinical trial
Hartz, C. S., Almeida de Molon Mendes, M., Buck, K. H., Moreno, M. A., Bortolazzo, G. L.
Journal of Bodywork and Movement Therapies, 2025/10

53

Effects of osteopathic manipulative treatment on autonomic nervous system of a child in complete retinoblastoma remission: a case report
Lorenzetti, S., Tarantino, A., Buffone, F., Tabbi, C., Dal Farra, F., Bergna, A., Parii, A., Vismara, L.
Journal of Bodywork and Movement Therapies, 2025/10

54

Dr. William Garner Sutherland (1873-1954): A Pioneer in Cranial Osteopathy
Griswold, S. R., Brask, A. S., Bhakta, K. D., Campbell, A. M., Smith-Gonzalez, A. R.
Cureus, 2025/10
Free full text

55

The Spinal Facilitation Hypothesis and Reflex Arcs in Modern Osteopathic Medicine
Bordoni, B., Simonelli, M., Morabito, B., Escher, A. R.
Cureus, 2025/09
Free full text

56


57

Funktionelle Suturenbögen
(Functional suture loops)
Kamp, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/09


59

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text

60

The Use of OMT in the Emergency Department: A Scoping Review
Nemes, P.
Spartan Medical Research Journal, 2025/09


62

Use of a community care coordination team to reduce emergency department utilization and hospital readmissions for the highest utilizers
Shipman, S., Painter, K., Epperson, L. C., Smith, K.
Journal of Osteopathic Medicine, 2025/09
Free full text

63

Osteopathy Educators’ and Researchers’ Perspectives on Artificial Intelligence in Academia: A Cross-Sectional Study
Mhadhbi, H., Draper-Rodi, J., Consorti, G., Antunes Ferreira, A. P., Horta, L. M., Rinne, S., Vaucher, P., Ménard, M.
International Journal of Osteopathic Medicine, 2025/09

64

Profiling Osteopathy in New Zealand: Insights into Practitioner Engagement with Accident Compensation Corporation (ACC) and Musculoskeletal (MSK) Care
Kovanur Sampath, K., Berg, N., Paine, J. L., Orrock, P., Standen, C.
International Journal of Osteopathic Medicine, 2025/09

65

Understanding specific, contextual and non-specific effects in osteopathy
Tripodi, N., Lawton, A., Corcoran, D., Feehan, J.
International Journal of Osteopathic Medicine, 2025/09
Free full text

66

Development of a research mentorship program for Australian osteopaths
Eaves, S., Steel, A.
International Journal of Osteopathic Medicine, 2025/09


68

Journal Club 2025 – 2
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/09






74

Acute Effects of Osteopathic Treatment in Long COVID-19 Patients with Fatigue Symptoms: A Randomized, Controlled Trial
Zissler, U. M., Poehlmann, T., Gloeckl, R., Ibrahim, S., Klupsch, K., Schneeberger, T., Jarosch, I., Koczulla, A. R.
Journal of Clinical Medicine, 2025/08
Free full text

75

The hospitalist’s paradox: on pay, perception, and the true value of a healer in the valley of the sun
MacDonald, G. P.
Journal of Osteopathic Medicine, 2025/08
Free full text

76

Impact of osteopathic tests on heart rate and heart rate variability: an observational study on osteopathic students
Gillet, F., Gault, M., Dussault, V., Cheggour, S., Grinand, M., Martinez, P.
Journal of Osteopathic Medicine, 2025/08
Free full text

77

Private equity in healthcare: implications and policy recommendations
Jestin, M.
Journal of Osteopathic Medicine, 2025/07
Free full text


79

Wurzel mit Riechfunktion
(Root with olfactory function)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/07


81

Patience in Practice: A Nonoperative Approach to Osteochondritis Dissecans
Rodas, A. W., Gupta, P., Pan, K., Rule, R., Goddard, M.
Cureus, 2025/07
Free full text

82

The mechanism of muscle energy for a superiorly subluxed rib one
Teixeira, K., Russell, N., Huzij, T.
Journal of Osteopathic Medicine, 2025/07
Free full text

83

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07

84

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text




88

Journal Club 2025 – 1
Franke, H., Engel, M., Rotter, G.
Osteopathische Medizin, 2025/06


90

Osteopathic approach to injuries of the overhead thrower’s shoulder
De Luigi, A. J., Raum, G. M., King, B. W., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/06
Free full text


92

Prone Still Technique for an Upslipped Innominate
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06

93

Combined Myofascial Technique for a Second Posterior Sacral Segment Dysfunction
Stellon, A. G., Rudberg-Post, L. J., Gustafson, H. C., Hartwell, L. E., Matz, O. C., Woolley, A. L.
The AAO Journal, 2025/06

94

Management of endometriosis: a call to multidisciplinary approach
Duncan, J.M., Delara, R., Ranieri, G., Wasson, M.
Journal of Osteopathic Medicine, 2025/06
Free full text


96

Evaluating the Efficacy of AI Note-Taking Software in Documenting Osteopathic Manipulative Medicine Treatment Encounters
Milius, M., Jurges, T., Pentlarge, J., Gabriel, D., Yang, N., Yadalla, S., Siddiqui, S., Bills, K., Barnhurst, N.
The AAO Journal, 2025/06

97

Osteopathic Manipulative Treatment For Postoperative Arthritis Following Midfoot Arthrodesis: A Case Report
Moe, B. M., Aldridge, A. F., Rich, E. D., Bardowell, A.
The AAO Journal, 2025/06


99

Osteoevidence: A User-Centric Database for Advancing Osteopathic Manipulative Medicine
Pollesel, A., Pollesel, G., Petrulaityte, A.
Medical Reference Services Quarterly, 2025/06


101

Integrative medicine
(Интегративная медицина)
Shabrov, A. V., Mokhov, D. E., Tregubova, E. S., Korotkov, K. G., Moiseev, V. I., Partsernyak, S. A.
Russian Osteopathic Journal, 2025/06



104

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06

105

Leadership and Capacity Building in International Osteopathic Research: introducing Strengthening Osteopathy Leadership and Research (SOLAR) Program
McIntyre, C., McLeod, G. A., Antunes Ferreira, A. P., Cerritelli, F., Draper-Rodi, J., Feehan, J., Fleischmann, M., Sampath, K. K., Morin, C., Muddle, L., Sinderholm Sposato, N., Thomson, O. P., Treffel, L., Tripodi, N., Vaughan, B., Steel, A., Adams, J.
International Journal of Osteopathic Medicine, 2025/06
Free full text

106

Incidence of fall-from-height injuries and predictive factors for severity
Palacio, C., Darwish, M., Acosta, M., Bautista, R., Hovorka, M., Chen, C., Hovorka, J.
Journal of Osteopathic Medicine, 2025/05
Free full text

107

Elbow injuries in overhead throwing athletes: clinical evaluation, treatment, and osteopathic considerations
King, B. W., Raum, G. M., De Luigi, A. J., Bowers, R. L.
Journal of Osteopathic Medicine, 2025/05
Free full text

108

Improving peripheral artery disease screening and treatment: a screening, diagnosis, and treatment tool for use across multiple care settings
Rudd, K. M., Roberts, K. K., Hamilton, C. M.
Journal of Osteopathic Medicine, 2025/04
Free full text

109

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2025/04


111

Categorizing treatment mechanisms for Complementary and Integrative Musculoskeletal Interventions
Cook, C. E., Abraira, V. E., Burns, J., Degenhardt, B. F., Kawchuk, G., Keter, D., Loghmani, M. T., Reed, W. R., Winkelstein, B. A., McDevitt, A.
International Journal of Osteopathic Medicine, 2025/03


113

Context is complex: Challenges and opportunities addressing contextual factors in manual therapy mechanisms research
Keter, D. L., Esteves, J. E., Loghmani, M. T., Rossettini, G., Cook, C. E.
International Journal of Osteopathic Medicine, 2025/03

114

Advancing Equitable Osteopathic Practice: Integrating Person-Centredness & Addressing Racial Biases Through the Lens of Critical Theory
Mhadhbi, H., MacMillan, A., Draper-Rodi, J., Ménard, M., Sinderholm Sposato, N.
International Journal of Osteopathic Medicine, 2025/03

115

Autonomic rehabilitation: Vagal and sympathetic impacts of modified occipitomastoid suture V-spread
Miller, A., Gustin, D., Wilson, J., Johns, J., Burch, J., Fotopoulos, T., Garg, R., Vasauskas, A.
PM&R, 2025/03

116

The Seven Drivers of Change in Osteopathic Education
Engel, R.
International Journal of Osteopathic Medicine, 2025/03








124

The Spiritual Component Of Still's Writings
Kimberly, P. E.
The AAO Journal, 2025/03





129

Gaskell, Langley, and the “para-sympathetic“ idea
Brunet, J. F.
Elife, 2025/03
Free full text


131

Die Milz
(The Spleen)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

132

Altersbedingte Veränderungen des autonomen Nervensystems
(Age-related changes in the autonomic nervous system)
Scheuchl, F., Peuker, E.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03


134

American Osteopathic History Tour 2024: eine Reise zu den Ursprüngen der Osteopathie
Wittchow, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

135

Protecting the profession: lessons from the recent physician scandals
Kelso, R. A., Schmidt, D., McLay, C.
Journal of Osteopathic Medicine, 2025/02
Free full text

136

Dr. William Garner Sutherland (1873-1954): The Founder of Cranial Osteopathy
Childs, B., Hammes, C.
Cureus, 2025/02
Free full text

137

Impact of Osteopathic Techniques on Autonomic Regulation: A Study of Heart Rate Variability in Healthy Adults
Stępnik, J., Kędra, A., Czaprowski, D.
Medical Science Monitor, 2025/02
Free full text

138

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text

139

Vestibularsystem
(Vestibular system)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01


141

Heilungshindernisse
(Obstacles to healing)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01

142

Cochlea-Implantat-Versorgung mit besonderem Blick auf die kindliche Versorgung
Lesinski-Schiedat, A.
DO - Deutsche Zeitschrift für Osteopathie, 2025/01


144

Dr. William Garner Sutherland: The Man Who Changed Osteopathy Forever
Sharath, H. V., Phansopkar, P., Qureshi, M. I., Raghuveer, R., Kaur, G.
Cureus, 2025/01
Free full text


146

Dynamometry for the assessment of trunk muscle strength in postpartum women with pregnancy-related posterior pelvic girdle pain: A reliability study
Jafarian, F.S., Jafari-Harandi, M., Yeowell, G., Sadeghi-Demneh, E.
International Journal of Osteopathic Medicine, 2024/12

147

The rise of advanced practice provider independence bills: a misguided attempt to address the physician shortage
Bohler, F., Peters, G., Aggarwal, N., Harvey, K., Bohler, J. D.
Journal of Osteopathic Medicine, 2024/12
Free full text

148

Assessing osteoporosis screening compliance in total joint surgery: a retrospective chart review
Shepard, S., Bartholomew, A., Houserman, D., Bamberger, H. B., Manocchio, A. G.
Journal of Osteopathic Medicine, 2024/12
Free full text

149

Journal Club 2024 – 1
Franke, H., Rotter, G.
Osteopathische Medizin, 2024/12





154

Strömungsdynamik in den Faszien
(Fluid dynamics in the fasciae)
Schleip, R.
Osteopathische Medizin, 2024/12


156

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12

157


158

Investigation of Suboccipital Release, Muscle Energy, and Combination Therapy, Respectively Evaluating their Effect on Carotid Artery Blood Flow: Preliminary Results
Sabbagh, M., Moriarty, S., Perera, I., Dziepak, S., Santiago, M., Peddibhotla, V., Rubis, C., Anandakrishnan, R., Rawlins, F., Brolinson, P. G.
Journal of Osteopathic Medicine, 2024/12

159

Haltung bewahren. Körperhaltung und OMT
Liem, T.
Naturheilpraxis, 2024/12


161

Prone Counterstrain Technique for a High Ilium Sacroiliac Tenderpoint
Hartwell, L. E., Gustafson, H. C., Rudberg-Post, L. J., Matz, O. C., Woolley, A. L.
The AAO Journal, 2024/12



164

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

165

The Role of Osteopathic Manipulative Treatment in Osteoarthritis: A Scoping Review
Stoll, V., Trube, J., Johnson, T., Darbhanga, J., Mehra, R. S.
Cureus, 2024/11
Free full text

166

Glenohumeral Internal Rotation Deficit in Overhead Throwing Athletes: Evidence and Perspectives of Osteopathic Manipulative Treatment
Senigagliesi, F., Scialla, S., Di Bacco, F., Marasco, M. L.
Journal of Bodywork and Movement Therapies, 2024/10


168

Osteopathic manipulation and its applicability in the emergency department: A narrative review
Pelletier, J., Capistrant, T., Nordt, S. P.
The American Journal of Emergency Medicine, 2024/10




172

Chronic pain, complexity and a suggested role for the osteopathic profession
McDonald, H. N., Lowe, T. J.
International Journal of Osteopathic Medicine, 2024/09


174

Osteopathy: A potential ally against anorexia?
Mattatia, J.
Advances in Integrative Medicine, 2024/09



177

Das Ellenbogengelenk: ein Multitalent
(The elbow joint: a multi-talent)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

178

Endometriose
(Endometriosis)
Engel-Schulmeyer, A., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

179

Typ-I-Allergien ganzheitlich behandeln
(Treating type I allergies holistically)
Hinteregger-Männel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

180

Das respiratorisch-zirkulatorische Modell in der osteopathischen Praxis
Tozzi, P.
DO - Deutsche Zeitschrift für Osteopathie, 2024/09

181

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text

182


183

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text



186

The establishment of conscientious monopolies in rural communities
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/08
Free full text

187

Effectiveness of Osteopathic Manipulative Treatment on Hemodynamic and Pulmonary Response in Coronary Artery Bypass Graft Patients: A Meta-Analysis
McGonegal, C., Bhatti, S., Carrasquillo, J., Potesta, M. A., Kavulich, J., Toldi, J.
Cureus, 2024/08
Free full text

188

Lumbar osteopathic manipulative treatment can improve KOA symptoms: short-term efficacy observation and mechanism analysis
Du, P., Li, X., Yin, S., Li, W., Sun, X., Zhang, Z., Zhao, J., Shijun, G., Du, S., Zhang, D.
Frontiers in Bioengineering and Biotechnology, 2024/08
Free full text

189

Medical malpractice liability in large language model artificial intelligence: legal review and policy recommendations
Shumway, D. O., Hartman, H. J.
Journal of Osteopathic Medicine, 2024/07
Free full text


191

The Neurophysiological Effects of Craniosacral Treatment on Heart Rate Variability: A Systematic Review of Literature and Meta-Analysis
Cook, A. C., Egli, A. E., Cohen, N. E., Bernardi, K., Chae, M. Y., Kapalko, B. A., Coyne, S. A., Scott, R.
Cureus, 2024/07
Free full text


193

Headache Treatment Options
Florczyk, S., Elliott, T., Lawrence, K., Penwell-Waines, L., Robes, C.
Journal of the American Board of Family Medicine, 2024/07
Free full text

194

The effect of non-pharmacological methods on pain in patients undergoing open heart surgery: A systematic review and meta-analysis
Yildiz, T., Oyuktaş, M., Avcu, Ç.
Turkish Journal of Thoracic and Cardiovascular Surgery, 2024/07

195


196

Leitlinien in der Osteopathie: Pro und Kontra
(Guidelines in osteopathy: Pros and cons)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07




200

Resonanz in der Osteopathie
Sonntag, M.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

201

Leitlinien in der Osteopathie: Pro und Kontra
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2024/07

202

Pseudoscience - A skeleton in osteopathy's closet?
Thomson, O. P., Martini, C.
International Journal of Osteopathic Medicine, 2024/06

203

‘It's all connected, so it all matters' - the fallacy of osteopathic anatomical possibilism
Hidalgo, D. F., MacMillan, A., Thomson, O. P.
International Journal of Osteopathic Medicine, 2024/06

204

The double facets of osteopathy's identity
L'Hermite, P.L.
International Journal of Osteopathic Medicine, 2024/06

205

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text


207

Short leg syndrome in clinical practice
(Синдром короткой ноги в клинической практике)
Frolov, V. A., Nechaev, V. I., Nechaev, E. V., Ivanov, V. V.
Russian Osteopathic Journal, 2024/06

208

Seize the Dura: An Osteopathic Approach to Postictal Delirium
Vijayakar, R., Obialo, S., Nixon, K.
The AAO Journal, 2024/06


210

Effects of OMT on Heart Rate Variability in Rats
Lobo, S., Petrillo, G., Staudt, M., Zhang, Y., Cai, W., Keys, J.
The AAO Journal, 2024/06



213

A Qualitative and Quantitative Analysis of Suboccipital Release on Heart Rate Variability
Moon, J., Fotopoulos, T. J., Gustin, D., Thornburgh, K. R., Wenner, A. R., McAllister, J. M.
The AAO Journal, 2024/06

214

Post Isometric Muscle Energy at the Cervical Spine (OA, C1, C2) Increases Vagal Tone as Quantified by Heart Rate Variability Metrics
Nakashima, T., Curran, C., Yates, H., Fanous, S., Johns, J., Fotopoulos, T. J., Miller, A.
The AAO Journal, 2024/06


216

The osteopathic concept after a century
Mackenzie, A. S.
The AAO Journal, 2024/06
Free full text

217

Osteopathic Approach to the Voice
Surve, S.
The AAO Journal, 2024/06


219

The association of folate deficiency with clinical and radiological severity of knee osteoarthritis
Abedi, M., Mollashahi Javan, H., Khosravi, A., Rohani, R., Mohammadsharifi, G.
Journal of Osteopathic Medicine, 2024/05
Free full text

220

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

221

Considerations for an Osteopathic Approach to Rheumatoid Arthritis
Averell, N., Gawash, A., Lo, D. F., Spicer, S., Al-Shehab, U.
Osteopathic Family Physician, 2024/05

222

Waste not, want not: call to action for spinal manipulative therapy researchers
Aspinall, S. L., Nim, C., Hartvigsen, J., Cook, C. E., Skillgate, E., Vogel, S., Hohenschurz-Schmidt, D., Underwood, M., Rubinstein, S. M.
Chiropractic & Manual Therapies, 2024/05


224

Colorectal Cancer Guide for Family Physicians
Raines, S. G. M., Dennison, M. A., Brondhaver, T. P., Hayes, B. M.
Osteopathic Family Physician, 2024/05

225

Telehealth in opioid use disorder treatment: policy considerations for expanding access to care
Niyibizi, A., Haveric, A., Irio, G.
Journal of Osteopathic Medicine, 2024/04
Free full text

226

Augmentation of immune response to vaccinations through osteopathic manipulative treatment: a study of procedure
Sanchez, J., Martinez, E. S., Loveless, B., Sees, J. P., Zammuto, J., Szurmant, H., Fuchs, S., Crone, P., Hostoffer, R.
Journal of Osteopathic Medicine, 2024/04
Free full text

227

The effectiveness of an osteopathic manual technique compared with a breathing exercise on vagal tone as indicated by heart rate variability, a crossover study
Cavanagh, M., Cope, T., Smith, D., Tolley, I., Orrock, P., Vaughan, B.
Journal of Bodywork and Movement Therapies, 2024/04
Free full text


229

A superficial dissection approach to the sphenopalatine (pterygopalatine) ganglion to emphasize osteopathic clinical relevance
Matz, O. C., Rudberg-Post, L. J., Gustafson, H. C., Matz, D. G.
Journal of Osteopathic Medicine, 2024/04
Free full text

230

Lumbar Spinal Stenosis: Diagnosis and Management
Webb, C. W., Aguirre, K., Seidenberg, P. H.
American Family Physician, 2024/04

231

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

232

Relational clinical practice: A hermeneutic, enactive, intersubjective model of osteopathy
Banton, A., Vogel, S.
International Journal of Osteopathic Medicine, 2024/03

233

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03


235

Advancing osteopathic education in Canada: New offerings, new direction
Noy, M.
International Journal of Osteopathic Medicine, 2024/03

236

Introduction to running analysis in the clinical setting: A masterclass
Tripodi, N., Feehan, J., Corcoran, D., Vaughan, B., McLaughlin, P.
International Journal of Osteopathic Medicine, 2024/03
Free full text



239



241

Funktionelle Anatomie der Interozeption
(Functional anatomy of interoception)
Luthin, D., Neuhuber, W.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

242

Der Schluckakt
(The act of swallowing)
Sergueef, N.
Osteopathische Medizin, 2024/03

243

Der Säuglingsfuß in der osteopathischen Praxis
(The infant's foot in osteopathic practice)
Rossi, S., Taubner, A.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03

244

Aus der digitalen Welt
(From the digital world)
Sonntag, M.
Osteopathische Medizin, 2024/03
Free full text

245

Haltungs- und Bewegungsasymmetrien im Säuglingsalter
Sacher, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/03


247

Abstracts From the First Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 15, 2023
Amalfitano, A., Obando, P., Ismail, R., Akenami, F.
Spartan Medical Research Journal, 2024/03
Free full text

248

Osteopathic manipulative treatment for chronic inflammatory diseases
Gillan, R., Bachtel, G., Webber, K., Ezzair, Y., Myers, N. E., Bishayee, A.
Journal of Evidence-Based Medicine, 2024/03

249

The Sentient Cell: Implications for Osteopathic Medicine
Bordoni, B., Escher, A. R., Castellini, F., Vale, J.
Cureus, 2024/02
Free full text

250

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

251

Social determinants of health in patients with arthritis: a cross-sectional analysis of the 2017 Behavioral Risk Factor Surveillance System
Webb, J., Emmert, R., Reddy, A., Sajjadi, N. B., Greiner, B., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/02
Free full text

252

Integration of Osteopathic Manipulative Treatment for Patients with Chronic Pain
Gustowski, S., Slicho, T., Newsome, D.
Missouri Medicine, 2024/02
Free full text

253

Analysis of Variation in the Origin of the Obturator Artery in Midwestern American Donor Bodies
Diemer, C., Schubert, B., Funk, S., Markand, S.
Cureus, 2024/02
Free full text

254

Issues of informed consent for non-specialists conducting colorectal cancer screenings
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/01
Free full text

255

Retrospective analysis of robotic unicompartmental and total knee arthroplasties: patient demographics and outcomes
Kendrick, A. M., Carter, J. M., Gregg, N., MacNeill, S. C., Gittins, M. E.
Journal of Osteopathic Medicine, 2024/01
Free full text

256

Supine counterstrain technique for rhomboid tender point
Matz, O. C., Gustafson, H. C., Hartwell, L. E., Rudberg-Post, L. J., Woolley, A. L.
Journal of Osteopathic Medicine, 2024/01
Free full text

257

Delayed discovery: the COVID-19 pandemic’s influence on osteoarthritis clinical trials
Sajjadi, N. B., Anderson, J. M., Hughes, G. K., Abraham, C. E., Malik, J., Hartwell, M., Vassar, M.
Journal of Osteopathic Medicine, 2024/01
Free full text


259

Knieverletzungen bei Fußballerinnen
(Knee injuries among female soccer players)
Hüppmeier, E.M., Halsband, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

260

Funktionelle Stimmstörungen bei Sängern
(Functional voice disorders in singers)
Kaltenbrunner, U.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

261

Das Mundatmungssyndrom in der osteopathischen Praxis
(Mouth breathing syndrome in the osteopathic practice)
Keller, M., Brümmer, M., Schulz, B.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

262

Mitleid und Mitgefühl
(Pity and compassion)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01


264

(The knee joint)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2024/01

265

Autonomic nervous system responses in the intermediate band to cranial cutaneous stimulation
Keller, M., Pelz, H., Müller, G., Borik, S., Mathiak, K., Mayer, J., Repik, I., Geilgens, A., Perlitz, V.
Physiological Reports, 2024/01
Free full text






271

Psychosomatische Osteopathie
(Psychosomatic osteopathy)
Liem, T.
Osteopathische Medizin, 2023/12

272

Besonderheiten osteopathischer Forschung
(Peculiarities of osteopathic research)
Scheuchl, F., Peuker, E., Kamp, R.
Osteopathische Medizin, 2023/12

273

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12

274

Power and capital: In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

275

Effects of combined taping of quadriceps and hamstring muscles on pain and disability in patients with knee osteoarthritis: Randomized assessor-blinded controlled study
Mohamed, Y. E., Abd-Alkareem, D. S., Balbaa, A.E. A.A., Samy, M. M., Ashour, R. S.
International Journal of Osteopathic Medicine, 2023/12

276

Application of high-velocity low-amplitude technique in cervicothoracic junction produces cardiovascular responses in subjects with C7-T1 dysfunction: Randomized crossover trial
Zago, J., de Souza, B. U. L., Amatuzzi, F., Rondinel, T. Z., Queiroz, R., Cipriano, G., Cipriano, G. F. B.
International Journal of Osteopathic Medicine, 2023/12



279

Features of the state of occlusion with partial loss of teeth (literature review)
Zhulev, E. N., Saakyan, M. Y., Vel', makina, I. V., Bragina, O. M., Vokulova, Y. A.
Russian Osteopathic Journal, 2023/12

280

Simplicity of Osteopathy
Fryette, H. H.
The AAO Journal, 2023/12
Free full text

281

Head Pain
Miller, H. C.
The AAO Journal, 2023/12
Free full text

282

Power and capital; In osteopathy
MacMillan, A.
International Journal of Osteopathic Medicine, 2023/12

283

Osteopathic Manipulative Treatment for Obstetrics
Johnson Skariah, C.
Osteopathic Family Physician, 2023/12

284

Ultrasound-guided injection through the rotator cuff interval: a clinical perspective of one institution's results and description of technique
Beard, N. M., Beggs, L., Murphy, W. G., Knack, M., Golden, O., Ross, W.
Journal of Osteopathic Medicine, 2023/12
Free full text

285

Analysis of alternate material Onyx™ for total knee arthroplasty instrumentation sets
Gregg, N., Kendrick, A. M., Carter, J. M., Gittins, M. E., MacNeill, S. C.
Journal of Osteopathic Medicine, 2023/12
Free full text


287

The Effects of Osteopathic Manipulative Treatment on Cardiac Arrhythmias in Patients with Cardiovascular Implantable Electronic Devices: A Randomized Controlled Trial
Malkov, D., Nikakis, J., Tale, E., Keys, J., Li, T. S., Yao, S. C., Cohen, T. J.
Journal of Osteopathic Medicine, 2023/12

288

Analyzing ChatGPT’s Proficiency In Multiple Choice Osteopathic Manipulative Medicine Questions: Insights and Implications
Sundin, A., Gawash, A., Zia, H., Lo, D. F., Averell, N., King, A., Powell, L.
Journal of Osteopathic Medicine, 2023/12


290

Counterstrain technique for anterior and middle scalene tender point
Matz, O. C., Gustafson, H. C., Hartwell, L. E., Rudberg-Post, L. J., Woolley, A. L.
Journal of Osteopathic Medicine, 2023/11
Free full text

291

Rethinking the Origin of the Primary Respiratory Mechanism
Bordoni, B., Escher, A. R.
Cureus, 2023/10
Free full text


293

Dermal Reflections of Neural Disorders: An Hypothesis
Patriquin, D. A.
The AAO Journal, 2023/09
Free full text

294

Osteopathic Approach for Keloids and Hypertrophic Scars
Bordoni, B., Escher, A. R., Girgenti, G. T., Tobbi, F., Bonanzinga, R.
Cureus, 2023/09
Free full text

295

Adductor magnus: Extending the knowledge – A short review of structure and function
Corcoran, D., McNamara, T., Feehan, J., Tripodi, N.
International Journal of Osteopathic Medicine, 2023/09

296

Six practical tips to prepare for the Comprehensive Osteopathic Medical Licensing Examination (COMLEX) USA level 1
Kadavakollu, S., Ham-Ying, J., Graneto, J. W., Van Es, T. G., Mavyan, R., Qureshi, M., Merino, E. J.
International Journal of Osteopathic Medicine, 2023/09

297

Therapeutic Strategies for Postherpetic Neuralgia: Mechanisms, Treatments, and Perspectives
Tang, J., Zhang, Y., Liu, C., Zeng, A., Song, L.
Current Pain and Headache Reports, 2023/09


299

Stomatognathes System: Stellenwert für die Osteopathie
(Stomatognathic system: Significance for osteopathy)
Prätorius, O., Herdick, T.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

300

Die Rolle des Menstruationszyklus bei Sportverletzungen
(The role of the menstrual cycle in sports injuries)
Stierl, J. A., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09

301

Mechanische Eigenschaften der Arterien
(Mechanical characteristics of the arteries)
Wyvekens, M., Hirth, T., Wyvekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/09


303

Osteopathy in the world of modern medicine
(Остеопатия в мире современной медицины)
Konopleva, E. L., Ostapenko, V. M., Tarasov, N. A.
Russian Osteopathic Journal, 2023/09
Free full text

304

Uniting a shared history: Bringing osteopathic and evolutionary medicine (back) together
Place, A. J., Eddy, A. J., Bray, N. N.
International Journal of Osteopathic Medicine, 2023/09

305

Lower Back Pain in Adolescents with an Osteopathic Component
Givner, D., Luksch, J., Polansky, C., Mehallo, C.
Osteopathic Family Physician, 2023/09

306


307

Short-term effects on heart rate variability of occipito-mastoid suture normalization in healthy subjects
Besson, C., Mur, T., Benaim, C., Schmitt, L., Gremeaux, V.
Frontiers in Neuroscience, 2023/09
Free full text

308

Back to the Future: An Appraisal of the Role of Osteopathic Manipulative Treatment in Patients with Neurological Diseases
Bonanno, M., Calabrò, R. S.
Innovations in Clinical Neuroscience, 2023/09
Free full text

309

Gleichgewicht und Propriozeption
(Balance and proprioception)
Barral, J.P.
Osteopathische Medizin, 2023/09



312

Was stimmt nicht mit der Osteopathie?
(What's wrong with osteopathy?)
Thomson, O. P., MacMillan, A.
Osteopathische Medizin, 2023/09

313

Associations of intimate partner violence and maternal comorbidities: a cross-sectional analysis of the Pregnancy Risk Assessment Monitoring System
Hartwell, M., Keener, A., Robling, K., Enmeier, M., Sajjadi, N. B., Greiner, B., Price, J.
Journal of Osteopathic Medicine, 2023/08
Free full text

314

Non-steroidal Anti-inflammatory Drugs and Osteopathic Manipulative Treatment for Pain Management in Patients With Osteoarthritis: A Literature Review
Stoll, V., Jost, J. M., Jack, A., Johnson, T., Klein, S., Darbhanga, J., Hurwitz, A., Mehra, R. S., Waters, H. B.
Cureus, 2023/08
Free full text

315

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text


317

Superior-medial pole of the bipartate patella
Tu, P. Y., Huang, C. H., Chou, P. P.
Journal of Osteopathic Medicine, 2023/08
Free full text

318

Practice of Peritoneal Adhesions in Osteopathic Medicine: Part 2
Bordoni, B., Girgenti, G. T., Escher, A. R.
Cureus, 2023/08
Free full text

319

Reconceptualizing Principles and Models in Osteopathic Care: A Clinical Application of the Integral Theory
Liem, T., Lunghi, C.
Alternative Therapies in Health and Medicine, 2023/07

320

Peritoneal Adhesions in Osteopathic Medicine: Theory, Part 1
Bordoni, B., Escher, A. R., Girgenti, G. T.
Cureus, 2023/07
Free full text

321

Potential therapeutic effects of adjunct osteopathic manipulative treatments in SARS-CoV-2 patients
Jacob, B., Sawhney, M., Sridhar, A., Jacob, B., Muller, J., Abu-Sbaih, R., Yao, S. C.
Journal of Osteopathic Medicine, 2023/07
Free full text



324

Sprechen wir noch eine Sprache?
(Are we still speaking the same language?)
Schlemmer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06


326

Investigating the mechanism of dextrose prolotherapy in vitro: fibroblast proliferation and production of growth factors
Harting, B., Fox, S., Motyka, T., Hinkelman, A.
The AAO Journal, 2023/06
Free full text




330

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

331

Combating poor mental health in emergency responders: Helping Emergency Responders Overcome (HERO) Act
Derynda, B., Gupta, K. A., Bhattacharya, S., Hollar, T. L.
Osteopathic Family Physician, 2023/06

332

Embryologie und Midline
(Embryology and midline)
Wojtowicz, A., Freeman, B., Dijs, P.
Osteopathische Medizin, 2023/06
Free full text


334

An Osteopathic Approach to the Management of Systemic Lupus Erythematosus
Hoelscher, A. M., Sonnenberg, G., Smith, M., Fritz, D., Belanger, A., Toffol, R.
Osteopathic Family Physician, 2023/06


336

Somatic Dysfunction. Clinical Guidelines 2023
(Соматическая дисфункция. Клинические рекомендации 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06
Free full text

337

What's wrong with osteopathy?
Thomson, O. P., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/06

338

Schlaf hat’s ganz schön in sich
(Sleep really packs a punch)
Dick, S.
DO - Deutsche Zeitschrift für Osteopathie, 2023/06



341

The Acute Physiologic Effects of Osteopathic Manipulative Treatment in Patients with Cardiac Implantable Electronic Devices: A Randomized Controlled Trial
Nikakis, J., Malkov, D. Y., Tale, E., Arora, U. S., Keys, J., Li, T. S., Yao, S., Cohen, T. J.
Heart Rhythm, 2023/05

342

Effectiveness of the muscle energy technique on postpartum meralgia paresthetica: A randomized controlled trial
El-Din Mahmoud, L. S., El Meligie, M. M., Yehia, R. M.
Journal of Back and Musculoskeletal Rehabilitation, 2023/05

343

Anatomy-based approach to the thyroid examination
Matz, O. C., Gustafson, H. C., Figueroa, J.
Journal of Osteopathic Medicine, 2023/05
Free full text

344

The Importance of the Diaphragm in Neuromotor Function in the Patient with Chronic Obstructive Pulmonary Disease.
Bordoni, B., Escher, A., Compalati, E., Mapelli, L., Toccafondi, A.
International Journal of Chronic Obstructive Pulmonary Disease, 2023/04
Free full text

345

Glucocorticoid use in rheumatoid arthritis patients and the onset of pneumonia: a systematic review and meta-analysis
Elsouri, K. N., Arboleda, V., Basbous, L., Heiser, S., Collins, D. P., Ragusa, P., Baxter, C., Cabrera, D., Akhand, T., Stermer, E., Sharma, K., Seguro, C., Hardigan, P., Kesselman, M., Beckler, M. D.
Journal of Osteopathic Medicine, 2023/04
Free full text

346

Enabling health potential: exploring nonlinear and complex results of osteopathic manual medicine through complex systems theory
Ching, L. M., Benjamin, B. A., Stiles, E. G., Shaw, H. H.
Journal of Osteopathic Medicine, 2023/04
Free full text

347

Hyoid Bone Syndrome in a Patient Undergoing Left Ventricular Assist Device Implantation
Bordoni, B., Escher, A. R.
Healthcare, 2023/04
Free full text

348

Überlastungssyndrome im Sport
(Overuse syndromes in sports)
Cécilia-Menzel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

349

Abwertung als Ziel
(Devaluation as a goal)
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

350

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

351

Leitlinien zur HWS-Untersuchung und -Behandlung
(Guidelines for cervical spine examination and treatment)
Hinkelthein, E., Mihajlovic, Z.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03

352

Anatomie der Halswirbelsäule
(Anatomy of the cervical spine)
Mihajlovic, Z., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2023/03







359

Fascia; facts and fantasies
Hoppeler, H.
European Journal of Translational Myology, 2023/03

360

A Heart for Medicine: Palpitations In the Midst of Training
Coggins, J.
Osteopathic Family Physician, 2023/03

361

Osteopathic Considerations in Pain Management
Param, D.
Osteopathic Family Physician, 2023/03
Free full text



364

The Use of Osteopathic Manipulative Treatment as a Therapy for Mental Health Disorders: A Review
Kinderknecht, C. A., Dewilde, P.
Osteopathic Family Physician, 2023/03

365

Osteopathic Manipulation Skills Training: Past, Present, and Future
Masiello, D. J., Torrents, M.
The AAO Journal, 2023/03
Free full text

366

The Virtues of Osteopathic Manipulative Treatments in Patients with Opioid Use Disorder
Shmuts, R., Soled, H., Patel, S., Abend, D. S.
Osteopathic Family Physician, 2023/03

367

Autobiography of AT Still: Chapter XXV
Still, A. T.
The AAO Journal, 2023/03
Free full text

368

Prostate Cancer with a Presenting Symptom of Lower Thoracic Back Pain
Malhotra, V., Singh, C., Weening, A., Patel, S., Mayi, B., Migliozzi, J., Malhotra, V.
Osteopathic Family Physician, 2023/03



371

Looking beyond the pool: An intersectional feminist perspective on osteopathic education
Maretic, S., MacMillan, A.
International Journal of Osteopathic Medicine, 2023/03

372

Still's Osteopathy
Handoll, N.
The AAO Journal, 2023/03
Free full text

373

Effects of face masks on oxygen saturation at graded exercise intensities
Vishwanath, V., Favo, C. L., Tu, T. H., Anderson, B., Erickson, C., Scarpulla, M., Kern, J., DeWinter, L., Gawelko, A., Bolch, C., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2023/03
Free full text

374

Mind, Body and Spirit: What Makes Osteopathic Medicine is Hands on
Williams, B. R.
Osteopathic Family Physician, 2023/03


376

Eficacia de las técnicas osteopáticas en el dolor de rodilla
(Effectiveness of osteopathic techniques in knee pain)
González Ruiz, P. M., Laguna Aranda, A. M., Aranda Guirado, L.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text

377

Beneficios del tratamiento osteopático en el periodo obstétrico
(Benefits of osteopathic treatment during pregnancy)
Rodríguez Pérez-Serrano, E., Sedeño Vidal, A.
European Journal Osteopathy & Related Clinical Research, 2023/03
Free full text



380

Preserving the History and Future of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2023/03
Free full text

381

Characteristics of patients presenting at a university outpatient department for com-plementary and integrative medicine
Rotter, G., Binting, S., Teut, M., Ortiz, M., Willich, S. N., Brinkhaus, B.
Complementary Medicine Research, 2023/02


383

Preventative Management of Sepsis-Induced Acute Respiratory Distress Syndrome in the Geriatric Population
Geyer-Roberts, E., Lacatusu, D. A., Kester, J., Foster-Moumoutjis, G., Sidiqi, M.
Cureus, 2023/02
Free full text

384

Conquering diabetes therapeutic inertia: practical tips for primary care
Moverley, J. A., Novak, L., Shubrook, J. H.
Journal of Osteopathic Medicine, 2023/02
Free full text

385

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text

386


387


388

Schulter-Arm-Schmerzen
(Shoulder-arm pain)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2023/01


390

The Osteopath's Imprint: Osteopathic Medicine Under the Nanoscopic Lens
Bordoni, B., Escher, A. R.
Cureus, 2023/01
Free full text


392

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

393

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2023/01

394


395

Osteopathic manipulative treatment in cardiac surgery patients: A systematic review
Rorris, FP, Skouteli, EA T., Papakonstantinou, K., Kokotsaki, L., Skotiniotis, E., Kokotsakis, J.
International Journal of Osteopathic Medicine, 2022/12




399

Avoiding nocebo and other undesirable effects in chiropractic, osteopathy and physiotherapy: An invitation to reflect
Hohenschurz-Schmidt, D., Thomson, O. P., Rossettini, G., Miciak, M., Newell, D., Roberts, L., Vase, L., Draper-Rodi, J.
Musculoskeletal Science and Practice, 2022/12




403

Variations of the Cystohepatic Blood Supply in American Midwestern Donor Cadavers
Memar, S. A., VanSickle, C., Funk, S., Houser, J. J., Markand, S.
Cureus, 2022/12
Free full text

404

Reconceptualizing the therapeutic alliance in osteopathic practice: Integrating insights from phenomenology, psychology and enactive inference
Shaw, R., Abbey, H., Casals-Gutiérrez, S., Maretic, S.
International Journal of Osteopathic Medicine, 2022/12



407

Five challenges for manual therapies trials with placebo controls: A proposal
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/12


409

Opportunities to Incorporate Osteopathic Manipulative Treatment Within Cancer Rehabilitation and the Current State of the Evidence
Martone, P., Marshall, G. D., Davidoff, C., Maltser, S.
Current Physical Medicine and Rehabilitation Reports, 2022/11

410

An Osteopathic Approach to Anemia
Pettitt, R., Horkott, G., Reno, D., Grohol, B.
Osteopathic Family Physician, 2022/10
Free full text

411

Osteopathie bei männlicher Infertilität
(Osteopathy for male infertility)
Biberschick, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/09




415

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text


417

Piriformis syndrome
(Синдром грушевидной мышцы)
Belash, V. O., Petrova, E. A.
Russian Osteopathic Journal, 2022/09

418

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/09



421

(Osteopathic paradox)
Krause, K. C.
Osteopathische Medizin, 2022/09

422

Acute effect of whole body-vibration exercise and osteopathic manipulative treatment on the heart rate variability in individuals with metabolic syndrome: Randomized cross-study protocol
Batouli-Santos, D., Reis-Silva, A., Guimarães-Lourenço, G. M., Mendonça-Guimarães, R., Moreira-Marconi, E., Sonza, A., Bernardo-Filho, M., Sá-Caputo, D. C.
International Journal of Osteopathic Medicine, 2022/09




426

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

427

Where do people acquire their beliefs about low back pain?
Suhail, A., Poulter, D. C.
International Journal of Osteopathic Medicine, 2022/09

428

Osteopathic Manipulative Treatment Decreases Hospital Stay and Healthcare Cost in the Neonatal Intensive Care Unit
Roland, H., Brown, A., Rousselot, A., Freeman, N., Wieting, J. M., Bergman, S., Mondal, D.
Medicines (Basel), 2022/09
Free full text

429

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

430

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text

431

The Importance of the Posterolateral Area of the Diaphragm Muscle for Palpation and for the Treatment of Manual Osteopathic Medicine
Bordoni, B., Walkowski, S., Escher, A., Ducoux, B.
Complementary Medicine Research, 2022/08

432

Das zerebrospinale venöse System
(The cerebrospinal venous system)
Flenker, J.
DO - Deutsche Zeitschrift für Osteopathie, 2022/07

433

Osteopathy in Dentistry – Review of the Literature
Alfaqeeh, S. A., Alzaidy, S. I., Bin Jadeed, S. A., Aljammaz, W. A.
European Journal of Molecular & Clinical Medicine, 2022/07

434

Low-back pain in adolescents with an osteopathic component
Tung, P.
Osteopathic Family Physician, 2022/07
Free full text

435

Multiple Sclerosis: A comprehensive Review for the Osteopathic Provider
Blocher-Smith, E. C., Izokaitis, A.
Osteopathic Family Physician, 2022/07
Free full text

436

Addressing disparities in medicine through medical curriculum change: a student perspective
Kureshi, A., Landman, S., Ahmed, M., Savinova, O. V., Becker, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

437

Overcoming reward deficiency syndrome by the induction of “dopamine homeostasis” instead of opioids for addiction: illusion or reality?
Blum, K., Soni, D., Badgaiyan, R. D., Baron, D.
Journal of Osteopathic Medicine, 2022/07
Free full text

438

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

439

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07

440

The Effects of Osteopathic Manipulative Therapy and Topical Diclofenac Sodium on Osteoarthritis
Francis, V. K. J., Jost, J., Hurwitz, A., Jack, A., Johnson, T., Darbhanga, J., Klein, S., Mandavalli, A.
Southern Medical Journal, 2022/07

441

Osteopathic Approach to Assessment and Treatment of an Adolescent with Polyarthralgia in the Post-COVID Setting
Mutter, C. M., Vemuri, A., Yassin, K., Rehman, N., Nelson, A., Waters, H., Mehra, R.
Southern Medical Journal, 2022/07



444

Pediatric unilateral knee swelling: a case report of a complicated differential diagnosis and often overlooked cause
Guardado, K. E., Sergent, S.
Journal of Osteopathic Medicine, 2022/06
Free full text

445

An Enactive-Ecological Model to Guide Patient-Centered Osteopathic Care
Cerritelli, F., Esteves, J. E.
Healthcare, 2022/06
Free full text

446

(The philosophy of osteopathy or the love of not knowing)
Engel, M.
Osteopathische Medizin, 2022/06
Free full text


448

Bruxismus und Osteopathie
(Bruxism and Osteopathy)
Liem, T.
Osteopathische Medizin, 2022/06



451

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text



454

Transverse colon adenocarcinoma with direct cutaneous extension: complex multidisciplinary surgical management
Snow, Z. A., Marshall, B. N., Dreher, P., Parikh, S. N., Walchak, A., Cahn, D. B.
Journal of Osteopathic Medicine, 2022/06
Free full text

455

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text

456

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05

457

Tissutal and Fluidic Aspects in Osteopathic Manual Therapy: A Narrative Review
Verzella, M., Affede, E., Di Pietrantonio, L., Cozzolino, V., Cicchitti, L.
Healthcare, 2022/05
Free full text

458

Knee dislocations and multi-ligament knee injuries: A review
Cinti, J., Elbert, G., Lamb, A., Frousiakis, P., Sweet, S.
Osteopathic Family Physician, 2022/05
Free full text

459

The effects of OMT on progressive massive fibrosis: A brief report of an adjunctive therapy to improve respiratory function in Appalachian coal miners
Raven, J., Lewis, P., Justice, A., Crum, J. F., Driskill, D.
Osteopathic Family Physician, 2022/05
Free full text


461

Os trigonum identified after trauma to heel
Pargeon, M. E., Tjiattas-Saleski, L. R.
Journal of Osteopathic Medicine, 2022/05
Free full text

462

Osteopathic Manipulative Medicine: A Brief Review of the Hands-On Treatment Approaches and Their Therapeutic Uses
Roberts, A., Harris, K., Outen, B., Bukvic, A., Smith, B., Schultz, A., Bergman, S., Mondal, D.
Medicines (Basel), 2022/04
Free full text

463

Osteopathic Manipulative Treatment Regulates Autonomic Markers in Preterm Infants: A Randomized Clinical Trial
Manzotti, A., Cerritelli, F., Lombardi, E., Monzani, E., Savioli, L., Esteves, J. E., Galli, M., La Rocca, S., Biasi, P., Chiera, M., Lista, G.
Healthcare, 2022/04
Free full text

464

Clinical evaluation and management of calcific tendinopathy: an evidence-based review
Catapano, M., Robinson, D. M., Schowalter, S., McInnis, K. C.
Journal of Osteopathic Medicine, 2022/04
Free full text

465

Bleeding gums due to immune thrombocytopenic purpura
Trydal, L., Liu, T.
Journal of Osteopathic Medicine, 2022/04
Free full text

466

Integrative medicine considerations for convalescence from mild-to-moderate COVID-19 disease
Alschuler, L., Chiasson, A. M., Horwitz, R., Sternberg, E., Crocker, R., Weil, A., Maizes, V.
Explore (NY), 2022/03
Free full text



469

Osteoarthritis disease progression through the lower extremity: A review
Canton, D., Conte, M., Kammen, P.
Osteopathic Family Physician, 2022/03
Free full text

470

Childhood obesity: An approach to individualized treatment
Collins, P., Brolis, N.
Osteopathic Family Physician, 2022/03
Free full text


472

Schwindel und Tinnitus
(Vertigo and tinnitus)
Bonacker, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

473

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

474

A.T. Still’s Biogen
Masiello, D. J.
The AAO Journal, 2022/03
Free full text


476

Supine Counterstrain Technique for Posterior Rib Tenderpoints
Figueroa, J. S., Ellis, M. M.
The AAO Journal, 2022/03
Free full text

477

Should person-centredness care be an affordable goal in French osteopathic education?
Salmon, M., Cretal, A., Gonzales-Bandres, M.
International Journal of Osteopathic Medicine, 2022/03
Free full text

478

Die Rolle der Leber in der Osteopathie
(The role of the liver in osteopathy)
Gerstner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03

479

Osteopathie bei Schwangeren und nach der Geburt
(Osteopathy in pregnant women and after birth)
Marjanovic, A.H.
DO - Deutsche Zeitschrift für Osteopathie, 2022/03


481

Weibliche Anatomie: Die Harnblase
Female Anatomy: The Urinary Bladder
Bazin, O., Naudin, M.
Osteopathische Medizin, 2022/03



484

Sticky Floor, Broken Ladder, and Glass Ceiling in Academic Obstetrics and Gynecology in the United States and Canada
Kim, K. Y., Kearsley, E. L., Yang, H. Y., Walsh, J. P., Jain, M., Hopkins, L., Wazzan, A. B., Khosa, F.
Cureus, 2022/02
Free full text

485

Osteopathic Care as (En)active Inference: A Theoretical Framework for Developing an Integrative Hypothesis in Osteopathy
Esteves, J. E., Cerritelli, F., Kim, J., Friston, K. J.
Frontiers in Psychology, 2022/02
Free full text

486

Integrated Osteopathic-Neurologic Examinations with Musculoskeletal Treatment: The ONE Approach
Joseph, C. R., Lockwood, M. D., Cargill, M. P., Jackson, A. M., Morris, J. K.
Neurology: Clinical Practice, 2022/02

487

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

488

Osteopathic approach to sacroiliac joint pain in pregnant patients
Morimoto, K., Harrington, A., Nelson, C., Loveless, B.
Journal of Osteopathic Medicine, 2022/02
Free full text

489

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

490

Prostate disorders diagnosis and management review with an osteopathic component
George, E., Larsen, H.
Osteopathic Family Physician, 2022/01
Free full text

491

Acute giardiasis and Chapman reflexes: Musculoskeletal symptoms preceding, during and after infection
Powell, L., Richmond, C., Cooley, D.
Osteopathic Family Physician, 2022/01
Free full text



494

Arterielle Versorgung des Kraniums
(Arterial supply of the cranium)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

495

Teilleistungsstörung bei visueller Wahrnehmungsstörung
(Partial performance disorder in visual perception disorder)
Engemann, K., Preiss-Leger, B.
DO - Deutsche Zeitschrift für Osteopathie, 2022/01

496




499

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

500

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12


502

Overcoming placebo-related challenges in manual therapy trials: The ‘whats and hows’ and the ‘touch equality assumption’ proposals
D'Alessandro, G., Ruffini, N., Iacopini, A., Annoni, M., Kossowsky, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/12

503

Clinical assessment during a global pandemic - Transitioning to a COVID safe hybrid OSCE
Attenborough, P., Towns, J., Fazalbhoy, A., Fitzgerald, K.
International Journal of Osteopathic Medicine, 2021/12
Free full text




507

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12





512

Osteopathic ableism: A critical disability view of traditional osteopathic theory in modern practice
MacMillan, A.
International Journal of Osteopathic Medicine, 2021/12

513

Therapeutic Effects of Lymphatic Pump Treatment on Lymphangiogenesis and Inflammatory Cytokines in Lymph Nodes of Rats with Adjuvant-Induced Arthritis
Blucher, K. M., Jain, S., Weber, D., Gober, C., Zanotti, B., Incrocci, R., Del Toro, R., Swanson-Mungerson, M., Volin, V. V.
Journal of Osteopathic Medicine, 2021/12

514

Effect of Self-Performed Osteopathic Manipulative Treatment (suboccipital release) on Heart Rate Recovery: A Pilot Study
Loquist, D. C., Wong, T., Warner, M., Cannumay, S., Singh, G., Nazarian, D., Saukhla, N., Hovsepian, T.
Journal of Osteopathic Medicine, 2021/12

515

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12

516

Traditional Osteopathy and the General Osteopathic Treatment: A Historical Concept and a Modern Application
Grolaux, P. J., Sparrow, T. J., Lalonde, F.
The AAO Journal, 2021/12
Free full text



519

An osteopathic approach to carpal tunnel syndrome
Baxter, S., Millhuff, A., Desai, G., Dowling, D.
Osteopathic Family Physician, 2021/11

520

Insomnia diagnosis and management: an osteopathic approach
Cody, Homistek, Heather, Doty
Osteopathic Family Physician, 2021/11



523

Osteopathy and Mental Health: An Embodied, Predictive, and Interoceptive Framework
Bohlen, L., Shaw, R., Cerritelli, F., Esteves, J. E.
Frontiers in Psychology, 2021/10
Free full text



526

Obsessive-Compulsive Disorder: Diagnosis and Management with an Osteopathic Component
Flaum, T. B., Chinsky, R.I, Yao, S. C..
Osteopathic Family Physician, 2021/10




530

Schreikinder
(Crying infants)
Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/09


532




535

Masterclass: Axial Spondyloarthritis for Osteopaths and Manual Therapists
MacMillan, A., Corser, A., Clark, Z., McCrum, C., Gaffney, K.
International Journal of Osteopathic Medicine, 2021/09

536

The legacy and implications of the body-mind-spirit osteopathic tenet: a discussion paper evaluating its clinical relevance in contemporary osteopathic care
Zegarra-Parodi, R., Esteves, J. E., Lunghi, C., Baroni, F., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2021/09

537

Utilizing the Four Tenets of Osteopathic Medicine as an intersectional framework for approaching sexual orientation and gender identity disclosure as a provider
Counce, T. L., Ko, A., Martinez, A. D., Rivera, J. M., Browne, C., Solis, L.
Journal of Osteopathic Medicine, 2021/09
Free full text

538

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09


540

Osteopathic considerations in pneumonia
Celebi, T., Muller, J., Terzella, M.
Osteopathic Family Physician, 2021/09

541

Puberty: An approach to diagnosis and management with an osteopathic component
Chinsky, R., Lilaporia, S., Li, T., Chan, T.
Osteopathic Family Physician, 2021/09


543

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

544

Acute and Time-Course Effects of Osteopathic Manipulative Treatment on Vascular and Autonomic Function in Patients With Heart Failure: A Randomized Trial
Amatuzzi, F., Gervazoni Balbuena de Lima, A. C., Da Silva, M. L., Cipriano, G. F. B., Catai, A. M., Cahalin, L. P., Chiappa, G., Cipriano, G.
Journal of Manipulative and Physiological Therapeutics, 2021/08

545

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


547

Ungleichgewicht von Produktion und Resorption des LCS
(Imbalance of production and absorption of the LCS.)
Buekens, J., Grasmück, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

548

Leiblichkeit des Herzens (Teil 2)
(Corporeality of the Heart (Part 2))
Kozljanič, R. J., Scheuchl, F., Walker, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07

549

Der Mensch und seine Mikroben
(Man and its microbes)
Kraml, M. M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/07



552

Osteopathic considerations for breastfeeding women
Conaway, E. M., O'Donnell, A. E.
Journal of Osteopathic Medicine, 2021/07
Free full text







559

A Review of COVID-19 Recovery and the Benefits of an Osteopathic Approach
Haney, T., Worsham-Frye, M.A., Bray, N.
Osteopathic Family Physician, 2021/07

560

Heel Pain With an Osteopathic Component
Italiano, J., Bitterman, A.
Osteopathic Family Physician, 2021/07

561

MYNd&CO (Mindfulness, Yoga, Nutrition, development & Coaching, and Osteopathy) randomized controlled trial for a positive psychophysical experience in pregnancy and after birth: a study protocol
Giovannini, N., Cetera, G. E., Ercolino, C., Miozzo, M. R., Parazzini, F., Ferrazzi, E. M., Manzotti, A., Colaceci, S.
Acta Bio-Medica, 2021/07
Free full text

562

Integrative Medicine: Manual Therapy
Snyder, M. J., Hawks, M. K., Moss, D. A., Crawford, P. F.
FP Essentials, 2021/06

563

Osteopathy: Italian professional profile. A professional commentary by a group of experts of the European community of practice
Cerritelli, F., Lunghi, C., Esteves, J. E., Vaucher, P., van Dun, P. L. S., Alvarez, G., Biberschick, M., Wagner, A., Merdy, O., Menard, M., Tavernier, P., Clouzeau, C., Risch, A., Ruffini, Nuria, Nunes, A., Santiago, R., Marett, P., Grech, R., Thomson, O. P.
International Journal of Osteopathic Medicine, 2021/06





568

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

569

An Osteopathic Approach to Patients with Degenerative and Herniated Discs
Kessler, R., Haase, C., Dean, D.
The AAO Journal, 2021/06
Free full text

570

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

571

The impact of COVID-19 on womxn in science and osteopathic medicine
Beverly, E. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

572

The Osteopathic Approach to Treating Depression in Children and Adolescents
Chinsky, R.I, Chan, T.
Osteopathic Family Physician, 2021/05

573

Activation of the cholinergic antiinflammatory reflex by occipitoatlantal decompression and transcutaneous auricular vagus nerve stimulation
Kania, A. M., Weiler, K. N., Kurian, A. P., Opena, M. L., Orellana, J. N., Stauss, H. M.
Journal of Osteopathic Medicine, 2021/04
Free full text


575

Osteopathic manual therapy in heart failure patients: A randomized clinical trial
Thomaz, S. R., Teixeira, F. A., de Lima, Acgb, Cipriano Junior, G., Formiga, M. F., Cahalin, L. P.
Journal of Bodywork and Movement Therapies, 2021/04




579

Adverse events from spinal manipulations in the pregnant and postpartum periods: a systematic review and update
Weis, C. A., Stuber, K., Murnaghan, K., Wynd, S.
The Journal of the Canadian Chiropractic Association, 2021/04
Free full text

580

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04


582

Occipitoatlantal decompression and noninvasive vagus nerve stimulation slow conduction velocity through the atrioventricular node in healthy participants
Dalgleish, A. S., Kania, A. M., Stauss, H. M., Jelen, A. Z.
Journal of Osteopathic Medicine, 2021/04
Free full text

583

Osteopathic Palpation of the Heart
Bordoni, B., Escher, A. R.
Cureus, 2021/03
Free full text


585

Der Knochen aus osteopathischer Sicht
(The bone from an osteopathic point of view)
Junge, M.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


587

Sportosteopathie: Leistung auf hohem Niveau
(Sports osteopathy: performance at a high level)
Van Gorp, J.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03


589

Das indirekte Beschwerdebild
(Indirect symptoms)
Selzle, C.
DO - Deutsche Zeitschrift für Osteopathie, 2021/03




593

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text







600

Osteopathy modulates brain-heart interaction in chronic pain patients: an ASL study
Cerritelli, F., Chiacchiaretta, P., Gambi, F., Saggini, R., Perrucci, M. G., Ferretti, A.
Scientific Reports, 2021/02
Free full text

601

Extremitätenentwicklung in der Embryonalphase
(Limb development in the embryonic phase)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01


603

Hüftreifungsstörung
(Hip dysplasia)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2021/01

604


605

Osteopathic Manipulative Treatment and Cardiovascular Autonomic Parameters in Rugby Players: A Randomized, Sham-Controlled Trial
Carnevali, L., Cerritelli, F., Guolo, F., Sgoifo, A.
Journal of Manipulative and Physiological Therapeutics, 2021/01

606

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text


608

Adult Hearing Loss: Applying the Five Models of Osteopathic Medicine to Diagnose and Treat
Elnashar, A., Lodato, Z., Do Faao, S. Y.
Osteopathic Family Physician, 2021/01
Free full text

609

A Comprehensive Review of Alternative Therapies for the Management of Chronic Pain Patients: Acupuncture, Tai Chi, Osteopathic Manipulative Medicine, and Chiropractic Care
Urits, I., Schwartz, R. H., Orhurhu, V., Maganty, N. V., Reilly, B. T., Patel, P. M., Wie, C., Kaye, A. D., Mancuso, K. F., Kaye, A. J., Viswanath, O.
Advances in Therapy, 2021/01
Free full text

610

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

611

Towards a history of the development of osteopathy
Didur, M.D., Egorova, I.A., Novoseltsev, S.V., Zinkevich, E.R.
History of Medicine, 2021
Free full text

612

Embryologische Wellenreiter
(Embryological surfers)
Keown, D.
Osteopathische Medizin, 2020/12



615

Readmission Risk Factors and Heart Failure With Preserved Ejection Fraction
Harmon, D., Rathousky, J., Choudhry, F., Grover, H., Patel, I., Jacobson, T., Boura, J., Crawford, J., Arnautovic, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text





620

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12




624

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

625

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text


627



629

Postoperative peritoneale Adhäsionen
(Postoperative peritoneal adhäsionen)
Liedler, M.
DO - Deutsche Zeitschrift für Osteopathie, 2020/10

630

Exploring the Effects of Osteopathic Manipulative Treatment on Autonomic Function Through the Lens of Heart Rate Variability
Carnevali, L., Lombardi, L., Fornari, M., Sgoifo, A.
Frontiers in Neuroscience, 2020/10
Free full text

631

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text

632

Phylogenetics of the Fascial System
Vieira, L.
Cureus, 2020/10
Free full text

633




636

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/09

637

An Osteopathic Perspective on COVID-19: Is There a Missing Link to Treatment?
Chmielewski, R.
The AAO Journal, 2020/09
Free full text


639

An Osteopathic Approach to Post-Partum Low Back Pain: A Case Report
Mehner, T. R., Lewis, D. D.
The AAO Journal, 2020/09



642

Spinal Manipulation and Select Manual Therapies: Current Perspectives
Hinkeldey, N., Okamoto, C., Khan, J.
Physical medicine and rehabilitation clinics of North America, 2020/09





647

Opioid Use in the Postpartum Period: Are We Prescribing Too Much?
Prentice, D., Berry, A., Stewart, L., Wilkins, H., Ural, S., Deiter, R.
The Journal of the American Osteopathic Association, 2020/08
Free full text

648

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

649

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

650

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

651

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text


653

Variations of HRV and skin conductance reveal the influence of CV4 and Rib Raising techniques on autonomic balance: A randomized controlled clinical trial
Arienti, C., Farinola, F., Ratti, S., Daccò, S., Fasulo, L.
Journal of Bodywork and Movement Therapies, 2020/07

654

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text


656

Novel Dual-Fluorescent Mitophagy Reporter Reveals a Reduced Mitophagy Flux in Type 1 Diabetic Mouse Heart
Kobayashi, S., Patel, J., Zhao, F., Huang, Y., Kobayashi, T., Liang, Q.
The Journal of the American Osteopathic Association, 2020/07
Free full text

657

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text


659

Die Nieren
(The kidneys)
Kamiyar-Kiel, T
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

660

(Corporeality of the heart)
Kozljanič, R. J., Scheuchl, F., Rösing, S.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06


662

Neuro-Ocular Release: A New Osteopathic Technique For Resolving Somatic Dysfunction
Feely, R. A., Smith, J. A.
The AAO Journal, 2020/06
Free full text

663

Richtige Kommunikation in unserem Beruf
(The right communication in our profession: an international concern)
van Dun, P., Wagner, C.
DO - Deutsche Zeitschrift für Osteopathie, 2020/06

664

Osteopathic Self-Treatment to Promote Health and The Body’s Ability to Fight COVID-19
Lewis, D.D., McMunn, R.D.
The AAO Journal, 2020/06
Free full text


666

Test der Faszienkompartimente
(Test for fascia compartments)
Lunghi, C.
Osteopathische Medizin, 2020/06


668

Buying Time: Using OMM to Potentially Reduce the Demand for Mechanical Ventilation in Patients With COVID-19
Stenta, M. E.
The Journal of the American Osteopathic Association, 2020/06
Free full text

669

The effect of osteopathic manual therapy with breathing retraining on cardiac autonomic measures and breathing symptoms scores: A randomised wait-list controlled trial
Benjamin, J. G., Moran, R. W., Plews, D. J., Kilding, A. E., Barnett, L. E., Verhoeff, W. J., Bacon, C. J.
Journal of Bodywork and Movement Therapies, 2020/06










679

Graves Orbitopathy
Natali, S., Shogan, P.
The Journal of the American Osteopathic Association, 2020/06
Free full text

680

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text



683

Osteopathic Manipulative Treatment for Low Back Pain
Ponna, V., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

684

Antithrombotic Therapy for Patients With Atrial Fibrillation and Acute Coronary Syndrome or Percutaneous Coronary Intervention
Tseng, A. S., Shamoun, F. E., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/05
Free full text

685

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text

686

Effects of osteopathic treatment versus static touch on heart rate and oxygen saturation in premature babies: A randomized controlled trial
Manzotti, A., Cerritelli, F., Lombardi, E., La Rocca, S., Chiera, M., Galli, M., Lista, G.
Complementary Therapies in Clinical Practice, 2020/05

687

Dermatofibrosarcoma Protuberans
Natali, S., Borelli, C., Shogan, P.
The Journal of the American Osteopathic Association, 2020/05
Free full text

688

Medizinischer Notfall in der Praxis: Ich packe meinen Koffer …
(Medical emergency in the practice: I pack my suitcase ...)
Merkt, P., Grasmück, J., Funke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04



691

Der chronische Beckenschmerz
(Chronic Pelvic Pain)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2020/04

692

The future of osteopathy in Portugal – Patient safety and practice standards
Rodrigues dos Santos, M., Mendes, C.
European Journal of Integrative Medicine, 2020/04

693

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

694

Approach To Joint Pain In The Elderly For Osteopathic Providers
Daudfar, S., Nakajima, N., Faiss, K., Tegeler, L., Kuo, J., Dreibelbis, R., Goering, E., Katsaros, E., Pham, J. T.
Osteopathic Family Physician, 2020/04
Free full text

695

Osteopathic Primary Care Treatment Options for Ulcerative Colitis
Fernandez, A., Januchowski, R.
Osteopathic Family Physician, 2020/04
Free full text

696

Urticaria: Diagnosis and Treatment with Osteopathic Considerations
Stacey, S.., Burke, D., Brininger, T.
Osteopathic Family Physician, 2020/04
Free full text


698

Introducing Short Lever Still Technique, a New Variant
van Buskirk, R. L.
The AAO Journal, 2020/03
Free full text

699

Osteopathic Manipulative Treatment for Pediatric Patients With Otitis Media
Winger, K., Hendriksz, T., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2020/03
Free full text

700

Rhinitis: The Osteopathic Modular Approach
Wu, S. S., Graven, K., Sergi, M., Hostoffer, R.
The Journal of the American Osteopathic Association, 2020/03
Free full text

701

Skoliose und Osteopathie: Teil 1: Grundlagen
(Scoliosis and osteopathy. Part 1: Basics)
Zweedijk, R., Tylleman, C., Schwind, P.
Osteopathische Medizin, 2020/03

702

The ICD-11 and opportunities for the osteopathy profession
Fitzgerald, K., Vaughan, B., Fleischmann, M., Orchard, D.
International Journal of Osteopathic Medicine, 2020/03

703

Osteopathic Treatment Approach to Psychoemotional Trauma by Means of Bifocal Integration
Liem, T., Neuhuber, W.
The Journal of the American Osteopathic Association, 2020/03
Free full text

704

Non-Allergic Rhinitis with Osteopathic Treatment Techniques
Bukhari, O., Phillips, G., Sweeney, K.
Osteopathic Family Physician, 2020/03
Free full text



707

Antidepressant Discontinuation Syndrome: A Common but Underappreciated Clinical Problem
Rizkalla, M., Kowalkowski, B., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2020/02
Free full text

708

A Stepwise Approach to the Management of Heart Failure and its Comorbidities
Rogers, F. J., Saghir, Z.
The Journal of the American Osteopathic Association, 2020/02
Free full text


710

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text

711

Osteopathic Approach to Diagnosis and Treatment of Dysfunction at the Thoracolumbar Junction
Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/02
Free full text

712

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text

713

Ist die Osteopathie eine Wissenschaft?
(Is Osteopathy a Science?)
Kaiser, A. K.
DO - Deutsche Zeitschrift für Osteopathie, 2020/01




717

The Many Facets of Hypermobile Ehlers-Danlos Syndrome
Riley, B.
The Journal of the American Osteopathic Association, 2020/01
Free full text

718

Food Sensitivity Testing and Elimination Diets in the Management of Irritable Bowel Syndrome
Smith, E., Foxx-Orenstein, A., Marks, L. A., Agrwal, N.
The Journal of the American Osteopathic Association, 2020/01
Free full text

719

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text

720

High-Velocity, Low-Amplitude Management of Posterior Rib Somatic Dysfunction
Kasten, K. M., Lewis, D. D.
The Journal of the American Osteopathic Association, 2020/01
Free full text


722

Preventing Premature Weaning: Management Options for Common Lactation Conditions, Including OMT
Sackett, D. R., Dajani, T., Shoup, D., Ikonne, U., Bombei, B.
Osteopathic Family Physician, 2020/01

723

Taxonomy of the Lateral Strain Patterns at the Sphenobasilar Synchondrosis for Osteopathic Cranial Manipulative Medicine
Capobianco, J. D., Shermon, S.
The Journal of the American Osteopathic Association, 2020/01
Free full text



726

Osteopathic Cranial Manipulative Medicine: Frontal and Parietal Lift Techniques
Mardini, D., Peña, N., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/12
Free full text









735

Role of Opioid Involved Drug Interactions in Chronic Pain Management
Bain, K. T., Knowlton, C. H.
The Journal of the American Osteopathic Association, 2019/12
Free full text

736

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text

737

Osteopathic Manipulative Medicine Considerations in Pelvic Pain
Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/11
Free full text

738

An Osteopathic Physician's Approach to the Esports Athlete
Zwibel, H., DiFrancisco-Donoghue, J., DeFeo, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2019/11



741

Osteopathic Manipulative Treatment Considerations in Tension-Type Headache
Lee, E., Moloney, S., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/10
Free full text


743

Visceral osteopathic manipulative treatment reduces patient reported digestive toxicities induced by adjuvant chemotherapy in breast cancer: A randomized controlled clinical study
Lagrange, A., Decoux, D., Briot, N., Hennequin, A., Coudert, B., Desmoulins, I., Bertaut, A.
European Journal of Obstetrics and Gynecology and Reproductive Biology, 2019/10



746

Awareness of axial spondyloarthritis among chiropractors and osteopaths: findings from a UK Web-based survey
Yong, C. Y., Hamilton, J., Benepal, J., Griffiths, K., Clark, Z. E., Rush, A., Sengupta, R., Martindale, J., Gaffney, K.
Rheumatology Advances in Practice, 2019/10
Free full text



749

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

750

An Osteopathic Approach to Uterine-Induced Low Back Pain: A Case Report
Kanze, D. M.
The AAO Journal, 2019/09
Free full text

751

The Native American heritage of the body-mind-spirit paradigm in osteopathic principles and practices
Zegarra-Parodi, R., Draper-Rodi, J., Haxton, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/09

752

Osteopathic approach with a patient undergoing cardiac transplantation: the five diaphragms
Bordoni, B., Morabito, B., Simonelli, M., Nicoletti, L., Rinaldi, R., Tobbi, F., Caiazzo, P.
International medical case reports journal, 2019/09
Free full text

753

Endokrinologie und Osteopathie
(Endocrinology and osteopathy)
Ebner, M.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

754

Dysmenorrhö
(Dysmenorrhea)
Engel-Schulmeyer, A.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09


756

Persistent Postoperative Swelling Following Arthroscopic Meniscectomy: A Case Report
Noblitt, T. R., Fleming, R. K.
The AAO Journal, 2019/09
Free full text



759

Die Schilddrüse
(The thyroid)
Stöckl, D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/09

760

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

761

Fascial Nomenclature: An Update
Bordoni, B., Walkowski, S., Morabito, B., Varacallo, M. A.
Cureus, 2019/09
Free full text

762

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

763

Dynamic touch reduces physiological arousal in preterm infants: A role for c-tactile afferents?
Manzotti, A., Cerritelli, F., Esteves, J. E., Lista, G., Lombardi, E., La Rocca, S., Gallace, A., McGlone, F. P., Walker, S. C.
Developmental Cognitive Neuroscience, 2019/08
Free full text

764

Mesenteric Lift for Constipation in Cystic Fibrosis
Sarti, F., Wolf, K., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

765

Kindlicher Kopfschmerz
(Child headache)
Peters, K.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

766

Körperarbeit als Zugang zum ganzen Menschen
(Bodywork as access to the whole person)
Petzold, T. D.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07

767

Manuelle Behandlung der Skoliose beim Erwachsenen
(Manual treatment of scoliosis in adults)
Schwind, P.
DO - Deutsche Zeitschrift für Osteopathie, 2019/07




771

Нормы труда врача остеопата в учетом кодирования заболеваемости
(The labor standards of osteopath with regard to morbidity coding)
Shipova, V. M., Berseneva, E. A., Mikhailov, D. Y.
Problemy sotsial'noi gigieny, zdravookhraneniia i istorii meditsiny, 2019/07




775

Specific Adjusting Technique
(Specific Adjusting Technique)
Lamb, Gez, Schabel, Kai
Osteopathische Medizin, 2019/06

776

Osteopathic Cranial Manipulative Medicine and the Blood Brain Barrier: A Mechanistic Approach to Alzheimer Prevention
McAree, M., Dunn, A., Furtado, J., Timmerman, C., Winchell, Z., Rani, R., Farah, J., Crispino, L. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

777

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06

778

Refining the biopsychosocial model for musculoskeletal practice by introducing religion and spirituality dimensions into the clinical scenario
Zegarra-Parodi, R., Draper-Rodi, J., Cerritelli, F.
International Journal of Osteopathic Medicine, 2019/06



781

Management of Temporomandibular Disorders: New Opportunities for Osteopathic Medicine?
Hruby, R. J.
The Journal of the American Osteopathic Association, 2019/06
Free full text

782

Osteopathic Manipulative Treatment for Temporomandibular Disorders
Easterbrook, S., Keys, J., Talsma, J., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/06
Free full text

783

Integrating Osteopathic Philosophy in Cancer Care
Brown, Z. J., Martin, S. P., Carman, R.
The Journal of the American Osteopathic Association, 2019/06
Free full text


785

Cranial Osteopathy: Obscurantism and Enlightenment
Bordoni, B., Morabito, B., Simonelli, M.
Cureus, 2019/05

786

The Other Side of the Fascia: Visceral Fascia, Part 2
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05

787

The Other Side of the Fascia: The Smooth Muscle Part 1
Bordoni, B., Simonelli, M., Morabito, B.
Cureus, 2019/05
Free full text

788

Stress axis and osteopathy: A dual hormone approach
Sampath, K. K., Katare, R., Tumilty, S.
International Journal of Osteopathic Medicine, 2019/05


790

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

791

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text

792

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

793

Das hormonelle Gleichgewicht des Mannes
(Hormonal balance of the man)
Camirand, Nathalie
Osteopathische Medizin, 2019/04

794

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text


796

How and why I apply the Osteopathic Principles In Practice
Hoover, H. V.
The AAO Journal, 2019/03
Free full text

797

Muscle Energy for the Occipitoatlantal Joint
Pierce-Talsma, S., Ji, S., Pearce, M., Talsma, J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

798

Reflecting on new models for osteopathy – it's time for change
Smith, D.
International Journal of Osteopathic Medicine, 2019/03


800

The River of Life: Flüssigkeiten in der Osteopathie
(The river of life: fluids in osteopathy)
Mayer-Fally, E., Knox, C.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03

801

Otitis media
(Otitis media)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2019/03


803

Ist Asymmetrie Dysfunktion?
(Is asymmetry dysfunction?)
Robert, V.
Osteopathische Medizin, 2019/03


805

Symptomatic Approach to Gas, Belching and Bloating with OMT Treatment Options
Gennaro, C., Larsen, H.
Osteopathic Family Physician, 2019/03

806

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

807

Manipulative Therapies: What Works
Smith, M. S., Olives, J., Smith, K.
American Family Physician, 2019/02
Free full text

808

The sacro-iliac joint: A potentially painful enigma. Update on the diagnosis and treatment of pain from micro-trauma
Le Huec, J. C., Tsoupras, A., Leglise, A., Heraudet, P., Celarier, G., Sturresson, B.
Orthopaedics & Traumatology: Surgery & Research, 2019/02

809

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

810

Incorporating a Standardized Online Professionalism Curriculum in Osteopathic Medical School
Riley, B.
The Journal of the American Osteopathic Association, 2019/01
Free full text

811

Der zervikothorakale Übergang
(The cervicothoracic junction)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

812

Welche Elemente charakterisieren die Osteopathie?
(Which elements characterize osteopathy?)
Buekens, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

813

Back to the Roots: Palpation
(Back to the Roots: Palpation)
Eulenberg, J.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01

814

Die Arbeit mit Diaphragmen im Zapchen
(Working with diaphragms through the Zapchen)
Weiß, B.
DO - Deutsche Zeitschrift für Osteopathie, 2019/01


816

Osteopathic Manipulative Medicine Use in Pediatric Patients With Pertussis
Hendriksz, T., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2019/01
Free full text

817

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

818

Somatic Dysfunction: Updating the Concept
Fryer, G.
Australian Journal of Osteopathy, 2019
Free full text




822

Fundamental study of a visceral pericardial osteopathic protocol on heart physiology
Fatisson, J., Mullie, Y., Oswald, V., Gauthier, M., Lalonde, F., Comtois, A. S.
Journal of Complementary and Integrative Medicine, 2018/12
Free full text

823

Osteopathic manipulative treatment: A “fishing expedition“
Ozturk, G. T., Ekiz, T.
Turkish Journal of Physical Medicine and Rehabilitation, 2018/12
Free full text

824

An Osteopathic Approach to Stasis Dermatitis and Chronic Venous Insufficiency
Anderson, Z., Nuno, V., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/12
Free full text





829

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

830

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text

831

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

832

Concussion Evaluation and Management: An Osteopathic Perspective
Zwibel, H., Leder, A., Yao, S., Finn, C.
The Journal of the American Osteopathic Association, 2018/10
Free full text

833

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10

834

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10

835

Die Kunst des Briefschreibens und der Korrespondenz
(The art of letter writing and correspondence)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09
Free full text

836

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text

837

Hebammenarbeit und Osteopathie – Berührungspunkte
(Midwifery and osteopathy - points of contact)
Göggerle-Locher, A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

838

Does Osteopathic Manipulative Treatment Make a Neuropsychological Difference in Adults With Pain? A Rationale for a New Approach
Rizkalla, M. N., Henderson, K. K., Huntington-Alfano, K., Heinking, K. P., Koronkiewicz, A., Knees, M., Hoffman, H., Elahi, F., Impens, A.
The Journal of the American Osteopathic Association, 2018/09
Free full text

839

Behandlungsprotokoll: Interne Behandlung
(Treatment protocol: Internal treatment)
Sonntag, U.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09

840

Wie kam die Kunst in die Osteopathie?
(How did art come into osteopathy?)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


842

Anatomie am Lebenden
(Anatomy on the living object)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09


844

Die Rolle sanfter Berührungen in der perinatalen Osteopathie
(The role of gentle touch in perinatal osteopathy)
McGlone, F., Cerritelli, F., Walker, S., Esteves, J.
Osteopathische Medizin, 2018/09



847

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

848

Was ist Schmerzpsychotherapie?
(What is pain psychotherapy?)
Butz, M., Braun, C., Böger, A.
Osteopathische Medizin, 2018/09

849

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text

850

Commentary: Does my patient have statin associated muscle symptoms (SAMS)?
Di Giorgio, L., Fleischmann, M.
International Journal of Osteopathic Medicine, 2018/09

851

Umgangsformen: Respektvolles und offenes Miteinander
(Manners: Respectful and open interaction)
Brandes, M., Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/09



854

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text

855

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

856

Doming the Diaphragm in a Patient With Multiple Sclerosis
Anderson, Z., Hiserote, R. M., Pierce-Talsma, S.
The Journal of the American Osteopathic Association, 2018/08
Free full text

857

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text


859

Mut zur Muße
(Dare to laze)
Lamersdorf, P. J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


861

Still und das Geheimnis von Gesundheit
(Still and the secret of health)
Lewis, J.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07


863

The Rule of the Artery Is Supreme. Or, Is It?
Rogers, F. J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

864

Reducing Low Back and Posterior Pelvic Pain During and After Pregnancy Using OMT
Smith, M., Galbraith, W., Blumer, J.
The Journal of the American Osteopathic Association, 2018/07
Free full text

865

Addressing the ongoing friction between anecdotal and evidence-based teachings in osteopathic education in Europe
Sposato, N., Shaw, R., Bjersa, K.
Journal of Bodywork and Movement Therapies, 2018/07

866

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07

867

Effect of HVLA on Chronic Neck Pain and Dysfunction
Cabahug, M. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

868

Die Gesundheit in der Osteopathieausbildung
(Health in osteopathic education)
Bock, N.
DO - Deutsche Zeitschrift für Osteopathie, 2018/07

869

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

870

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text

871

The challenges and opportunities of using patient reported outcome measures (PROMs) in clinical practice
Fleischmann, M., Vaughan, B.
International Journal of Osteopathic Medicine, 2018/06

872

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text



875

Osteopathie in Deutschland vor 1945
(Osteopathy in Germany before 1945)
Mildenberger, F. G.
Osteopathische Medizin, 2018/05

876

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text




880

Experiences of pregnant women receiving osteopathic care
Sheraton, A., Streckfuss, J., Grace, S.
Journal of Bodywork and Movement Therapies, 2018/04

881

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

882

Osteopathische Begleitung der Kieferentwicklung
(Osteopathic monitoring of jaw development)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03


884

Leaky Gut und Osteopathie
(Leaky gut and osteopathy)
Huss, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

885

Gesundheit finden
(Finding health)
Krause, R.
Osteopathische Medizin, 2018/03

886

Rethinking Superior and Inferior Sacroiliac Shear: A New Approach to Diagnosis and Treatment
Goldman, S. I., van Buskirk, R. L.
The AAO Journal, 2018/03
Free full text


888

Die Zusammenarbeit von Hebamme und Osteopath
(The collaboration of midwife and osteopath)
Steinfurth, G., Böhringer, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03

889

Interdisziplinäre Zusammenarbeit
(Interdisciplinary collaboration)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2018/03



892

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03

893

Osteopathic manipulative treatment improves function and relieves pain in knee osteoarthritis: A single-blind, randomized-controlled trial
Altınbilek, Turgay
Turkish Journal of Physical Medicine and Rehabilitation, 2018/03
Free full text

894

Nociception, pain, neuroplasticity and the practice of Osteopathic Manipulative Medicine
Pelletier, R., Bourbonnais, D., Higgins, J.
International Journal of Osteopathic Medicine, 2018/03

895

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text

896

Clinical reasoning for complex cervical spine conditions
Reid, D., Rebbeck, T., McCarthy, C.
International Journal of Osteopathic Medicine, 2018/03



899

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

900

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

901

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

902

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

903

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

904

Charlotte Weaver: Forschung zur Schädelwirbeltheorie
(Charlotte Weaver: Research on the cranial vertebra theory)
Engemann, K., Biermann, H.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

905

Pionierinnen der Osteopathie
(Female pioneers in osteopathy)
Quinn, T. A.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

906

Beryl Arbuckle und die kraniale Osteopathie
(Beryl Arbuckle and cranial osteopathy)
Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01



909

Frauen in der osteopathischen Praxis
(Women in osteopathic practice)
Wagner, G.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

910

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

911

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

912

Anne Wales (1904 – 2005)
Dove, C.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

913

Wer war eigentlich Edna M. Lay?
(Who was Edna M. Lay?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2018/01

914




917

Upper Limb Ischemia by Subclavian Artery Dissection after Osteopathic Manipulation
Boulon, C., Maillet, A., Salaun, P., Skopinski, S., Constans, J.
Annals of Vascular Surgery, 2017/12

918

Best uses of osteopathic manipulation
Slattengren, A. H., Nissly, T., Blustin, J., Bader, A., Westfall, E.
The Journal of Family Practice, 2017/12
Free full text

919

What are the risks of manual treatment of the spine? A scoping review for clinicians
Swait, G., Finch, R.
Chiropractic & Manual Therapies, 2017/12
Free full text

920

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text


922

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

923

Lymphatic Pump Treatment of Inflammation in Rat Adjuvant-Induced Arthritis
Volin, M., McAuliffe, R., Zanotti, B.
The Journal of the American Osteopathic Association, 2017/11

924

Measuring Multidimensional Empathy: Theoretical and Practical Considerations for Osteopathic Medical Researchers
Martingano, A. J., Martingano, D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

925

An Osteopathic, Non Pharmacologic Approach to Parkinson’s Disease, Restless Leg Syndrome & Essential Tremor
Goldfinger, M. S., Moriarty, S., DelPlato, K., Yao, S. C., Leder, A., Mancini, J. D.
Osteopathic Family Physician, 2017/11
Free full text

926

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

927

My Stepping “Stone“ to Osteopathic Medicine
Segelnick, J.
The Journal of the American Osteopathic Association, 2017/10
Free full text

928

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

929

Osteopathic manipulative treatment for low back and pelvic girdle pain during and after pregnancy: A systematic review and meta-analysis
Franke, H., Franke, J.D., Belz, S., Fryer, G.
Journal of Bodywork and Movement Therapies, 2017/10

930

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

931

Effect of osteopathic manipulative technique on peak expiratory flow rate, forced expiratory volume in one second among childhood Asthma participants
Shanmugananth, E., Vivek, P. R., Nambi, G., Dev, K., Sridevi, D., Rekha, K.
Biomedicine (India), 2017/10



934

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

935

A Still Technique to Correct Upslipped Innominate Somatic Dysfunctions
Figueroa, J. S., Juba, A. M. H.
The AAO Journal, 2017/09
Free full text

936

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09





941

Single Osteopathic Manipulative Therapy Session Dampens Acute Autonomic and Neuroendocrine Responses to Mental Stress in Healthy Male Participants
Fornari, M., Carnevali, L., Sgoifo, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

942

Osteopathic Manipulative Treatment to Manage Ophthalmic Conditions
Sherman, T., Qureshi, Y., Bach, A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

943

Die Räume des Viszerokraniums
(The rooms of the viscerocranium)
Mayer-Logeman, M.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


945

Das Bewusstsein von Raum
(Spatial awareness)
Steele, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09


947

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

948

Scheinselbstständigkeit in der osteopathischen Praxis
(False self-employment in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09
Free full text

949

Das Nichts zwischen den Dingen – oder was ist Raum?
(The nothingness between things - or what is space?)
Wallbrecht, C., Nehlsen, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

950

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text


952

Raum und Weite im Lernfeld Osteopathie
(Space and width in the learning field of osteopathy)
Brown, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09



955

Die Bedeutung von Raum in der Traumatherapie
(The significance of space in trauma therapy)
Harris, M., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/09

956

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

957

Functional Somatic Syndrome: Assessment and Management
Graver, C. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

958

A Path to Osteopathic Distinction: The Touro California GROUPIE Program
Clearfield, M.
The Journal of the American Osteopathic Association, 2017/08
Free full text

959

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


961

Osteopathic Manipulative Treatment Improves Heart Surgery Outcomes: A Randomized Controlled Trial
Racca, V., Bordoni, B., Castiglioni, P., Modica, M., Ferratini, M.
The Annals of Thoracic Surgery, 2017/07
Free full text

962

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

963

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

964

Adverse Childhood Experiences: A Call to Action for Osteopathic Medicine
St. Germain, D., Rutledge, K. J.
Osteopathic Family Physician, 2017/07
Free full text





969

Reflexionen über Psyche und Geist in der Osteopathie
(Reflections on psyche and mind in osteopathy)
Turner, S., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

970

Kraniozervikomandibulär bedingte Gleichgewichtsstörungen
(Vertigo caused by the cranio-cervico-mandibular complex)
Van Gorp, J., Stöcker, D.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06


972

Osteopathie lindert Wachstumsschmerzen bei Kindern
(Osteopathy relieves growing pains in children)
Renninghoff, A.
Osteopathisch - Zeitschrift für Osteopathen, 2017/06

973

Balance – Grundgesetz und Vollendung der Bewegung
(Balance – fundamental law and completion of movement)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06
Free full text

974

Patienteninfo: Schwindel
(Patient information: Vertigo)
Gehrke, P.
DO - Deutsche Zeitschrift für Osteopathie, 2017/06

975

Bridging the Gap: An Osteopathic Primary Care-Centered Approach to Duchenne Muscular Dystrophy
Carls, C., Krajacic, P.
The Journal of the American Osteopathic Association, 2017/06
Free full text

976

The role of osteopathy in clinical care: Broadening the evidence-base
Steel, A., Blaich, R., Sundberg, T., Adams, J.
International Journal of Osteopathic Medicine, 2017/06

977

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text

978

Effectiveness of OMT and OCMM for temporomandibular disorders
Tang, M. Y., King, H. H.
The Journal of the American Osteopathic Association, 2017/05
Free full text

979

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

980

An Osteopathic Approach to Chronic Pain Management
Jerome, J. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

981

Building Primary Care Research Capacity in a College of Osteopathic Medicine
Nottingham, K. L., Rush, L. J., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/05
Free full text

982

Regulationsstörung
(Infantile colic)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04

983




986

Persistierende frühkindliche Reflexe
(Persistent early childhood reflexes)
Watrin, A.
DO - Deutsche Zeitschrift für Osteopathie, 2017/04


988


989

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text



992

Management of Non-Tropical Sprue: Medical vs Osteopathic
Farnum, D. A.
The AAO Journal, 2017/03
Free full text

993

The importance of pilot studies, how to write them and what they mean
Vogel, S., Draper-Rodi, J.
International Journal of Osteopathic Medicine, 2017/03

994

A process approach in osteopathy: beyond the structural model
Lederman, E.
International Journal of Osteopathic Medicine, 2017/03


996

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03






1002

Pectus Excavatum: A Review of Diagnosis and Current Treatment Options
Abid, I., Ewais, M. M., Marranca, J., Jaroszewski, D. E.
The Journal of the American Osteopathic Association, 2017/02
Free full text


1004

Professional ballet dancers' experience of injury and osteopathic treatment in the UK: A qualitative study
Pollard-Smith, T., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2017/01/01/




1008

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text

1009

Die Architektur der extrazellulären Matrix
(The architecture of the extracellular matrix)
Armstrong, C., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

1010

Osteopathic considerations in the infections of the respiratory tract
Yao, S., Mikhail, N., III, Koutsouras, G., III, Coombs, A., III, Terzella
Osteopathic Family Physician, 2017/01
Free full text

1011

Osteopathie, Krankheit und Gesundheit
(Osteopathy, disease and health)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

1012

Die therapeutische Potency
(Therapeutic potency)
Frymann, V.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01



1015

John Martin Littlejohn: Leben und Werk
(John Martin Littlejohn: life and work)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2017/01

1016

(Thinking, feeling and wanting as component of a treatment)
Krause, R.
Osteopathische Medizin, 2016/12







1023

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

1024

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

1025

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text


1027

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

1028

A model for radiating leg pain of endometriosis
Bove, G. M.
Journal of Bodywork and Movement Therapies, 2016/10

1029

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text


1031

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

1032

Manual therapy and cervical artery dysfunction: Identification of potential risk factors in clinical encounters
Vaughan, B., Moran, R., Tehan, P., Fryer, G., Holmes, M., Vogel, S., Taylor, A.
International Journal of Osteopathic Medicine, 2016/09



1035

Patienteninfo: Leben ist Bewegung
(Patient information: Life is movement)
Mahler, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09



1038

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1039




1042

(Skin cancer: What you should watch out for in your patients)
Schnopp, C., Mempel, M., Baumstark, J.
Osteopathische Medizin, 2016/09


1044

Nuad Boran – die traditionelle thailändische Massage
(Nuad Boran - the traditional Thai massage)
Rouhani, A., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


1046

Haftungsfälle in der osteopathischen Praxis
(Cases of liability in osteopathic practice)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/09


1048

Antimicrobial Stewardship and Osteopathic Medicine: A Call to Action
Orenstein, R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1049

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

1050

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

1051

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text

1052

Manual evaluation of the diaphragm muscle
Bordoni, B., Marelli, F., Morabito, B., Sacconi, B.
International Journal of Chronic Obstructive Pulmonary Disease, 2016/08
Free full text





1057

Psychosomatik und Osteopathie
(Psychosomatics and osteopathy)
Steinfurth, G., Rudner, S.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07
Free full text



1060

Was macht die Psyche somatisch?
(What makes the psyche somatic?)
Vogt, R.
DO - Deutsche Zeitschrift für Osteopathie, 2016/07

1061

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text


1063

Opioid crisis renews interest in osteopathic manipulation
Johnson, S. R.
Modern Healthcare, 2016/07
Free full text


1065

Can The Concept Stand The Test Of Time?
Frymann, V.
The AAO Journal, 2016/06

1066

(The polyvagal theory in osteopathy)
Porges, S. W., Liem, T.
Osteopathische Medizin, 2016/06


1068

Multimodale Schmerztherapie und Osteopathie
(Multimodal pain therapy and osteopathy)
Treptow-Wünsche, S., Böger, A.
Osteopathische Medizin, 2016/06

1069

Beliefs about back pain: The confluence of client, clinician and community
Darlow, B.
International Journal of Osteopathic Medicine, 2016/06

1070

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

1071

Yonder: Advance care planning, osteopathy, HPV vaccination, and international medical graduates
Rashid, A.
British Journal of General Practice, 2016/06
Free full text


1073

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

1074

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1075

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1076

Osteopathic Medical Education and Social Accountability
Phillips-Madson, R., Dharamsi, S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

1077

Fertilitätsstörungen bei Frauen
(Fertility disorders in women)
Koop, C.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


1079

Was ist eigentlich … Body-Mind-Centering®?
(What actually is Body-Mind-Centering®?)
Leinweber, D., Rustler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03



1082

Anmerkungen zu Blechschmidt
(Comments on Blechschmidt)
Mildenberger, F. G.
Osteopathische Medizin, 2016/03

1083

Sensitization and Interoception as Key Neurological Concepts in Osteopathy and Other Manual Medicines
D'Alessandro, G., Cerritelli, F., Cortelli, P.
Frontiers in Neuroscience, 2016/03
Free full text

1084

Patienteninfo: Schilddrüsenunterfunktion
(Patient information: Hypothyroidism)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

1085

Das Oxytocin-System im Laufe des Lebens
(The oxytocin system throughout the course of life)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03


1087

The Glymphatic-Lymphatic Continuum: Opportunities for Osteopathic Manipulative Medicine
Hitscherich, K., Smith, K., Cuoco, J. A., Ruvolo, K. E., Mancini, J. D., Leheste, J. R., Torres, G.
The Journal of the American Osteopathic Association, 2016/03
Free full text


1089

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03



1092

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

1093

Patients' experiences of living with persistent back pain
van Griensven, Hubert
International Journal of Osteopathic Medicine, 2016/03

1094

Die Polyvagal-Theorie
(The Polyvagal Theory)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2016/03

1095

Research Into Osteopathic Manipulative Medicine: Steps on the Evidence Pyramid
Ching, L. M.
The Journal of the American Osteopathic Association, 2016/03
Free full text


1097

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text


1099


1100

Modern Still Life
Pennekamp, A.
The Journal of the American Osteopathic Association, 2016/01
Free full text





1105

Die Faszien im Alter
(Fascia in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

1106

Bluthochdruck im Alter
(Hypertension in old age)
Seidler, J.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

1107

Philosophie der Unsterblichkeit
(Philosophy of immortality)
Still, A. T.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01


1109

Der lange Weg bis ins hohe Alter
(The long walk to old age)
Chandler, P.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

1110

Veränderungen des Immunsystems im Alter
(Changes of the immune system in old age)
Conrath, H.
DO - Deutsche Zeitschrift für Osteopathie, 2016/01

1111

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

1112

Effective Patient-Physician Communication Based on Osteopathic Philosophy in Caring for Elderly Patients
Noll, D. R., Ginsberg, T., Elahi, A., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2016/01
Free full text


1114

Assessment in the final year clinical practicum of an Australian osteopathy program
Vaughan, B., Morrison, T.
International Journal of Osteopathic Medicine, 2015/12







1121

Safeguarding children in osteopathic practice part 2: Managing concerns about children
Feld, A., Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2015/12


1123

The anatomy, biological plausibility and efficacy of visceral mobilization in the treatment of pelvic floor dysfunction
Horton, R. C.
Journal of Pelvic, Obstetric Gynaecological Physiotherapy, 2015/12
Free full text

1124

Scimitar syndrome: A rare explanation for a common symptom with an osteopathic approach
Rivera, N. T., Martin, R. B., Gordon, M.l B., Rajter, J.-J., Bray, N.
International Journal of Osteopathic Medicine, 2015/12



1127

Achilles Tendon Disorders
Saini, S. S., Reb, C. W., Chapter, M., Daniel, J. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

1128

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

1129

2015 Updated Method Guideline for Systematic Reviews in the Cochrane Back and Neck Group
Furlan, A. D., Malmivaara, A., Chou, R., Maher, C. G., Deyo, R. A., Schoene, M., Bronfort, G., van Tulder, M. W.
Spine (Phila Pa 1976), 2015/11

1130

The fascial system and exercise intolerance in patients with chronic heart failure: hypothesis of osteopathic treatment
Bordoni, B., Marelli, F.
Journal of Multidisciplinary Healthcare, 2015/10
Free full text

1131

Reflections on osteopathic fascia treatment in the peripheral nervous system
Bordoni, B., Bordoni, G.
Journal of Pain Research, 2015/10
Free full text


1133




1136

Osteopathie in Auroville
(Osteopathy in Auroville)
Kraus, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1137

Understanding Fibroblasts in Order to Comprehend the Osteopathic Treatment of the Fascia
Bordoni, B., Zanier, E.
Evidence-based Complementary and Alternative Medicine, 2015/09
Free full text




1141

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09


1143

Kinesiologisches Taping in der Osteopathie
(Kinesiology taping in osteopathy)
Seifert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09
Free full text

1144

Rechtliches rund um die osteopathische Praxis: Abrechnung der Behandlung
(Billing of treatment)
Wagner-Burkard, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09



1147

Patienteninfo: Anzeichen für einen Schlaganfall
(Patient information: Signs of a stroke)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1148

Osteopathische Forschung bei Kindern
(Osteopathic research in children)
Coulton, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1149

Im Westen was Neues
(News from the West)
Dick-Wallace, S. F.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1150

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09


1152

Der Zehengang
(Toe walking)
Guerassimiouk, D., Goussel, W., Rega, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/09

1153

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1154

Variations of high frequency parameter of heart rate variability following osteopathic manipulative treatment in healthy subjects compared to control group and sham therapy: randomized controlled trial
Ruffini, N., D'Alessandro, G., Mariani, N., Pollastrelli, A., Cardinali, L., Cerritelli, F.
Frontiers in Neuroscience, 2015/08
Free full text

1155

Modeled Osteopathic Manipulative Treatments: A Review of Their in Vitro Effects on Fibroblast Tissue Preparations
Zein-Hammoud, M., Standley, P. R.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1156

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1157

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text

1158

Das Schleimhaut-assoziierte lymphatische Gewebe (MALT)
(Mucosa Associated Lymphatic Tissue (MALT))
Höppner, J.P., Stark, M.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07

1159

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text


1161

Entzündungsreaktionen aus Sicht der Osteopathie
(Inflammatory reactions from an osteopathic point of view)
Sarzeaud, R., Thon, N., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07
Free full text



1164


1165

Strömung
(Flow)
Geyer, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07


1167

Das Gefäßsystem – ein osteopathischer Ansatz
(The vascular system - an osteopathic approach)
Hayden, L., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/07




1171

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

1172

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

1173

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text


1175

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06




1179

Systematic Review Challenges Efficacy of Pediatric OMT
Martincik, L., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1180

High-Velocity Thrust to the Atlantoaxial Joint Does Not Increase Mechanical Stress on the Vertebral Artery
Guevarra, C. C., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1181

Imaging technology and somatic dysfunction theory
Ho, R. W.
The Journal of the American Osteopathic Association, 2015/05
Free full text

1182

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1183

Wie können wir unsere Wahrnehmung verbessern?
(How can we improve our perception?)
Marris, T., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1184

Darm-Mikrobiota – das vergessene Organ
(Gut microbiota - the forgotten organ)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1185

Was nimmt mein Osteopath wahr?
(What does my osteopath perceive?)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1186

Sutherland
Bordoni, B., Zanier, E.
Advances in Mind-Body Medicine, 2015/04

1187

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1188

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1189

Das Immunsystem – ein System der Wahrnehmung
(The immune system - a system of perception)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1190

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text



1193

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1194

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1195

Was ist eigentlich … Wahrnehmung?
(What actually is perception?)
Engemann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2015/04

1196

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1197

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1198

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

1199

Recognizing the Value of Manual Therapy Interventions in Women's Health: An Interim Report
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1200

Dramatic Reduction in Menstrual Pain After Osteopathic Manipulative Therapy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

1201

OMT—and Placebo—Shown Effective in Reducing Pain During Pregnancy
King, H. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text


1203

Chronic inflammatory disease and osteopathy: a systematic review
Cicchitti, L., Martelli, M., Cerritelli, F.
PLoS One, 2015/03
Free full text


1205

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03

1206


1207

Osteopathic Considerations in the Management of Migraine in Pregnancy
Soshnick, S., Mezzone, C., Yao, S., Abu-Sbaih, R.
Osteopathic Family Physician, 2015/03
Free full text




1211

Ideas, properties, and standards of fracture repositioning with osteopathy in traditional Mongolian medicine in China
Wang, M., Wang, H., Zhao, N.
Journal of traditional Chinese medicine, 2015/02
Free full text


1213

Osteopathic Manipulative Treatment Improves Clinical Response and Lowers Relapse Rates Among Patients With Chronic Low Back Pain
Brohard, J. N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01
Free full text

1214

Osteopathic Manipulative Treatment Is Effective for Nonspecific Low Back Pain
O'Donnell Rosendahl, N., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2015/01


1216

Osteopathische Sterbebegleitung
(Osteopathic terminal care)
Thomas, C.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01
Free full text

1217

Alt geworden oder jung geblieben?
(Grown old or stayed young?)
von Studzinski, I.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1218

Veränderungen im Alter
(Changes in old age)
Wentzke, S.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1219

Patienteninfo: Gute Ernährung für gesundes Altern
(Patient information: Good nutrition for healthy aging)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1220

The hokum of ‘History is more or less bunk’ – A masterclass in historiography
O'Brien, J. C.
International Journal of Osteopathic Medicine, 2015/01

1221

Durch Tanzen anders altern
(Aging differently through dancing)
Gierz, G.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01

1222

Kann die Arbeit mit dem Liquor älteren Patienten helfen?
(Can working with cerebrospinal fluid help elderly patients?)
Grundberg, S., Höflehner-Schnürch, B.
DO - Deutsche Zeitschrift für Osteopathie, 2015/01



1225

Diagnosis and Management of Plantar Fasciitis
Thompson, J. V., Saini, S. S., Reb, C. W., Daniel, J. N.
The Journal of the American Osteopathic Association, 2014/12
Free full text

1226

Adhesive capsulitis: Prospective observational multi-center study on the Niel-Asher technique (NAT)
Niel-Asher, S., Hibberd, S., Bentley, S., Reynolds, J.
International Journal of Osteopathic Medicine, 2014/12

1227

Laser Doppler Flowmetry in Manual Medicine Research
Zegarra-Parodi, R., Snider, E. J., Park, P. Y. S., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/12
Free full text




1231

Doctors of osteopathic medicine (DO): a Canadian perspective
Evren, S., Bi, A. Y., Talwar, S., Yeh, A., Teitelbaum, H.
Canadian Medical Education Journal, 2014/12
Free full text



1234

Safeguarding children in osteopathic practice: Part 1: Identifying children at risk
Maddick, A. F., Feld, A., Laurent, S.
International Journal of Osteopathic Medicine, 2014/12

1235

Reversing the paradox: evidence-based medicine and osteopathic medicine
Parker, J. D.
The Journal of the American Osteopathic Association, 2014/11
Free full text








1243

Effect of myofascial techniques applied to the cranial region on autonomic Nervous System analyzed by Heart Rate Variability
Cantalino, J. L. R., Salgado, A. S. I., Santos, I. R., Oliveira, L. V. F., Oliveira, C. S., Ferreira, L. A. B., Da Silveira, N. J. F., Costa, M. S.
Manual Therapy, Posturology & Rehabilitation Journal, 2014/11
Free full text


1245

Die Bedeutung der Faszien im Hochleistungssport
(The importance of fascia in high-performance sports)
Igel, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text


1247

Osteopathic Manipulative Treatment Induces Enhanced Intracellular Immune Response
Blumer, J.
The Journal of the American Osteopathic Association, 2014/10
Free full text


1249

Dose-Response Research in Chiropractic Care and Possible Comparisons With OMT
King, H. H.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1250

OMT Is Efficacious for Patients With High Baseline Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1251

How to Win the Match Against Tennis Elbow: A Comparison of Different Techniques
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1252

Als Osteopath bei den Olympischen Sommerspielen
(At the Summer Olympics as an Osteopath)
Maurer, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10




1256

Hypnose in Leistungssport und Osteopathie
(Hypnosis in competitive sports and osteopathy)
von Fischern, I.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10

1257

Achillodynie
(Achillodynia)
Corts, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/10
Free full text



1260

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1261

Gray zone: why a delayed acceptance of osteopathic medicine persists in the international community
Gougian, R. L., Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2014/10
Free full text

1262

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09


1264

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text


1266

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text


1268

Osteopathic Primary Care of Patients With Inflammatory Bowel Disease: A Review
Bragg, J. D.
The Journal of the American Osteopathic Association, 2014/09
Free full text


1270

Male spine motion during coitus: implications for the low back pain patient
Sidorkewicz, N., McGill, S. M.
Spine (Phila Pa 1976), 2014/09

1271

Osteopathic manipulative treatment for nonspecific low back pain: a systematic review and meta-analysis
Franke, H., Franke, J.D., Fryer, G.
BMC Musculoskeletal Disorders, 2014/08
Free full text

1272

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text




1276

Osteopathische Annäherung an die Arteriosklerose
(Osteopathic approach to arteriosclerosis)
Elferink, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

1277

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text


1279

Osteopathic musculoskeletal examination and subarachnoid anesthetic administration in a patient with severe scoliosis
Lamberg, J. J., Adhikary, S. D., McFadden, A. T.
The Journal of the American Osteopathic Association, 2014/07
Free full text

1280

Patienteninfo: Herzinfarkt bei Frauen
(Patient information; Heart attack in women)
Gräfin von Pfeil, S.
DO - Deutsche Zeitschrift für Osteopathie, 2014/07

1281

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1283

Introducing a portfolio assessment in a pre-professional osteopathy program
Vaughan, B., Florentine, P., Carter, A.
International Journal of Osteopathic Medicine, 2014/06


1285






1290

Reprint of: Elevating the quality of disability and rehabilitation research: Mandatory use of the reporting guidelines
collective, Authors
International Journal of Osteopathic Medicine, 2014/06
Free full text

1291

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

1292

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text


1294

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text

1295

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text

1296

Manual Therapy Shown to Be Effective for Tension-Type Headache
King, H. H.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1297

OMT Improves Acute Hemodynamic Control in Pregnancy by Means of Improved Venous Return
Seffinger, M. A., Brohard, J. N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1298

G.I. Joe: Could Visceral Osteopathy Help Fight the War against IBS?
Seffinger, M. A., Halbeisen, A. M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1299

Two novel nonsurgical treatments of carpal tunnel syndrome
Schreiber, A. L., Sucher, B. M., Nazarian, L. N.
Physical Medicine and Rehabilitation Clinics of North America, 2014/05

1300

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1301

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

1302

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1304

Schlafstörungen bei Säuglingen und Kindern
(Sleep disorders in infants and children)
Lim, K. W., Schilling, R.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

1305

Das fetale Alkoholsyndrom
(Fetal alcohol syndrome)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04

1306


1307

Hirnnerven und Dysfunktionen des Schädels
(Cranial nerves and dysfunctions of the skull)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2014/04


1309

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text


1311

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text


1313

Creating an osteopathic community with education at its core
Tyreman, S., Cymet, T.
International Journal of Osteopathic Medicine, 2014/03




1317

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text


1319

Preliminary findings on the use of osteopathic manipulative treatment: outcomes during the formation of the practice-based research network, DO-Touch.NET
Degenhardt, B. F., Johnson, J. C., Gross, S. R., Hagan, C., Lund, G., Curry, W. J.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1320

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

1321

The seven-step palpation method: A proposal to improve palpation skills
Aubin, A., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2014/03

1322

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03


1324

Gelenke – ein neuer osteopathischer Ansatz
(Joints - A new osteopathic approach)
Barral, J.P., Croibier, A.
Osteopathische Medizin, 2014/03

1325


1326

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly
Juhl, J. H.
The Journal of the American Osteopathic Association, 2014/02
Free full text


1328

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text

1329

Response to Letter Regarding “Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly“
Noll, D. R.
The Journal of the American Osteopathic Association, 2014/02
Free full text



1332

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1333

Abdominal Muscles Are the Front Side of the Low Back
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1334

Review of Severe Adverse Events From Spinal Manipulative Therapy of the Lumbopelvic Area
King, H. H.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1335

OMT Relieves Severe Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1336

Systematic Review Paints Incomplete Picture of OMT Research
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1337

Manual Therapy or Exercise Effective for Hip or Knee Osteoarthritis
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1338

A Research Primer, Part 2: Guidelines for Developing a Research Project
Yens, D. P., Brannan, G. D, Dumsha, J. Z.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1339

Schuhe und chronische Fußschmerzen im Alter
(Shoes and chronic foot pain in old age)
Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01


1341

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01


1343

Our past, present, and future are in our hands
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2014/01
Free full text

1344

Der lebendige Fuß des Menschen aus osteopathischer Sicht
(The living human foot from an osteopathic perspective)
Wales, A., Mitha, N., Möckel, E.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1345

Der Osteopath am Fuße des Patienten
(The osteopath at the foot of the patient)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1346

Was ist Podo-Postural-Therapie?
(What's Podo-Postural Therapy?)
Weisz, J.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1347

Die Mechanik des Fußes
(The mechanics of the foot)
Zwierzchowska, Z., Vieten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2014/01

1348


1349

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text




1353

Problem-based learning in osteopathic education
Lalonde, F.
International Journal of Osteopathic Medicine, 2013/12

1354

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12

1355

The Fifty Dollar Palpation Lab: An objective assessment tool for first year osteopathic medical students
Surve, S. A., Channell, M. K.
International Journal of Osteopathic Medicine, 2013/12

1356

Axioms, osteopathic culture, and a perspective from geriatric medicine
Noll, D. R., Sthole, H. J., Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2013/12
Free full text

1357

Potential New Dimensions in Dermatology: The Osteopathic Approach to Cutaneous Disease
Michunovich, A. M., Stern, R.
The AAO Journal, 2013/12
Free full text





1362

Plagiozephalie – Ursachen und Hintergründe
(Plagiocephaly - Causes and background)
Künzel, K.H., Hoermann, R.
Osteopathische Medizin, 2013/11


1364

Peer review guidance: how do you write a good review?
Allen, T. W.
The Journal of the American Osteopathic Association, 2013/11
Free full text

1365

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text

1366

Swedenborgs Einfluss auf die Osteopathie
(Swedenborg's influence on osteopathy)
Fuller, D. B.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

1367

„Mein Andrew Taylor Still“
(“My Andrew Taylor Still“)
Girardin, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10

1368

Don't Throw the Baby Out With the Bath Water
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1369

Systematic Review of OMTh for Lower Urinary Tract Symptoms in Women Shows Benefit
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1370

Systematic Review of CAM Approaches to Otitis Media: The Otolaryngology Perspective
King, H. H.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1371

Quantifying Lack of Interexaminer Reliability
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1372


1373




1376


1377

A. T. Still und die Wissenschaft
(A. T. Still and science)
Trowbridge, C.
DO - Deutsche Zeitschrift für Osteopathie, 2013/10


1379

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

1380

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text


1382

Leg Length Discrepancy and Osteoarthritic Knee Pain in the Elderly: An Observational Study
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

1383

Markenstreit beendet
(Brand dispute settled)
Osteopathische Medizin, 2013/09

1384





1388

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text


1390

The effect of OMT on postoperative medical and functional recovery of coronary artery bypass graft patients
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/08
Free full text

1391

Demonstration of Increased Vascular Characteristics Using Bilateral, Multiparameter Sensors After Controlled Vertebral Osteopathic Manipulative Treatment
Heath, D. M., Makin, I. R. S., Pedapati, C., Mast, T. D.
The Journal of the American Osteopathic Association, 2013/08

1392

Further Demonstration of the Benefit of Osteopathic Manipulative Therapy in Pediatric Care
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1393

Visceral Manipulation Is Shown to Reduce Postoperative Ileus in an Animal Model
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1394

Osteopathic Manipulative Therapy Affects the Position of Internal Organs in Humans
King, H. H.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1395

Osteopathic Manipulative Treatment Is Efficacious for Management of Chronic Low Back Pain
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1396

Multimodal Chest Physiotherapy Is Beneficial for Patients Receiving Ventilation
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1397

Manual Therapy Is Beneficial for Cervical Radiculopathy
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1398

Wer waren eigentlich …
(Who actually were ...)
Lewis, J. R.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1399



1401

Okulomotorik und visuelle Teilleistungsstörungen
(Oculomotor and partial visual impairment)
Steinfurth, G.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1402

A research primer: basic guidelines for the novice researcher
Brannan, G. D., Dumsha, J. Z., Yens, D. P.
The Journal of the American Osteopathic Association, 2013/07
Free full text

1403

Die frühkindliche Bewegungsentwicklung
(Early childhood movement development)
Bein-Wierzbinski, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1404


1405

Oxytocingabe während der Geburt und ADHS
(Oxytocin during birth and ADHD)
Fleischer, F.
DO - Deutsche Zeitschrift für Osteopathie, 2013/07

1406

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07






1412

Osteopathie als Kunst?
(Osteopathy as art?)
Novy, R., Sommerfeld, P.
Osteopathische Medizin, 2013/06


1414

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1415

In the hands of an angel
Archer, J. B.
The AAO Journal, 2013/06
Free full text


1417

The liquorodynamic model of the primary respiratory mechanism
Moskalenko, Y. E., Kravchenko, T. I., Weinstein, G. B., Vardy, T. C.
The AAO Journal, 2013/06
Free full text

1418

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

1419

The effect of osteopathic manipulative treatment on postoperative medical and functional recovery of coronary artery bypass graft patients
Wieting, J. M., Beal, C., Roth, G. L., Gorbis, S., Dillard, L., Gilliland, D., Rowan, J.
The Journal of the American Osteopathic Association, 2013/05
Free full text

1420

Back to back: postnatal osteopathic care
Johnson, C.
The Practising Midwife, 2013/05


1422

Manual Therapy May Benefit Women With Primary Dysmenorrhea
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text


1424

Severity of Irritable Bowel Syndrome Symptoms Is Reduced by Osteopathy
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1425

Manual Therapy May Benefit Women With Interstitial Cystitis and Pelvic Floor Pain
King, H. H.
The Journal of the American Osteopathic Association, 2013/04
Free full text



1428

Vaskularisierung der Lendenwirbelsäule
(Vascularization of the lumbar spine)
Rapprich, W.
DO - Deutsche Zeitschrift für Osteopathie, 2013/04

1429

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text


1431

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1432

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1433

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1434

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1435

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

1436

Physicians of the future
Wilson, M.
Missouri Medicine, 2013/04
Free full text

1437

Osteopathic principles: More harm than good?
Evans, D. W.
International Journal of Osteopathic Medicine, 2013/03

1438

Principle driven osteopathy
McChesney, B. D.
International Journal of Osteopathic Medicine, 2013/03


1440

The core principles of osteopathic philosophy
Paulus, S.
International Journal of Osteopathic Medicine, 2013/03

1441

The Biopsychosocial model: Redefining osteopathic philosophy?
Penney, J. N.
International Journal of Osteopathic Medicine, 2013/03

1442

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

1443

Re-evaluating ‘osteopathic principles’
Tyreman, S.
International Journal of Osteopathic Medicine, 2013/03






1449

Suboccipital decompression enhances heart rate variability indices of cardiac control in healthy subjects
Giles, P. D., Hensel, K. L., Pacchia, C. F., Smith, M. L.
The Journal of Alternative and Complementary Medicine, 2013/02
Free full text

1450

Exercise Shown Effective for Management of Neck Pain—Who Needs OMT?
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1451

Visceral Manipulation May Affect Pain Perception
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1452

Frozen Shoulder Treatment—Different Strokes for Different Folks
King, H. H.
The Journal of the American Osteopathic Association, 2013/01
Free full text

1453

Trauma: Betrachtung aus osteopathischer Sicht
(Trauma: Viewed from an osteopathic perspective)
Kleßen, H.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

1454

Osteopathic Fascial Manipulation Reduces Low Back Pain and Increases Kidney Mobility
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/01
Free full text


1456

Abdominal Visceral Manipulation Prevents and Reduces Peritoneal Adhesions
Seffinger, M. A., Martin, A. J.
The Journal of the American Osteopathic Association, 2013/01
Free full text



1459

Management of falls and balance disorders in the elderly
Noll, D. R.
The Journal of the American Osteopathic Association, 2013/01
Free full text




1463

Die Gesundheit im Trauma entdecken
(Discovering health within trauma)
Harris, M.
DO - Deutsche Zeitschrift für Osteopathie, 2013/01

1464

A logical approach to complicated sacral and innominate dysfunction
Klock, G. B.
The AAO Journal, 2012/12
Free full text

1465

The stabilometric platform as a measuring instrument
Huard, Y.
The AAO Journal, 2012/12
Free full text

1466

Anatomie des Thorax
(Anatomy of the thorax)
Beck, M.
Osteopathische Medizin, 2012/12

1467

Osteopathie in Spanien
(Osteopathy in Spain)
Beltran, J. A.
Osteopathische Medizin, 2012/12



1470

Techniken der kardiovaskulären Osteopathie
(Techniques of cardiovascular osteopathy)
Van Den Heede, P., Danjon, J.L.
Osteopathische Medizin, 2012/12

1471

Die Identität der Osteopathie in Europa
(The identity of osteopathy in Europe)
van Dun, P. L. S., Wagner, C.
Osteopathische Medizin, 2012/12

1472

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1473

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1474

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

1475


1476

Still relevant: the profession's characteristics of yesterday and today
Thomas, G.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1477

Management of primary knee osteoarthritis and indications for total knee arthroplasty for general practitioners
Van Manen, M. D., Nace, J., Mont, M. A.
The Journal of the American Osteopathic Association, 2012/11
Free full text

1478

Oral histories: get them live!
Stiger, J. C.
The Journal of the American Osteopathic Association, 2012/11
Free full text


1480

Form-Funktion und die Sache mit der Embryologie
(Form-Function and the matter of embryology)
Höppner, J.P.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10




1484

Die hilflosen Helfer
(Helplessly helping)
Textor, R.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10

1485

Posture and chronic gonalgia in the elderly: contribution of osteopathic treatment
Huard, Y.
Computer Methods in Biomechanics and Biomedical Engineering, 2012/10

1486

Osteopathic manipulative treatment: novel application to dermatological disease
Campbell, S. M., Winkelmann, R. R., Walkowski, S.
Journal of Clinical and Aesthetic Dermatology, 2012/10

1487

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

1488

Heterotaxien in der menschlichen Entwicklung
(Heterotaxies in human development)
Doll, S.
DO - Deutsche Zeitschrift für Osteopathie, 2012/10



1491








1498

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09


1500

The biology of manual therapies
Clark, B. C., Thomas, J. S., Walkowski, S. A., Howell, J. N.
The Journal of the American Osteopathic Association, 2012/09
Free full text

1501

Consent, competence and confidentiality for children and young people: Case problems from osteopathic practice
Maddick, A. F., Laurent, S.
International Journal of Osteopathic Medicine, 2012/09

1502

Vertebral and internal carotid artery flow during vascular premanipulative testing using duplex Doppler ultrasound measurements: A systematic review
Malo-Urriés, M., Tricás-Moreno, J. M., Lucha-López, O., Estébanez-de-Miguel, E., Hidalgo-García, C., Pérez-Guillén, S.
International Journal of Osteopathic Medicine, 2012/09

1503

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1504

Three-Dimensional Analysis of OMT in the Post–Total Arthroplasty Knee
Simela, A.
The Journal of the American Osteopathic Association, 2012/08

1505

Touch--more than a basic science
Elkiss, M. L., Jerome, J. A.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1506

Topografie des weiblichen Beckens
(Topography of the female pelvis)
Lütjen-Drecoll, E.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1507

Stressinkontinenz nach einer Geburt
(Stress incontinence after childbirth)
Mitha, N.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1509

Packende Fachartikel – So geht es
(Writing gripping professional articles - Here's how)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07


1511

Patienteninfo: Beckenbodenübungen
(Patient information: pelvic floor exercises)
Vleminckx, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1512

From clinical experience to a model for the human fascial system
Day, J. A., Copetti, L., Rucli, G.
Journal of Bodywork and Movement Therapies, 2012/07

1513

Trauma: Sexuelle Gewalt und ihre Folgen
(Trauma: Sexual Violence and its aftermath)
Dietrich, B.
DO - Deutsche Zeitschrift für Osteopathie, 2012/07

1514

Somatic dysfunction and its association with chronic low back pain, back-specific functioning, and general health: results from the OSTEOPATHIC Trial
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1515

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1516

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


1518

A consideration of the elbow as a tensegrity structure
Scarr, G.
International Journal of Osteopathic Medicine, 2012/06

1519

Differenzialdiagnostik manualmedizinischer Syndrome bei unteren Rückenschmerzen unter Einbeziehung osteopathischer Verfahren
(Manual-medical differential diagnosis of low back pain including osteopathic procedures)
Buchmann, J., Arens, U., Harke, G., Smolenski, U. C., Kayser, R.
Sportverletzung Sportschaden: Organ der Gesellschaft für Orthopädisch-Traumatologische Sportmedizin, 2012/06





1524

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1525

Dermatology: a specialty that exemplifies the osteopathic medical profession
Campbell, S. M., Sammons, D. L., Sarsama-Nixon, R. M., Holsinger, J. M., Stephenson, S., Walkowski, S.
The Journal of the American Osteopathic Association, 2012/05
Free full text




1529

Kopfschmerzforschung – ein Update
(Headache research - an update)
Luthin, D.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04



1532

Zeitmanagement – Entschleunigen Sie Ihr Leben!
(Time management - slow down your life!)
Schopf, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/04

1533

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text


1535

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text



1538

Osteopathie und Wissenschaft
(Osteopathy and science)
Liem, T., Hilbrecht, H., Schmidt, T.
Osteopathische Medizin, 2012/03



1541

Osteopathie in Belgien
(Osteopathy in Belgium)
van Dun, P. L. S.
Osteopathische Medizin, 2012/03

1542

Selected fascial aspects of osteopathic practice
Tozzi, P.
Journal of Bodywork and Movement Therapies, 2012/03
Free full text

1543

Reflex Relationships of Paravertebral Muscles
Elbe, J. N.
The AAO Journal, 2012/03
Free full text

1544

The Ram of Reason Seal: Musings on its Origin and Meaning
Hruby, R. J.
The AAO Journal, 2012/03
Free full text

1545

Spontaneous Release by Positioning
Jones, L. H.
The AAO Journal, 2012/03
Free full text

1546

The Neural Basis of the Osteopathic Lesion
Korr, I. M.
The AAO Journal, 2012/03
Free full text

1547

Structural Pelvic Function
Mitchell, F. L.
The AAO Journal, 2012/03
Free full text

1548

The Role of the Fascae in the Maintenance of Structural Integrity
Page, L. E.
The AAO Journal, 2012/03
Free full text

1549

Osteopathic Rhythmic Resistive Duction Therapy
Ruddy, T. J.
The AAO Journal, 2012/03
Free full text

1550

Respiratory and Circulatory Care: The Conceptual Model
Zink, J.G.
The AAO Journal, 2012/03
Free full text

1551

Osteopathic lymphatic pump techniques to enhance immunity and treat pneumonia
Hodge, L. M.
International Journal of Osteopathic Medicine, 2012/03





1556

Osteopathie studieren – wieso, weshalb, warum?
(Why study osteopathy?)
Meyer, B., Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02



1559

Thanks, but no thanks: how denial of osteopathic service in World War I and World War II shaped the profession
Silver, S. A.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1560

Keep it simple!
(Keep it simple!)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1561

Osteopathische Institutionen in Deutschland
(Osteopathic institutions in Germany)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


1563

Identität der Osteopathie in Deutschland
(Osteopathic identity in Germany)
Ginten, M.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02

1564

Osteopathische Berührung im Spiegel der Supervision
(Osteopathic touch in the mirror of supervision)
Hähn-Jakobs, C.
DO - Deutsche Zeitschrift für Osteopathie, 2012/02


1566

The Scope of Osteopathic Practice in Europe
van Dun, P. L. S., Kouwenberg, T.
European Federation of Osteopaths (EFO) & Forum for Osteopathic Regulation in Europe (FORE), 2012/01
Free full text


1568

Effect of OMT on Heart Rate in Normotensive and Prehypertensive Individuals
Siu, V. N., Cooper, A., Rezk, M., Terzella, M., Yao, S. C., Gilliar, W.
The Journal of the American Osteopathic Association, 2012/01



1571

Effect of cranial osteopathic manipulative medicine on cerebral tissue oxygenation
Shi, X., Rehrer, S., Prajapati, P., Stoll, S. T., Gamber, R. G., Downey, H. F.
The Journal of the American Osteopathic Association, 2011/12
Free full text

1572

Orthopedie dento-faciale et osteopathie.
(Dento-facial orthopedics and osteopathy)
Fournier, R., Aknin, J.J., Bourgier, S., Gebeile-Chauty, S.
L' Orthodontie francaise, 2011/12

1573

Manipulative Methods of Dr. A.T. Still
Archer, J.
The AAO Journal, 2011/12
Free full text

1574

What is health? What is disease? Thoughts on a complex issue
Flatscher, M., Liem, T.
The AAO Journal, 2011/12
Free full text

1575

Sacroiliac joint sparing in a patient with ankylosing spondylitis – An osteopathic approach
Ishii, J., Ehrenfeuchter, W. C., Olds, K. M., Berkowitz, M. R.
The AAO Journal, 2011/12
Free full text



1578

Osteopathie in Österreich
(Osteopathy in Austria)
Schulmeyer, A.
Osteopathische Medizin, 2011/12


1580

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1581

Innenstrukturen des Thorax
(Internal structures of the thorax)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1582

Steuerungsorgan Zwerchfell
(Control organ diaphragm)
Büsser, M.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10


1584

Atmung und obere Thoraxöffnung
(Breathing and upper thoracic opening)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10

1585

Lungen: Form und Funktion in der osteopathischen Praxis
(Lungs: Form and function in osteopathic practice)
Kuhlmann, C., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/10



1588

Lymphatic pump treatment enhances the lymphatic and immune systems
Hodge, L. M., Downey, H. F.
Experimental Biology and Medicine (Maywood, N.J.), 2011/10

1589

Patterns of chronic pain in the population
Carnes, D.
International Journal of Osteopathic Medicine, 2011/09

1590

Contribution of osteopathic medicine to care of patients with chronic wounds
Anglund, D. C., Channell, M. K.
The Journal of the American Osteopathic Association, 2011/09
Free full text

1591

Qualitative research: Exploring the multiple perspectives of osteopathy
Thomson, O. P., Petty, N. J., Ramage, C. M., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/09

1592

An osteopathic approach to type 2 diabetes mellitus
Shubrook, J. H., Jr., Johnson
The Journal of the American Osteopathic Association, 2011/09
Free full text


1594

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text





1599

Sutherland’s Signature
Stark, J.
The AAO Journal, 2011/09
Free full text


1601

Técnica articular para disfunción de malar en eversión
(Articular technique for zygoma in eversion dysfunction)
Antolinos Campillo, P. J., Baño Alcaraz, A., Pascual-Vaca, J. O.
Osteopatía Científica, 2011/09

1602

Técnica de thrust occipitomastoidea
(Occipital-mastoid thrust technique)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/09


1604

Effects of Osteopathic Cranial Manipulation on Biogenic Amine Levels, Heart Rate, and Blood Pressure in Adult Humans
Semeniken, K. R., Miller, P. A., Fuhrer, J. M., Farris, D.A., Parry, M. J., Petros, V., Corso, T.
The Journal of the American Osteopathic Association, 2011/08

1605

Lymphatic Pump Treatment of Rats With Adjuvant-Induced Arthritis
Shah, P., Zanotti, B., Woods, J. M., Volin, M.
The Journal of the American Osteopathic Association, 2011/08

1606

Der Wille des Patienten steht über allem
(The patient's will is above all else)
Böser, C.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07


1608


1609


1610

Lymphsystem und osteopathische Forschung
(Lymphatic system and osteopathic research)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2011/07

1611

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text



1614


1615

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text


1617

Diagnostic reliability in osteopathic medicine
Lucas, N. P., Bogduk, N.
International Journal of Osteopathic Medicine, 2011/06

1618

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

1619

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

1620

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text






1626

Jenette “Nettie” Bolles: First woman to pioneer osteopathy
Blumer, J.
The AAO Journal, 2011/06
Free full text





1631

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1633

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1634

Tug technique de escafoides para escafoides en rotación externa
(The Tug navicular technique for externally rotated navicular bones)
Baño Alcaraz, A., Antolinos Campillo, P. J., Oliva Pascual-Vaca, J.
Osteopatía Científica, 2011/05




1638

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text


1640

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1641

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1642

Was ist eigentlich …
(What actually is ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1643

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1644




1647

Das Urheberrecht (UrhG)
(Copyright law (UrhG))
Ulusal, S.
DO - Deutsche Zeitschrift für Osteopathie, 2011/04

1648


1649

Is a postural-structural-biomechanical model, within manual therapies, viable?: A JBMT debate
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2011/04

1650

Invited response: (without science, there must be art)
Hannon, J. C.
Journal of Bodywork and Movement Therapies, 2011/04

1651

Invited response (the postural structural model, with boundary conditions)
Irvin, R. E.
Journal of Bodywork and Movement Therapies, 2011/04


1653

Invited response (evidence and clinical experience: the challenge when they conflict)
Lee, D.
Journal of Bodywork and Movement Therapies, 2011/04

1654

Invited response
McGill, S.
Journal of Bodywork and Movement Therapies, 2011/04

1655

Helical tensegrity as a structural mechanism in human anatomy
Scarr, G.
International Journal of Osteopathic Medicine, 2011/03



1658

Current and distinctive terminology: osteopath and physician
Walkowski, S. A.
The Journal of the American Osteopathic Association, 2011/03
Free full text


1660

Invited response.
Fryer, G.
Journal of Bodywork and Movement Therapies, 2011/03

1661

Manual therapy of the mandibular accessory ligaments for the management of temporomandibular joint disorders
Cuccia, A. M., Caradonna, C., Caradonna, D.
The Journal of the American Osteopathic Association, 2011/02
Free full text






1667




1670

Wer war eigentlich …
(Who actually was ...)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2011/02

1671

A randomized controlled trial investigating the effects of craniosacral therapy on pain and heart rate variability in fibromyalgia patients
Castro-Sánchez, A. M., Matarán-Peñarrocha, G. A., Sánchez-Labraca, N., Quesada-Rubio, J. M., Granero-Molina, J., Moreno-Lorenzo, C.
Clinical Rehabilitation, 2011/01

1672

Osteopathy and (hatha) yoga
Liem, T.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text




1676

Quality of Life in aged with low back pain treated with osteopathy
Santos, P. O. dos, Cader, S. A., Mello, D. B. dos, Sousa, M. J. M. dos, Coelho, E. S., Dantas, E. H. M.
Revista Terapia Manual, 2011



1679

An Osteopathic Approach to Hypothyroidism
Burns, D. K.
The AAO Journal, 2010/12
Free full text

1680

Restoration of a McManis Treatment Stool
Clark, R. C.
The AAO Journal, 2010/12
Free full text



1683

Atypical Pathologic Somatic Dysfunctions: Techniques Revisited
Miller, D. S.
The AAO Journal, 2010/12
Free full text


1685

Thoracic outlet syndrome part 1: Clinical manifestations, differentiation and treatment pathways
Watson, L. A., Pizzari, T.
International Journal of Osteopathic Medicine, 2010/12

1686

Toward an osteopathic psychiatry: the biocognitive model of mind
McLaren, N.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1687

Mississippi welcomes first osteopathic medical school
Evers, K. A.
Journal of the Mississippi State Medical Association, 2010/11

1688

Das Schädeldach als Tensegrity-Struktur
(The cranial roof as a tensegrity structure)
Scarr, G., Hinz, K.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1689

Hinweise auf eine fasziale Rhythmizität?
(Evidence of fascial rhythmicity?)
Schleip, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1690

Knochen wie Kontinentalschollen
(Bones like continental floes)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1691

Anatomische Gesichtspunkte zur harten Hirnhaut
(Anatomical viewpoints on the hard meninges)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1692



1694

Hirnschädel und Menschsein
(Neurocranium and being human)
Fischer, T.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1695

Auf der Suche nach der Mittellinie
(Searching for the midline)
Kaiser, F.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1696

Suturen des Hirnschädels
(Sutures of the cranium)
Porthun, J.
DO - Deutsche Zeitschrift für Osteopathie, 2010/10

1697

Italian osteopathy--an exciting European example
Chaitow, L.
Journal of Bodywork and Movement Therapies, 2010/10
Free full text


1699

Placebo: Missverständnisse und Vorurteile
(Placebo: Misconceptions and prejudices)
Breidert, M., Hofbauer, K.
Osteopathische Medizin, 2010/09




1703

Dig on: A Case Study
Kolkhorst, A. B., Kary, D. J.
The AAO Journal, 2010/09
Free full text


1705

Tensegrity in der Osteopathie
(Tensegrity in osteopathy)
Pflüger, C.
Osteopathische Medizin, 2010/09

1706

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09


1708

Alzheimer disease: update on basic mechanisms
Bi, X.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1709

Técnica de lift-off para dorsales medias (T4-T10)
(Lift off technique in medium dorsal vertebrae (T4-T10))
Iglesias, J. G., del Cerro, L. P., Rodríguez Blanco, C.
Osteopatía Científica, 2010/09

1710

Alzheimer disease: the crisis is upon us
Simpkins, J. W., Wood, B. E., Balin, B. J.
The Journal of the American Osteopathic Association, 2010/09
Free full text

1711

A ‘system based’ approach to risk assessment of the cervical spine prior to manual therapy
Taylor, Alan J., Kerry, R.
International Journal of Osteopathic Medicine, 2010/09

1712

The Kirksville experience: where osteopathic medicine began
Slocum, P. C.
Missouri Medicine, 2010/08-07


1714

Differential Effects of Suboccipital Inhibition and Fourth Ventricle Compression On Heart Rate Variability: Evidence For Bi-Directional Modulation Of Autonomic Tone
Snider, E. J., Snider, K. T., Halma, K. D., Fossum, C., Fryer, G., Yang, Q., Mueller, G., Bluml, E. M., Purcell, E.
The Journal of the American Osteopathic Association, 2010/08

1715

Notes on visceral adhesions as fascial pathology
Hedley, G.
Journal of Bodywork and Movement Therapies, 2010/07

1716

Der Gesichtsschädel
(Patient information: The viscerocranium)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1717

The Fickle finger of quackery in otology: the saga of Curtis H. Muncie, Osteopath
Swamy, R. S., Jackler, R. K.
Otology & Neurotology, 2010/07


1719

Was sind eigentlich... Viszera?
(What actually are viscera?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07
Free full text


1721

Zum Aufbau des Gesichts
(Regarding the facial structure)
Fanghänel, J., Eigenwillig, P., Proff, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1722



1724

Entwicklung des Viszerokraniums
(Development of the viscerocranium)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/07

1725

What is 'manipulation'? A reappraisal
Evans, D. W., Lucas, N.
Manual Therapy, 2010/06
Free full text

1726

The application of osteopathic treatments to pediatric sports injuries
Bolin, D. J.
Pediatric Clinics of North America, 2010/06
Free full text



1729

The Superior Serratus Anterior: An Obscure Cause of Persistent Shoulder and Upper Thoracic Pain
Dominello, M. M., Kary, D. J.
The AAO Journal, 2010/06
Free full text

1730

Principles of Osteopathy in the Battlefield
Kozminski, M.
The AAO Journal, 2010/06
Free full text

1731




1734

The biopsychosocial model of pain and contemporary osteopathic practice
Penney, J. N.
International Journal of Osteopathic Medicine, 2010/06



1737

When to consider osteopathic manipulation
Cole, S., Reed, J.
The Journal of Family Practice, 2010/05


1739

The challenges of primary care and innovative responses in osteopathic education
Shannon, S. C., Ferretti, S. M., Wood, D., Levitan, T.
Health Affairs, 2010/05

1740

Modifying the effects of cerebral palsy: the Gregg Mozgala story
Chaitow, L., Rogoff, T., Mozgala, G., Chmelik, S., Comeaux, Z., Hannon, J., Lederman, E., Myers, T.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text

1741

Klinische Relevanz statt Placebo-Kontrolle
(Clinical relevance instead of placebo control)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1742

Morbus Sudeck und Osteopathie?
(Complex Regional Pain Syndrome and Osteopathy?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1744

Störungsketten im Bindegewebe
(Patient information: Disruptive chains in the fascia)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04


1746

Was ist eigentlich... intrinsische Bewegung?
(What actually is intrinsic movement?)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1747

(The osteopathic holistic approach to homeostasis, part 1)
Zink, J. G.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04

1748

PCMH: a revolutionary model of care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2010/04
Free full text

1749

Kontraktilität von Faszien
(Contractility of Fascias – How is This Behavior Possible?)
Brand, E.M.
DO - Deutsche Zeitschrift für Osteopathie, 2010/04




1753

Osteopathic Manipulative Treatment In the Emergency Department: A Two-Dimensional Curriculum
Mesisca, M., Hoffman, K., Fenati, G., Hruby, R. J.
The AAO Journal, 2010/03
Free full text



1756

Composite sacroiliac joint pain provocation tests: A question of clinical significance
McGrath, M. C.
International Journal of Osteopathic Medicine, 2010/03

1757

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1758

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1759

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1760

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1761

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

1762

Performing arts medicine--instrumentalist musicians, Part II--examination
Dommerholt, J.
Journal of Bodywork and Movement Therapies, 2010/01


1764

Fascia: A missing link in our understanding of the pathology of fibromyalgia
Liptan, G. L.
Journal of Bodywork and Movement Therapies, 2010/01
Free full text

1765

Ist das Bindegewebe ein Organ?
(Patient information: Is fascia an organ?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01


1767

Bioethics: a patient advocate role for Osteopathic Family Physicians
Abramson, L. J.
Osteopathic Family Physician, 2010/01


1769

Das Fasziendistorsionsmodell nach Stephen Typaldos
(The Fascial Distortion Model According to Stephen Typaldos)
Fischer, T., Rossmy, C., Anker, S.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01

1770

Gary Fryer –”...there is not much that we can say without any doubt.”
Franke, H.
DO - Deutsche Zeitschrift für Osteopathie, 2010/01



1773



1775

Masterclass: HIV-infection and osteopathy
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/12



1778

Dr. A. T. Still’s Treating Chair
Archer, J.
The AAO Journal, 2009/12
Free full text

1779

El Savador Mission Trip - Infant’s Wheeze gets relief with Osteopathic Manipulation
O'Brien, M., Haman, J.
The AAO Journal, 2009/12
Free full text

1780

There Are More Things in Heaven and Earth…
Ching, L. M.G.
The AAO Journal, 2009/12
Free full text


1782

The Transversus Thoracis Muscle in Humans
Kary, D. J.
The AAO Journal, 2009/12
Free full text



1785

Leben ist Bewegung
(Life is movement)
Gillemot, B., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1786

Klassische Osteopathie versus Sportosteopathie
(Classical Osteopathy versus Sports Osteopathy)
Hemar, E., Schmidt, T., McKone, W. L., Fetzer, J.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1787

Osteopathie für Pferd und Reiter
(Osteopathy for Horse and Rider)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10


1789

Manipulation vor dem Wettkampf?
(Manipulative treatment before the competition?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1790

Osteopathie im Sport
(Osteopathy in sports)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1791

Das vegetative Nervensystem und Sport
(The Vegetative Nervous System and Sports)
Schmidt, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1792

Leistung optimieren: Osteopathie und Sport
(Optimizing performance: Osteopathy and sports)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/10

1793

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1794

A descriptive account of the development of an osteopathic service within a hospital HIV day care centre
Blanchard, P. D.
International Journal of Osteopathic Medicine, 2009/09

1795

The functions of breathing and its dysfunctions and their relationship to breathing therapy
Courtney, R.
International Journal of Osteopathic Medicine, 2009/09




1799


1800

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1801

Understanding the Process of Fascial Unwinding
Minasny, B.
International Journal of Therapeutic Massage and Bodywork, 2009/09
Free full text

1802

La langue : déglutition, fonctions oro-faciales, croissance crânio-faciale
(The tongue: deglutition, orofacial functions and craniofacial growth)
Landouzy, J.M., Sergent Delattre, A., Fenart, R., Delattre, B., Claire, J., Biecq, M.
International Orthodontics, 2009/09

1803

Human Volume Tissue Investigation Method
Mokhov, D. E., Chashchin, A. V., Erofeev, N. P., Vcherashny, D. B.
The AAO Journal, 2009/09
Free full text

1804


1805

Análisis de la fiabilidad palpatoria del pulso en la arteria radial mediante sonografía Doppler
(Analysis of the reliability of radial artery pulse palpation through Doppler sonography)
Cortés Vega, M. D., Rodríguez Blanco, C., González García, P., Ribelles Mayo, J., Pascual-Vaca, Á. O.
Osteopatía Científica, 2009/09


1807

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text

1808

Time for the osteopathic profession to take the lead in musculoskeletal research
Licciardone, J. C.
Osteopathic Medicine and Primary Care, 2009/07
Free full text


1810

Osteopathische Behandlung akuter Erkrankungen
(Osteopathic Treatment of Acute Diseases)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1811

Magenulkus
(Gastric ulcer)
Hirth, T.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1812

Vincent Benedetto – Die Basis der Osteopathie
(Vincent Benedetto - The basis of osteopathy)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07


1814

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1815

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1816

Grundlagen der Entzündungspathologie
(Basics of the Pathology of Inflammation)
Siegert, S.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

1817



1819

Die gewollte Spaltung
(Deliberate division)
Gröbmüller, J.
Osteopathische Medizin, 2009/06


1821

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

1822

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

1823

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

1824

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text

1825

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text

1826

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text


1828

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text






1834


1835

Scapular Glide: Functional relationships, dysfunction and treatment
Kary, D. J.
The AAO Journal, 2009/06
Free full text

1836

Osteopathic approach to the spleen
Peeters, L., Lason, G.
The AAO Journal, 2009/06
Free full text



1839

Classroom lectures - where are the students and don't they care?
Reed, K.
Iowa Medicine: Journal of the Iowa Medical Society, 2009/03-04

1840

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1841

Osteopathy in Australasia: From marginality to a fully professionalised system of health care
Baer, H. A.
International Journal of Osteopathic Medicine, 2009/03

1842

Therapeutic needling in osteopathic practice: An evidence-informed perspective
Rickards, L. D.
International Journal of Osteopathic Medicine, 2009/03

1843

A Case History of Recent Problem Breathing and Special OMT for the Heart
Chapello, I. A.
The AAO Journal, 2009/03
Free full text

1844

The Integration of Undergraduate Osteopathic Manipulative Medicine Fellows into Medical Education: The KCUMB-COM Model
Cox, W. J., Boyajian-O'Neill, L. A., Roach, M. D., Ridgley, J. A.
The AAO Journal, 2009/03
Free full text


1846

WPO: Ein Meilenstein näher betrachtet
(WPO: A closer look at a milestone)
Fuhrmann, M., Weynen, R., von Tümpling, U.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1847

Geteilte Aufmerksamkeit
(Divided Attention)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1848

Das Handgelenk, eine Betrachtung
(The Wrist, a Reflection)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03


1850

Osteopathische Informationsquellen
(Osteopathic sources of information)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03

1851



1853

Palpation zwischen Struktur und Energie
(Palpation between Structure and Energy)
Weber, K. G.
DO - Deutsche Zeitschrift für Osteopathie, 2009/03
Free full text

1854

Brachial plexus injuries in neonates: an osteopathic approach
Mason, D. C., Ciervo, C. A.
The Journal of the American Osteopathic Association, 2009/02
Free full text


1856

Osteopathie und (Hatha-)Yoga
(Osteopathy and (Hatha) yoga)
Liem, T.
Osteopathische Medizin, 2009/02

1857

Die Leber – mehr als GOT und GPT?
(The liver – more than GOT and GPT?)
Preuße, U., Giebel, J.
Osteopathische Medizin, 2009/02



1860

Comparing Changes in Serum Nitric Oxide Levels and Heart Rate After Osteopathic Manipulative Treatment (OMT) Using the Dalrymple Pedal Pump to Changes Measured After Active Exercise
Overberger, R., Hoyt, J. A., Daghigh, F., Bell, M., Schoenfeldt, B., Bailey, J. W., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2009/01

1861

DO • Korrespondenten berichten
(DO • Correspondents reporting)
Jevbratt, M.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01
Free full text

1862

Osteopathische Früherkennung
(Osteopathic early detection)
Bayer, C.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01




1866

Osteopathie bei Frühgeborenen
(Osteopathy with Premature Infants)
Lamberts, A.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01



1869

Hilfe – mein Kind ist schief!
(Help - my child is crooked!)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/01

1870

Muscle Impulse, A Muscle Energy Variant
van Buskirk, R. L.
The AAO Journal, 2008/12
Free full text

1871

Hamo-study i: investigation of the effect of breathing on the position of the heart
Roncada, G., Bijnens, E., Dendale, P., Buekens, J.
International Journal of Osteopathic Medicine, 2008/12

1872

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12

1873

Study on the effectiveness of a test-dependent osteopathic treatment for women with persistent post partum back pain: A randomized controlled trial
Recknagel, C., Roß, J., Recknagel, A., Ruetz, M., Schwerla, F.
International Journal of Osteopathic Medicine, 2008/12



1876

Blocking categoría SOT 2 de M.B. Dejarnette
(M.B. Dejarnette's Blocking category SOT 2)
Rivas Cano, L., Breitschwerdt, C.
Osteopatía Científica, 2008/12




1880

Kinder!
(Children!)
Hebgen, E.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1881

Unsere Haut – Bau und Leistungen, Teil 2
(Our Skin – Structure and Performance, Part 2)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1882

Framingham–Studie
(Framingham Study)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1883

Diagnosis and management of piriformis syndrome: an osteopathic approach
Boyajian-O'Neill, L. A., McClain, R. L., Coleman, M. K., Thomas, P. P.
The Journal of the American Osteopathic Association, 2008/11
Free full text


1885

Die drei Säulen der Y–Fuge der Säuglingshüfte
(The Three Pillars of the Hypsiloid Cartilage of the Hip of Infants)
Schwerdtner, H.P., Watzl, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1886

Säuglinge sind Viszera
(Infants are Viscera)
Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2008/11

1887

Short-term hematologic and hemodynamic effects of osteopathic lymphatic techniques: a pilot crossover trial
Rivers, W. E., Treffer, K. D., Glaros, A. G., Williams, C. L.
The Journal of the American Osteopathic Association, 2008/11
Free full text





1892

Legg reduction maneuver for patients with anterior shoulder dislocation
Dyck Jr., D. D., Porter, N. W., Dunbar, B. D.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1893

Prevention, diagnosis, and management of osteoporosis-related fracture: a multifactoral osteopathic approach
Gronholz, M. J.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1894

The endocannabinoid system: an osteopathic perspective
McPartland, J. M.
The Journal of the American Osteopathic Association, 2008/10
Free full text

1895

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text

1896

Osteopathic Medicine and the Geriatric Patient
Hruby, R. J.
The AAO Journal, 2008/09
Free full text

1897

Valuing osteopathy: What are (our) professional values and how do we teach them?
Tyreman, S.
International Journal of Osteopathic Medicine, 2008/09

1898

Whose values are we teaching? Deconstructing responsibilities and duties of teachers of osteopathy
Sommerfeld, P.
International Journal of Osteopathic Medicine, 2008/09


1900

Techniken für Orbita und Auge
(Techniques for Orbita and Eyes)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1901

Unsere Haut – Bau und Leistungen Teil 1
(Our Skin – Structure and Performance, Part 1)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1902

Einschneidende Rituale
(Drastic Rituals)
Knöppler, K.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1903

Querschnitt– und Längsschnittstudien
(Cross-sectional and longitudinal studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08

1904


1905

Zwischen innen und außen: die Haut
(Between inside and outside: the skin)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/08



1908

Osteopathic approach to diastolic heart failure
McCombs, T. M.
The Journal of the American Osteopathic Association, 2008/08
Free full text







1915

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text


1917


1918

Complementary, holistic, and integrative medicine: therapies for acute otitis media
Bukutu, C., Deol, J., Vohra, S.
Pediatrics in Review, 2008/06

1919

The Cranial Plunger Theory
Burns, D. K.
The AAO Journal, 2008/06
Free full text

1920


1921

“Poiseuille’s Panacea”: a New Direction in Osteopathic Manipulation of the Thorax
McCombs, T. M., Towne, S., Treece, M.
The AAO Journal, 2008/06
Free full text

1922

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text

1923

The Osteopath Should Find Health
Höppner, J.P.
Osteopathische Medizin, 2008/05




1927

Das Herz - mehr als nur eine Pumpe
(The Heart - More Than Just a Pump)
Fraval, M., Norrie, A., del Pilar Munoz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04


1929

Retrospektive und prospektive Studien
(Retrospective and prospective studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04

1930

Das komplexe regionale Schmerzsyndrom
(The complex regional pain syndrome)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04


1932

Wunderwerkzeug Hand
(Miracle tool hand)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/04



1935

Autistic Spectrum Disorder
Sorrell, M. A.
The AAO Journal, 2008/03
Free full text


1937

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1938

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

1939

Die osteopathische Dysfunktion der Arterie
(Osteopathic Dysfunction of the Arteries)
Chauffour, P., Prat, E., Michaud, J.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1940

Medical conditions in works of art
Salter, V., Ramachandran, M.
British Journal of Hospital Medicine, 2008/02


1942

Entwicklung von Blut- und Lymphgefäßen
(The Development of Blood and Lymph Vessels)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1943

Die visuelle Analogskala
(The visual analog scale)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1944

Eigenrhythmizität von Blutgefäßen
(The Innate Rhythmicity of Blood Vessels)
Schmid-Schönbein, H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02

1945

Arterienbehandlung bei Bluthochdruck
(Arterial treatment for hypertension)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02




1949

Der Rhythmus des Blutflusses
(The Rhythm Of Perfusion)
Wyvekens, M.
DO - Deutsche Zeitschrift für Osteopathie, 2008/02


1951

Slow-Thrust Technik
(Slow thrust technique)
Dräger, K.
Osteopathische Medizin, 2008/01

1952

Die Gleitfähigkeit subkutaner Strukturen beim Menschen – eine Einführung
(Introduction to the knowledge of subcutaneous sliding system in humans)
Guimberteau, J. C., Sentucy-Rigall, J., Panconi, B., Bouleau, R., Mouton, P., Bakhach, J.
Osteopathische Medizin, 2008/01







1959


1960

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text

1961

OMT Homework
Clark, R. C.
The AAO Journal, 2007/12
Free full text

1962

Using integrative therapies to treat women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2007/11
Free full text





1967



1969

Osteopathie in der Pädiatrie, Teil 1
(Osteopathy in Pediatrics, Part 1)
Frymann, V. M.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1970

Spina bifida - Entstehung und Folgen
(Spina bifida - Development and Consequences)
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1971

Masterkurs in Kirksville - ein Stimmungsbild
(Master course in Kirksville - an impression)
Kaiser, A.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1972

Lebensqualität
(Quality of Life)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10



1975

Müsli gegen Spina bifida
(Muesli against spina bifida)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10

1976

Rauchen schadet Embryo
(Smoking harms the embryo)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/10




1980

Occipital Compression and its Potential Uses in Obstetrics
McAfee, S. N., Chila, A. G.
The AAO Journal, 2007/09
Free full text

1981

Independence and Interdependence
Paulus, S. F.
The AAO Journal, 2007/09
Free full text




1985

Comparing the Effects of Cranial Manipulation on Heart Rate Variability and Traube-Hering-Mayer Waves
Pexton, T., Nelson, K., Glonek, T., Heinking, K., Kappler, R., Sergueef, N.
The Journal of the American Osteopathic Association, 2007/08

1986

Die Entwicklung der Wirbelsäule (Teil 2)
(The Development of the Spinal Column (Part 2))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07


1988

Validität und Reliabilität
(Validity and reliability)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1989

SEE - Die SomatoEmotionale Entspannung nach Upledger
(SER - SomatoEmotional Release according to Upledger)
Landeweer, G. G., Assink, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07



1992

Speisen hält Leib und Seele zusammen
(Dining holds body and soul together)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1993

Medizin und Kreativität
(Medicine and creativity)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1994

Das Chronische Müdigkeitssyndrom
(Chronic Fatigue Syndrome)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07

1995

Eine kurze Geschichte der Seele
(A Short History of the Soul)
Sommerfeld, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/07


1997

Neuromusculoskeletal Causes of Back Pain in Competitive Figure Skaters
Goldman, S. I., Moyer, M.
The AAO Journal, 2007/06
Free full text


1999






2004

Bau und Funktion des Ellbogengelenks
(Construction and Function of the Elbow)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2005

Die Motrizität
(Motricity)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2006

Studienarten
(Types of studies)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2007

Embryologie des Ellbogens
(Embryology of the Elbow)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2008

Tennisellbogen: Osteopathie statt Kortison!
(Tennis elbow: Osteopathy instead of cortisone!)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2009

Tennisellbogen: Was hilft? Was hilft wirklich?
(Tennis elbow: What helps? What really helps?)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04


2011

Der Ellbogen
(The elbow)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/04

2012

Is Osteopathy research relevant? A challenge has been made
Lucas, N. P., Moran, R. W.
The AAO Journal, 2007/03
Free full text



2015

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text


2017

Back pain and the homoeostatic requirements of the spinal system
Brownhill, K.
International Journal of Osteopathic Medicine, 2007/03

2018

Responding to the challenge of clinically relevant osteopathic research: Efficacy and beyond
Licciardone, J. C.
International Journal of Osteopathic Medicine, 2007/03





2023

The heart - an expanded osteopathic approach
Wagner, G.
Unpublished MSc thesis, 2007/01
Free full text



2026

Die Bewegungen der Viszera: Die Mobilität, Teil 2
(Visceral Movements: Mobility, Part 2)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01

2027

Für eine streitbare und lebendige Osteopathie
(For a contentious and lively osteopathy)
Kwakman, R.
DO - Deutsche Zeitschrift für Osteopathie, 2007/01




2031



2033

The Use of OMT in Patients with Osteoarthritis: Case Report
Zaidi, T., Williams, S.
The AAO Journal, 2006/12
Free full text

2034

Dr. A. T. Still’s Treating Chair
Jordan, T. R.
The AAO Journal, 2006/12
Free full text

2035

Cranial osteopathy: its fate seems clear
Hartman, S. E.
Chiropractic & Manual Therapies, 2006/12
Free full text

2036

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

2037

An osteopathic approach to performing arts medicine
Shoup, D.
Physical Medicine and Rehabilitation Clinics of North America, 2006/11

2038

Unser Fuß, ein komplexes Organ
(The Foot - A Complex Organ)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

2039







2045

Osteopathic reasoning for the treatment of low back pain
Rennie, P. R.
Manuelle Medizin, 2006/10

2046

Brauchen Kinderfüße Einlagen?
(Do children's feet need insoles?)
Luthin, D., Rossi, S.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

2047

Evidence based-Medizin (EBM)
(Evidence-based medicine (EBM))
Krause, R., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10


2049

Die Bewegungen der Viszera: Die Mobilität - Teil 1
(Visceral Movements: Mobility - Part 1)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10



2052

Was bringt die Ganganalyse? - Pro und Contra
(What are the benefits of gait analysis? - Pros and cons)
Fink, M., Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2006/10

2053

One Heritage, Two Traditions; A Look to the Future
Steele, K. M.
The AAO Journal, 2006/09
Free full text

2054

Palpation of the sacroiliac joint: An anatomical and sensory challenge
McGrath, M. C.
International Journal of Osteopathic Medicine, 2006/09

2055

Infantile colic: A critical appraisal of the literature from an osteopathic perspective
Lim, K. W.
International Journal of Osteopathic Medicine, 2006/09

2056

Osteopathic medicine in transition: postmortem of the Osteopathic Medical Center of Texas
Hilsenrath, P. E.
The Journal of the American Osteopathic Association, 2006/09
Free full text

2057







2063

Die Geschichte der funktionellen Technik
(The history of functional technique)
Hoover, H., Bowles, C., Johnston, W. L., Franke, H.
Osteopathische Medizin, 2006/08

2064

Forschungen zur Somatischen Dysfunktion
(Research on somatic dysfunction)
Heath, D. M., Gevitz, N.
Osteopathische Medizin, 2006/08

2065



2067

Benötige ich ein Kunstgelenk?
(Do I need an artificial joint?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2068

Das Ohr, Anatomie und Physiologie
(The Ear, Anatomy and Physiology)
Rütz, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07


2070



2072

Tinnitus
Plothe, C.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2073

Konfidenzintervall
(Confidence interval)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2074

Tinnitus aurium - Wenn das Ohr pfeift
(Tinnitus - When the ear whistles)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2075

Das Os temporale und seine Beziehungen
(The Temporal Bone and its Relations)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2006/07

2076

What is the best treatment for infants with colic?
Crotteau, C. A., Wright, S. T.
The Journal of Family Practice, 2006/07

2077


2078

Psychology and low back pain
Bogduk, N.
International Journal of Osteopathic Medicine, 2006/06

2079

Viewpoint
Burton, K.
International Journal of Osteopathic Medicine, 2006/06


2081

Viewpoint
Burton, K.
International Journal of Osteopathic Medicine, 2006/06

2082

Sacroiliac Mechanics Revisited
Jordan, T. R.
The AAO Journal, 2006/06
Free full text

2083

Understanding comorbidity with depression and anxiety disorders
Aina, Y., Susman, J. L.
The Journal of the American Osteopathic Association, 2006/05

2084

Nonobstetric lacerations of the vagina
Sloin, M. M., Karimian, M., Ilbeigi, P.
The Journal of the American Osteopathic Association, 2006/05
Free full text

2085

Mechanism-of-injury approach to evaluating patients with blast-related polytrauma
Scott, S. G., Belanger, H. G., Vanderploeg, R. D., Massengale, J., Scholten, J.
The Journal of the American Osteopathic Association, 2006/05
Free full text

2086

Effects of cervical manipulation on cardiac autonomic control
Giles, P. D.
Unpublished MSc thesis, 2006/05

2087

Treating patients for comorbid depression, anxiety disorders, and somatic illnesses
Dolnak, D. R.
The Journal of the American Osteopathic Association, 2006/05


2089

The Drive for Legitimation by Osteopathy and Chiropractic in Australia: Between Heterodoxy and Orthodoxy
Baer, H. A.
Complementary Health Practice Review, 2006/04
Free full text


2091



2093


2094

Alles Schrott?
(All scrap?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2095

Altern und Osteopathie: Die Rolle von Beweisen
(Aging and Osteopathy: The Role of Evidence)
McGovern, R. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2096

Signifikanz
(Significance)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2097

Die Bewegungen der Viszera - Teil 1: Motilität
(Movements of the Viscera, Part 1: Motility)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2098

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

2099

Gross range of motion in the cervical spine: the effects of osteopathic muscle energy technique in asymptomatic subjects
Burns, D. K., Wells, M. R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

2100

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

2101

Intercostal rib release
McCarty, C. L.
The AAO Journal, 2006/03
Free full text

2102

HVLA thrust techniques: What are the risks?
Gibbons, P., Tehan, P.
International Journal of Osteopathic Medicine, 2006/03

2103

The effect of different rates of application of a rib raising technique on cardiovascular and respiratory measures in asymptomatic individuals
Farthing, R., Gosling, C., Williams, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2006/03

2104

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

2105

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

2106

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

2107

Matrix-Rhythmus-Therapie und osteopathischer Ansatz
(Matrix rhythm therapy and osteopathic approach)
Randoll, U. G., McCutcheon, R., Hennig, F. F.
Osteopathische Medizin, 2006/02

2108

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2006/02
Free full text

2109

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text



2112

(Various approaches for the treatment of postpartal problems)
Ligner, B.
Osteopathische Medizin, 2006/02
Free full text

2113

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text



2116

Das Studium des Lebens
(The study of life)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01


2118

Die osteopathische Versorgung älterer Menschen
(Osteopathic treatment of the elderly)
McGovern, J. J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01

2119

Mit Statistik manipulieren
(Manipulate through statistics)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2006/01



2122

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12

2123

Somatic Dysfunction – a Reflection on the Scope of Osteopathic Practice
Comeaux, Z. J.
The AAO Journal, 2005/12
Free full text

2124

American Osteopathic Association adopts policies on treatment of patients in pain: an overview
D'Alonzo, G. E., Jr., Stipp
The Journal of the American Osteopathic Association, 2005/11
Free full text

2125

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text


2127

Manual techniques addressing the lymphatic system: origins and development
Chikly, B. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

2128

Increased lymphatic flow in the thoracic duct during manipulative intervention
Knott, E. M., Tune, J. D., Stoll, S. T., Downey, H. F.
The Journal of the American Osteopathic Association, 2005/10
Free full text

2129

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

2130

Andrew Taylor Still-Techniken
(Andrew Taylor Still techniques)
Bachand, P.
Osteopathische Medizin, 2005/10



2133

(H. M. Patterson, D.O.: His life as an osteopath)
Patterson, M. M.
Osteopathische Medizin, 2005/10



2136

Ausgleich von Beinlängendifferenzen - Pro und Contra
(Compensation of leg length differences - pros and cons)
Küttner, T., Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


2138

Automatic Shifting
Paulson, A. R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

2139

Ein Osteopath auf eigenen Wegen
(An osteopath on his own paths)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

2140

Mit Osteopathie den Hüftschmerz kontrollieren
(Controlling hip pain with osteopathy)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10


2142

Das Hüftgelenk
(The hip joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

2143

Der holistische Imperativ in der Osteopathie
(The holistic imperative in osteopathy)
Weber, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2005/10

2144

Interventional pain management: an overview for primary care physicians
Boyajian, S. S.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2145

Headache pain
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2146

Management of neuropathic pain
Galluzzi, K. E.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2147

Clinical Prevention and Population Health Curriculum Framework: the nursing perspective
Allan, J. D., Stanley, J., Crabtree, M. K., Werner, K. E., Swenson, M.
Journal of Professional Nursing, 2005/09
Free full text

2148

Osteopathic manipulative medicine considerations in patients with chronic pain
Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2149

Management of osteoarthritic knee pain
Rubin, B. R.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2150

An osteopathic approach to treating women with chronic pelvic pain
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2151

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

2152

Legends and Lessons: William “Wild Bill” Wyatt, DO
Capobianco, A. D.
The AAO Journal, 2005/09
Free full text

2153

The Art of High Velocity Low Amplitude Osteopathic Manipulative Treatment
Clark, R. C.
The AAO Journal, 2005/09
Free full text

2154

Anatomy in the Osteopathic Field
Paulus, S. F.
The AAO Journal, 2005/09
Free full text

2155

The Instrument of our Distinction: The Hand
Smutny, C. J. III.
The AAO Journal, 2005/09
Free full text





2160

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

2161

The mechanics of cranial motion—the sphenobasilar synchondrosis (SBS) revisited
Cook, A.
Journal of Bodywork and Movement Therapies, 2005/07


2163



2165

Dreigliedrige Osteopathie
(Triune osteopathy)
Pöttner, M., Hartmann, C.
Osteopathische Medizin, 2005/07


2167

Das Kiefergelenk des Menschen
(The Human Jaw)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

2168

Störungen in der Entwicklung des kindlichen Kiefers
(Developmental Disorders of the Jaw in Children)
Gohl-Frohnmayer, P.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

2169

Literaturliste
(Bibliography)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

2170

Etienne Cloet - Was wirklich zählt
(Etienne Cloet - What really matters)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

2171

Osteopathie bei Kindern mit Asthma
(Osteopathy in children with asthma)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07


2173

Tagebuch aus Kirksville
(Diary from Kirksville)
Sutmar, S.C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

2174

Das Kiefergelenk
(The temporomandibular joint)
Terhorst, L., Sundermann, W.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07


2176

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

2177

Medical education in substance abuse: from student to practicing osteopathic physician
Wyatt, S. A., Vilensky, W., Manlandro, J. J., Jr., Dekker, M. A., 2nd
The Journal of the American Osteopathic Association, 2005/06
Free full text

2178

C1 Somatic Dysfunction and Unilateral Retroorbital Cephalalgia
Coffey, D.
The AAO Journal, 2005/06
Free full text


2180

Abreactions in Ligamentous Articular Strain
McMurrey, L., Williams, S. F.
The AAO Journal, 2005/06
Free full text

2181

The UK BEAM trial – a review and discussion
Vogel, S., Dear, J., Evans, D. W.
International Journal of Osteopathic Medicine, 2005/06

2182

Sir William Osler then and now: thoughts for the osteopathic profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2005/05
Free full text

2183

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text


2185

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text




2189

Osteopathische Therapie bei Glaukom
(Osteopathic Therapy of Glaucoma)
Esser, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

2190

Wanderer zwischen den Osteopathiewelten
(Roamer between osteopathic worlds)
Fossum, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04


2192


2193

Die Bedeutung von Abstracts
(The importance of abstracts)
Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04


2195

Osteopathie gegen Schielen
(Osteopathy for strabismus)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

2196


2197

Okulomotorik. Was bewegt das Auge?
(Oculomotorics: What makes the eye move?)
Storr, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/04

2198

Management of pain in older adults
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2005/03
Free full text

2199

Pain management in end-of-life care
Leleszi, J. P., Lewandowski, J. G.
The Journal of the American Osteopathic Association, 2005/03
Free full text

2200

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

2201

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text

2202

Zen awareness in the teaching of palpation: An osteopathic perspective
Comeaux, Z.
Journal of Bodywork and Movement Therapies, 2005/03




2206



2208




2211

The biodynamic model of osteopathy in the cranial field
McPartland, J. M., Skinner, E.
Explore (NY), 2005/01

2212

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text


2214

John Wernham - A.T. Stills “Enkel”
(John Wernham - A.T. Still's “Grandson“)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01


2216

Viszerosomatische Reflexe
(Viscerosomatic reflexes)
Friedman, H. D.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

2217

Die Wirbelsäule
(The Spine)
Fuhrmann, M., Kühn, J.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

2218

Osteopathie und Chiropraktik
(Osteopathy and chiropractic)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

2219

Die Entwicklung der Wirbelsäule (Teil 1)
(The Development of the Spinal Column (Part 1))
Heinzeller, T.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01

2220

Safety bei Untersuchung der Wirbelsäule
(Safety in the area of the spinal column)
Hinkelthein, E.
DO - Deutsche Zeitschrift für Osteopathie, 2005/01



2223





2227

Could Joint Hypomobility Alter Optimal Proprioceptive Information?
Zegarra-Parodi, R.
The AAO Journal, 2004/12
Free full text



2230

Osteopathie beim Kleinkind
(Osteopathy in small children)
Dufresne, D.
Osteopathische Medizin, 2004/11

2231

Gibt es eine kranielle Osteopathie?
(Is there such a thing as cranial osteopathy?)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11


2233

Osteopathie in der kraniellen Sphäre
(Osteopathy in the cranial sphere)
Dräger, K.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11



2236

Sutherland und das “flüssige Licht”
(Sutherland and the “liquid light“)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

2237

The unique role of osteopathic physicians in treating patients with low back pain
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2004/11
Free full text

2238

“Kraniosakral”- Mythen und Fakten
(“Craniosacral” - Myths and Facts)
Resch, K.L., Liem, T.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11


2240

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text

2241

Kraniosakrale Osteopathie - Was ist das?
(What's craniosacral osteopathy?)
Reiter, M.
DO - Deutsche Zeitschrift für Osteopathie, 2004/11

2242

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text



2245

The elephant in the room: does OMT have proved benefit?
Bledsoe, B. E.
The Journal of the American Osteopathic Association, 2004/10
Free full text

2246

An introduction to the use of outcomes questionnaires in osteopathic practice
Vaughan, B., DiVenuto, G.
Journal of Osteopathic Medicine, 2004/10

2247

Nitric oxide as a possible mechanism for understanding the therapeutic effects of osteopathic manipulative medicine (Review)
Salamon, E., Zhu, W., Stefano, G. B.
International Journal of Molecular Medicine, 2004/09

2248

Bei Tennisellenbogen Osteopathie?
(Osteopathy for tennis elbow?)
Ernst, E.
MMW - Fortschritte der Medizin, 2004/09


2250


2251

Osteopathie beim Säugling
(Osteopathy in infants)
Dufresne, D.
Osteopathische Medizin, 2004/08


2253



2255

Suturen – Wachstumszentren des Schädels
(Sutures - Cranial growth centers)
Fanghänel, J., Preuße, U.
Osteopathische Medizin, 2004/08




2259

Russische Forschungsstudien im Bereich der kranialen Osteopathie
(Russian research in cranial osteopathy)
Kravchenko, T. I., Moskalenko, Y. E., Vartanyan, I. A.
Osteopathische Medizin, 2004/08








2267

Die osteopathische Behandlung der weiblichen Brust
(Osteopathic treatment of the female breast)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07




2271

Vom Gegen- und Miteinander
(Of working together and working against each other)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07


2273

Eckpunkte für Curriculum festgelegt
(Cornerstones for curriculum established)
listed, No authors
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

2274

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text

2275

Wissenschaft, die Wissen schafft
(Science creating knowledge)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

2276

Osteopathie im Bereich des Brustkorbs
(Osteopathy in the thoracic region)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07

2277

Risk management for chiropractors and osteopaths: informed consent. A common law requirement
Walker, B. F., Cameron, M., French, S., Pollard, H. P., Vitiello, A. L., Reggars, J. W., Werth, P. D.
Australasian Chiropractic & Osteopathy, 2004/07

2278

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

2279

Travell trigger points--molecular and osteopathic perspectives
McPartland, J. M.
The Journal of the American Osteopathic Association, 2004/06
Free full text

2280

Wave Phenomena in Movements of Intracranial Liquid Media and the Primary Respiratory Mechanism
Moskalenko, Y. E., Kravchenko, T. I.
The AAO Journal, 2004/06
Free full text




2284

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

2285

Schutzimpfungen bei Kindern - Pro und Contra
(Vaccinations in children - pros and cons)
Dockx-Reinken, F., Rabe, S.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

2286

Zur funktionellen Anatomie des kindlichen Schädels
(The functional anatomy of the infantile skull)
Fanghänel, J., Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

2287

The spotted monster
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

2288

A randomized controlled trial of osteopathic manipulative treatment following knee or hip arthroplasty
Licciardone, J. C., Stoll, S. T., Cardarelli, K. M., Gamber, R. G., Swift, J. N., Jr., Winn
The Journal of the American Osteopathic Association, 2004/05
Free full text

2289

Das Unmögliche wagen
(Daring the impossible)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05



2292

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text

2293

A divisional approach to enhancing research among osteopathic family practice residents
Smith-Barbaro, P., Fulda, K. G., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2004/04
Free full text

2294

Breathing pattern disorders, motor control, and low back pain
Chaitow, L.
Journal of Osteopathic Medicine, 2004/04



2297

Energy medicine: an osteopath's personal view
Handoll, N.
The Journal of Alternative and Complementary Medicine, 2004/03

2298

The Neuroendocrine-Immune Complex Illustrated in the Work of Dr. Frank Chapman
Capobianco, J. D.
The AAO Journal, 2004/03
Free full text

2299

From the Archives: The Lymphatic System, Applied Anatomy
Millard, F. P.
The AAO Journal, 2004/03
Free full text

2300

Tägliche Eigenübungen
(Daily self-exercises)
Comeaux, Z., Haßfeld, U.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

2301

Akuter Lumbago - ein funktioneller Ansatz
(Acute lumbago: a functional approach)
Debroux, J.J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02



2304

“...jederzeit voll und ganz dabei sein!“
(“...be fully involved at all times!“)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

2305

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text

2306



2308

Der “Diagnostic Touch“ von Rollin E. Becker
(The diagnostic touch from Rollin E. Becker)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

2309

Stills Faszienkonzept
(Still’s fascia concept)
Stark, J.
DO - Deutsche Zeitschrift für Osteopathie, 2004/02

2310

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

2311

Efficacy of manipulation in low back pain treatment: The validity of meta-analysis conclusions
Chaitow, L., Comeaux, Z., Dommerholt, J., Ernst, E., Gibbons, P., Hannon, J., Lewis, D., Liebenson, C.
Journal of Bodywork and Movement Therapies, 2004/01


2313

Erectile dysfunction and comorbid diseases, androgen deficiency, and diminished libido in men
Fine, S. R.
The Journal of the American Osteopathic Association, 2004/01
Free full text

2314

Osteopathic approach to sexual dysfunction: holistic care to improve patient satisfaction and prevent mortality and morbidity
Martin, R. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


2316

Emu oil for osteoarthritic hand pain
Power, R.
Unpublished MSc thesis, 2004/01
Free full text

2317

Effects of osteopathic treatment on people with psoriatic arthritis: a pilot study
Wall, R., Ryan, E., Kiatos, J.
Unpublished MSc thesis, 2004/01
Free full text


2319

From The Archives: A Glimpse of Dr. Still's Art
McConnell, C. P.
The AAO Journal, 2003/12
Free full text


2321

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11

2322

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text


2324

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text


2326

The analgesia of movement: ideomotor activity and manual care
Dorko, B. L.
Journal of Osteopathic Medicine, 2003/10

2327

A review of the physiology of cranial osteopathy
Ferguson, A.
Journal of Osteopathic Medicine, 2003/10

2328

Intervertebral dysfunction: a discussion of the manipulable spinal lesion
Fryer, G.
Journal of Osteopathic Medicine, 2003/10


2330

Research at the British College of Osteopathic Medicine
Walters, N.
Journal of Osteopathic Medicine, 2003/10

2331

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text

2332

Viewpoint
Chaitow, L.
Journal of Osteopathic Medicine, 2003/10



2335

Sterilität - Möglichkeiten und Grenzen - Pro und Contra
(Sterility - possibilities and limits - pros and cons)
Dittmar, F. W., Kirchmayr, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

2336

Osteopathie in der Schwangerschaft
(Osteopathy during pregnancy)
Gillemot, B.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

2337

Osteopathie – ohne Frauen undenkbar!
(Osteopathy - unthinkable without women!)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

2338

James McGovern, Anwalt der Osteopathie
(James McGovern, Osteopathic Advocate)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/10

2339








2346

Likening Likening Strikes. Psychiatry, Osteopathy, and the Likeness Argument
Tyreman, S.
Philosophy, Psychiatry & Psychology, 2003/09


2348

History of Osteopathy in France
Barillon, B.
The AAO Journal, 2003/09
Free full text


2350

Dynamic Strain-Vector Release: An Energetic Approach to OMT
Hendryx, J. T., O'Brien, R. L.
The AAO Journal, 2003/09
Free full text

2351


2352

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

2353

A primary care approach to comprehensive care of patients with type 1 and type 2 diabetes mellitus
Keilers, R. K.
The Journal of the American Osteopathic Association, 2003/08
Free full text

2354

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text

2355

Osteopathic Manipulative Treatment and Congestive Heart Failure
Scheunemen, G. M., Mnabhi, A. K. S., Papp, M. A., Nelson, K. E., Glonek, T.
The Journal of the American Osteopathic Association, 2003/08

2356

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

2357

Osteopathic manipulative medicine in the treatment of hypertension: An alternative, conventional approach
Spiegel, A. J., Capobianco, J. D., Kruger, A., Spinner, W. D.
Heart Disease, 2003/07

2358

Treating patients in primary care: the impact of mood, behavior, and thought disturbances
Baron, D. A., Hay, D. P., Easom, H. M.
The Journal of the American Osteopathic Association, 2003/07
Free full text

2359

Aufbau und Funktion des Peritoneums
(Structure and function of the peritoneum)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2360

Abenteuer Leichenbeschaffung
(Adventure of providing cadavers)
Hartmann, C.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2361

Die mechanische Funktion des rechten Kolonwinkels
(The mechanical function of the right colonic angle)
Helsmoortel, J., Hirth, T., Wührl, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2362

Zum primären Verletzungsmechanismus bei Beschleunigungsverletzungen
(Whiplash injury: What you should know)
Keller, M., Bischoff, A., Schwerla, B. S.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2363

Das Peritoneum testen und behandeln
(Testing and treating the peritoneum)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07

2364

Nackenschmerzen: Hand anlegen überlegen!
(Neck pain: manual therapy scores best)
Resch, K.L.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07


2366

Bauchschmerzen - Wer untersucht? Wer behandelt?
(Abdominal pain - Who examines? Who treats?)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/07


2368

From the Archives: A Manual of Cranial Technique
Lippincott, R. C., Lippincott, H. A.
The AAO Journal, 2003/06
Free full text

2369

Physiological Background of the Cranial Rhythmic Impulse and The Primary Respiratory Mechanism
Moskalenko, Y., Frymann, V., Kravchenko, T., Weinstein, G.
The AAO Journal, 2003/06
Free full text



2372

Single system research designs in osteopathy
Sanders, G.
Journal of Osteopathic Medicine, 2003/04


2374

Sinus sphenoidalis und ethmoidalis
(Sphenoid sinus and ethmoid sinus)
Eser-Bindl, U.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2375

Funktionelle Anatomie der Nasennebenhöhlen
(Functional anatomy of the paranasal sinuses)
Fanghänel, J.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04


2377

Allergien und chronische Sinusitis
(Allergies and chronic sinusitis)
Muts, R. K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2378


2379

Die chronische Sinusitis: Eine Übersicht
(A review of chronic sinusitis)
Resch, K.L., Häfner, S., Stadler, M., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2380

Osteopathie bei chronischer Sinusitis: Nase frei!
(Osteopathic treatment of chronic sinusitis)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2381

Der chronische Paukenerguss
(The chronic tympanic effusion)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04


2383

Die chronische Sinusitis - Pro und Contra
(Chronic sinusitis - pros and cons)
Stadler, M., Biesinger, E.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2384

Die Nasopharyngitis “nicht-pathologisiert”
(The nasopharyngitis “non-pathologized“)
van Dun, P.
DO - Deutsche Zeitschrift für Osteopathie, 2003/04

2385

Bibliotherapy: the therapeutic use of didactic and literary texts in treatment, diagnosis, prevention, and training
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2003/03
Free full text


2387

Etiological Factors in Sacral Somatic Dysfunctions
Danto, J. B.
The AAO Journal, 2003/03
Free full text

2388

From the Archives: The Contribution of John Martin Littlejohn to Osteopathy
Hall, T. E., Wernham, J.
The AAO Journal, 2003/03
Free full text

2389

Conceptual and Treatment Models in Osteopathy
Jordan, T.
The AAO Journal, 2003/03
Free full text



2392

Manipulation of the cervical spine
Hing, W. A., Reid, D. A., Monaghan, M.
Manual Therapy, 2003/02

2393

The national cholesterol education program adult treatment panel ill guidelines
Clearfield, M. B.
The Journal of the American Osteopathic Association, 2003/01
Free full text

2394

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text

2395

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

2396

Allgemeiner Aufbau des Kniegelenks
(General structure of the knee joint)
Breul, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2397

Praxis optimieren: Eingang und Flur
(Optimizing your practice: Entrance and hallway)
Edelmann, K.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2398

Hausaufgaben und Tipps für’s Knie
(Homework and tips for the knee)
Fuhrmann, M.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2399



2401

Das schmerzhafte Knie: Eine Übersicht
(The painful knee: an overview)
Resch, K.L., Bachem, S., Salzmann, I., Schwartz, U., Krause, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2402

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2403

Traumatologische Diagnostik des Kniegelenks
(Traumatological diagnostics of the knee joint)
Schwerdtner, H.P., Schallier, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2404

Das posttraumatische Kniegelenk
(The post-traumatic knee joint)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

2405

The Primary Respiratory Mechanism
Nelson, K. E.
The AAO Journal, 2002/12
Free full text

2406

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2407

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2408

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

2409

Aptitude for osteopathic training. 1939
Yarborough, J. U.
The Journal of the American Osteopathic Association, 2002/11
Free full text

2410

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text


2412

Developing research at The British School of Osteopathy
Nash, K., Vogel, S.
Journal of Osteopathic Medicine, 2002/10

2413

Getting to the point: an osteopathic appreciation of Janet Travell
McPartland, J. M.
Journal of Osteopathic Medicine, 2002/10

2414

Osteopathic perturbation and immune network compensation
Degabriele, R.
Journal of Osteopathic Medicine, 2002/10

2415

From the Archives: Vindication
Bennett, G. M.
The AAO Journal, 2002/09
Free full text

2416


2417

Osteopathic manipulative treatment for postoperative pain
Nicholas, A. S., Oleski, S. L.
The Journal of the American Osteopathic Association, 2002/09
Free full text

2418

Educating health professionals, first responders, and the community about bioterrorism and weapons of mass destruction
Silvagni, A. J., Levy, L. A., McFee, R. B.
The Journal of the American Osteopathic Association, 2002/09
Free full text

2419

Osteopathic Manipulation Increases Active Range of Motion and Gait Parameters in Osteoarthritis: A Pilot Study
Bahamonde, L. G., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
Journal of Osteopathic Medicine, 2002/08

2420

Impact of Osteopathic Manual Medicine in Patients with Knee Osteoarthritis
Degenhardt, B. F., Kenney, R. G., McGovern, R. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/08

2421

Joint Kinetic Parameters as Indicators of Osteopathic Manipulative Treatment Effect in Osteoarthritis of the Knee
Kilbury Nason, L. L., Scandalis, T. A., Wells, M. R., Hallas, B. H., O'Halpin, S.
The Journal of the American Osteopathic Association, 2002/08

2422

Osteopathy in the cranial field: uncovering challenges and potential applications
King, H. H.
The Journal of the American Osteopathic Association, 2002/07
Free full text

2423

Improving functional ability in the elderly via the Spencer technique, an osteopathic manipulative treatment: a randomized, controlled trial
Knebl, J. A., Shores, J. H., Gamber, R. G., Gray, W. T., Herron, K. M.
The Journal of the American Osteopathic Association, 2002/07
Free full text

2424

Facilitated Oscillatory Release
Comeaux, Z. J.
The AAO Journal, 2002/06
Free full text


2426

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

2427

Ushering in the Institute for Excellence in Osteopathic Medical Education
Heun, L. R.
The Journal of the American Osteopathic Association, 2002/05
Free full text

2428

Joint cracking and popping: understanding noises that accompany articular release
Protopapas, M. G., Cymet, T. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text

2429

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04


2431

The immune network and homeostasis
Degabriele, R.
Journal of Osteopathic Medicine, 2002/04

2432


2433

'We will look for health': the Osteopathic Center for Children
Chilton, K.
Alternative Therapies in Health and Medicine, 2002/03

2434

Tackling birth trauma with cranio-sacral therapy
Turney, J.
The Practising Midwife, 2002/03

2435

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text

2436

From the Archives: Osteopathic Fundamentals
Page, L. E.
The AAO Journal, 2002/03
Free full text

2437


2438

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text


2440

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02

2441

Proposed tenets of osteopathic medicine and principles for patient care
Rogers, F. J., D'Alonzo, G. E., Jr., Glover, J. C., Korr, I. M., Osborn, G. G., Patterson, M. M., Seffinger, M. A., Taylor, T. E., Willard
The Journal of the American Osteopathic Association, 2002/02
Free full text

2442

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text


2444

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

2445

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

2446

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


2448

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text



2451

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2452

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2453

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2454

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

2455

Osteopathic education looks ahead. 1948
Dressler, O.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2456

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2457

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text

2458

Hands on care
Turney, J.
Nursing Standard, 2001/10

2459

Measurement challenges in physical diagnosis: refining inter-rater palpation, perception and communication
Comeaux, Z., Eland, D., Chila, A. G., Pheley, A., Tate, M.
Journal of Osteopathic Medicine, 2001/10

2460

Considerations for planning and conducting clinic-based research in physical therapy
Fitzgerald, G., Delitto, A.
Journal of Osteopathic Medicine, 2001/10

2461

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10

2462

Patient positioning and spinal locking for lumbar spine rotation manipulation
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10


2464

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10

2465

Cervical spine manipulation and the precautionary principle
Vautravers, P., Maigne, J.Y.
Journal of Osteopathic Medicine, 2001/10


2467

The muscle hypothesis: a model of chronic heart failure appropriate for osteopathic medicine
Rogers, F. J.
The Journal of the American Osteopathic Association, 2001/10
Free full text

2468

Andrew Taylor Still Memorial Lecture: the osteopathic difference--is it only manipulation? 1984
Siehl, D.
The Journal of the American Osteopathic Association, 2001/10

2469

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

2470

A research program for the osteopathic profession. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2471

Research our great and only hope
Snyder, O. J.
The Journal of the American Osteopathic Association, 2001/09
Free full text

2472

Elbow injuries in golf
Stockard, A. R.
The Journal of the American Osteopathic Association, 2001/09
Free full text


2474

Angina pectoris with special reference to its mechanical causes. 1938
Appleyard, E. C.
The Journal of the American Osteopathic Association, 2001/08
Free full text

2475

Osteopathic treatment of the common cold. 1937
Becker, A. D.
The Journal of the American Osteopathic Association, 2001/08
Free full text

2476

The osteopathic lesion as the etiological factor in some common surgical disorders. 1948
Conley, G. J.
The Journal of the American Osteopathic Association, 2001/08
Free full text

2477

Methods of applying manipulative technic. 1945
Burns, L.
The Journal of the American Osteopathic Association, 2001/07
Free full text

2478

Soft tissues in areas of osteopathic lesion. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/07
Free full text

2479

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2480

Segmental definition--Part IV. Updating the differential for somatic and visceral inputs
Johnston, W. L., Golden, W. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2481

Cold-induced urticaria
Mahmoudi, M.
The Journal of the American Osteopathic Association, 2001/05
Free full text

2482

A randomized clinical trial of exercise and spinal manipulation for patients with chronic neck pain
Bronfort, G., Evans, R., Nelson, B., Aker, P. D., Goldsmith, C. H., Vernon, H.
Journal of Osteopathic Medicine, 2001/04

2483

Evaluation of acute headaches in adults
Clinch, C. R.
Journal of Osteopathic Medicine, 2001/04

2484

Spinal manipulation: Indications, risks and benefits
Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/04

2485

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text

2486

Balanced on a tight rope between low back pain and evidence-based practice
Shacklock, M.
Journal of Osteopathic Medicine, 2001/04

2487

Osteopathic treatment considerations for rheumatic diseases
Tettambel, M. A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

2488

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text

2489

Abbreviations for use in osteopathic case notes
Fryer, G.
Journal of Osteopathic Medicine, 2001/04


2491

Review of Sacral Somatic Dysfunction
Janiak, D. D.
The AAO Journal, 2001/03
Free full text

2492

The primary respiratory mechanism beyond the craniospinal axis
Lee, R. P.
The AAO Journal, 2001/03
Free full text

2493

Changes in the Traube-Herring Wave following cranial manipulation
Sergueef, N., Nelson, K. E., Glonek, T.
The AAO Journal, 2001/03
Free full text

2494

Researched and demonstrated: inquiry and infrastructure at osteopathic institutions
Gevitz, N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2495

The somatic components of disease. 1956
MacBain, R. N.
The Journal of the American Osteopathic Association, 2001/03
Free full text

2496

Osteopathische Medizin
(Osteopathic Medicine)
Tempelhof, S., Weingart, J. R.
Erfahrungsheilkunde, 2001/03

2497

Muscle and the myoneural junction. Their relation to segmental spinal dysfunctions. 1955
Cole, W. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2498

Analyzing the osteopathic lesion. 1940
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/02
Free full text

2499

The place of the osteopathic concept in the healing art. 1947
Denslow, J. S.
The Journal of the American Osteopathic Association, 2001/01
Free full text

2500

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

2501

Osteopathy--fifty years later. Founders Memorial Lecture. 1951
Fischer, R. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

2502

Minor depression in primary care
Banazak, D. A.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2503

Endoscopic retrograde cholangiopancreatography: what role does it have in primary care?
Biery, D. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2504

Sleep-related gastroesophageal reflux
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2505

Spirituality in Osteopathic Medicine
Lee, R. P.
The AAO Journal, 2000/12
Free full text

2506

What osteopathists stand for in legislation. 1910
Hildreth, A. G.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2507

Re-expansion pulmonary edema following puncture of a giant bulla
McCoskey, E. H., McKinney, L. M., Byrd, R. P., Jr., Roy
The Journal of the American Osteopathic Association, 2000/12
Free full text

2508

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2509

A primary care approach to pediatric gastroesophageal reflux
Sunku, B., Marino, R. V., Sockolow, R.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2510

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

2511

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text


2513

Preparing future osteopathic physicians to practice in the global village
Dubin, B. D.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2514

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2515

The venous side: current directions in anticoagulant therapy
Kaatz, S.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2516

Long-term therapy of coronary artery disease: a vascular biology perspective
Mathé, A. J., Clearfield, M. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2517

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2518

Diagnosis and treatment of carotid artery stenosis
Mintz, B. L., Hobson, R. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2519

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2520

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2521

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2522

Thrombolytic, antithrombin, and antiplatelet treatment of acute coronary syndromes
Puma, J. A., Sketch, M. H.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2523

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2524

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2525

How West Virginia School of Osteopathic Medicine achieves its mission of providing rural primary care physicians
Stookey, J. R., Baker, H. H., Nemitz, J. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2526

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2527

Lake Erie College of Osteopathic Medicine's independent study pathway program: an alternative medical school curriculum design
Ferretti, S. M., Mesina, J. E., Gabel, L. L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

2528

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10

2529

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text

2530

Managing common problems in perimenopausal women
Forstein, D. A.
The Journal of the American Osteopathic Association, 2000/10

2531

Vascular medicine and osteopathic medicine: treating the whole patient
Gironta, M. G., Rosenfeld, C. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2532

Endovascular treatment of peripheral arterial disease
Gray, B. H.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2533

Glycation as the glucose link to diabetic complications
Gugliucci, A.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2534

Hypertension and renal artery stenosis: a complex clinical scenario
Jaff, M. R.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2535

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10

2536

Diagnosis and medical management of patients with intermittent claudication
LaPerna, L.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2537

Influencing the vegetative nervous system through manipulation. 1945
Northup, G. W.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2538

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2539

Spirituality in history taking
Spaeth, D. G.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2540

The autonomic nervous system in osteopathic therapy. 1948
Waitley, D. D.
The Journal of the American Osteopathic Association, 2000/10
Free full text

2541

Cervicogenic headache: mechanisms, evaluation, and treatment strategies
Biondi, D. M.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2542

Headache as a manifestation of otolaryngologic disease
Cosenza, M. J.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2543

The Role of Vibration or Oscillation in the Development of Osteopathic Thought
Comeaux, Z. J.
The AAO Journal, 2000/09
Free full text

2544

An Ancient Persian High-Velocity, Low-Amplitude Thrusting Technique for Somatic Dysfunctions of the Thoracic Spine
Namazian, M., Clark, R. C., Binkerd, J.
The AAO Journal, 2000/09
Free full text

2545

Carpal tunnel syndrome: more than just a problem at the wrist
Ramey, K. A.
The AAO Journal, 2000/09
Free full text

2546

Osteopathic cranial lesions. 1948
Kimberly, P. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2547

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2548

Psychologic aspects of chronic headache
Mueller, L.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2549

The cranial bowl. 1944
Sutherland, W. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2550

Treatment of acute migraine attacks
Weintraub, J. R.
The Journal of the American Osteopathic Association, 2000/09
Free full text

2551

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09

2552

Strategic choices for a primary care advantage: re-engineering osteopathic medicine for the 21st century
Glover, S. H., Rivers, P. A.
Health Services Management Research, 2000/08

2553

Circadian rhythm sleep disorders
D'Alonzo, G. E., Krachman, S. L.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2554

Dangers of sleepiness and inattention while driving
Eberhart, R., Hu, X., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2555

Sleep and breathing disorders: the genesis of obstructive sleep apnea
Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2556

Osteopathy and insanity. 1917
Gerdine, L. V.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2557

A Randomized Controlled Trial of Osteopathic Manipulation Following Knee or Hip Arthroplasty
Licciardone, J. C., Stoll, S. T., Herron, K. M., Gamber, R. G., Swift, J., Winn, W.
The Journal of the American Osteopathic Association, 2000/08

2558

Schizophrenia. 1939
Hildreth, A. G., Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2559

Workup and indications for polysomnography in patients with sleep-related complaints
Knox, K. S., Foresman, B. H.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2560

Effects of Osteopathic Manipulative Treatment on Knee Osteoarthritis
Pham, C. N., Knebl, J.
The Journal of the American Osteopathic Association, 2000/08

2561

Osteopathic and “old school“ results in mental diseases. 1933
Merrill, E. S.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2562

Psychosis and osteopathy
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

2563

The mechanism of anatomical structure in its relation to osteopathy. 1911
Bernard, H.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2564

Clinical research: the process
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2565

The emerging concept of the osteopathic lesion. 1948
Korr, I. M.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2566

Latex allergy: a primary care primer
Mahmoudi, M., Hunt, L. W.
The Journal of the American Osteopathic Association, 2000/07
Free full text

2567

Inhaled corticosteroid-induced bone loss and preventive strategies
Singh, R. F., Muskelly, C. C.
The Journal of the American Osteopathic Association, 2000/07
Free full text


2569

Osteopathic practice. 1903
Bernard, H. E.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2570

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06

2571

From the Archives: Prenatal Care
Grow, O. P.
The AAO Journal, 2000/06
Free full text

2572

Cardiovascular disease and obstructive sleep apnea: implications for physicians
Foresman, B. H., Gwirtz, P. A., McMahon, J. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2573

The compensatory pattern, as seen in art and osteopathy
Quinn, A.
The AAO Journal, 2000/06
Free full text

2574

Palpatory diagnosis. 1932
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2575

A glimpse of Dr. Still's art. 1917
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/06
Free full text

2576

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05


2578

Influenza and its osteopathic management. 1937
Ward, E. A.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2579

Osteopathic success in the treatment of influenza and pneumonia. 1919
Riley, G. W.
The Journal of the American Osteopathic Association, 2000/05
Free full text

2580

Somatic sensory impulses and vertebral lesions. 1921
Burns, L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2581

Use of magnetic resonance imaging to diagnose common wrist disorders
DiMarcangelo, M. T., Smith, P. A.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2582

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text

2583

Osteopathie - Die sanfte Chirotherapie
(Osteopathy - The gentle chirotherapy)
Klofat, I.
Ärztezeitschrift fur Naturheilverfahren, 2000/04

2584

Research Directions From 1940-1988
Beal, M. C.
The AAO Journal, 2000/03
Free full text

2585

Advancing Osteopathic Medicine in Health Care: Integrating OMM into Osteopathic Medical Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 2000/03
Free full text

2586

The overactive bladder in multiple sclerosis
Fingerman, J. S., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2587

Office evaluation of the patient with an overactive urinary bladder
Kowalczyk, J. J.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2588

Surgical and medical treatment options for urge incontinence
Lonsway, J. M.
The Journal of the American Osteopathic Association, 2000/03
Free full text

2589

Manual medicine treatment of the cervical spine and whiplash injury
Bilkey, W. J., Tomski, M. A.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

2590

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02

2591

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

2592

Reiter's syndrome and reactive arthritis
Parker, C. T., Thomas, D.
The Journal of the American Osteopathic Association, 2000/02

2593

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02

2594

The economic burden of back pain in the UK
Maniadakis, N., Gray, A.
Pain, 2000/01

2595

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01

2596

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01

2597

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01

2598

Role of antileukotriene agents in asthma therapy
Gawchik, S. M., Saccar, C. L.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2599

Osteopathy an independent system co-extensive with the science and art of healing. 1901
Littlejohn, J. M.
The Journal of the American Osteopathic Association, 2000/01
Free full text

2600

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01

2601

Muscle energy concepts - a need for change.
Fryer, G.
Journal of Osteopathic Medicine, 2000
Free full text

2602

A new challenge: Replacing opinion-based with evidence-based decisions
Heath, D. M., Kelso, A. F.
The AAO Journal, 1999/12
Free full text

2603

What's in a name? For DOs, plenty
Guglielmo, W. J.
Medical Economics, 1999/12

2604

Mechanism of action of high-velocity, low amplitude thrust technique
Mesina, J., Balmer, J., Esper, S., Esper, E., Evans, R., Hampton, D.
The AAO Journal, 1999/12
Free full text

2605

An overview of osteopathic medicine
Lesho, E. P.
Archives of Family Medicine, 1999/11


2607

A review of the principles of William G. Sutherland's general techniques
Golden, W. J.
The AAO Journal, 1999/09
Free full text

2608

Health services research: Evidence-based medicine and the AAO five-year strategy
Kelso, A. F., Heath, D. M.
The AAO Journal, 1999/09
Free full text

2609

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text

2610

Perspectives: An overview of support for osteopathy in the cranial field
Kuchera, M. L.
The AAO Journal, 1999/09
Free full text

2611

Gastroesophageal reflux disease update for the primary care physician
Mitz, H. S.
Journal of Osteopathic Medicine, 1999/08
Free full text

2612

Research resources to advance osteopathic theory and practice
Kelso, A. F., Heath, D. M.
The AAO Journal, 1999/06
Free full text

2613

Osteopathy – A philosophical perspective
Masiello, D. J.
The AAO Journal, 1999/06
Free full text

2614

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text

2615

Scripted role play: a technique for teaching sexual history taking
Schweickert, E. A., Heeren, A. B.
Journal of Osteopathic Medicine, 1999/05
Free full text

2616

An osteopathic approach to asthma
Rowane, W. A., Rowane, M. P.
Journal of Osteopathic Medicine, 1999/05
Free full text

2617


2618

Visualization technology in medical education
Gorbis, S., Hallgren, R. C.
Journal of Osteopathic Medicine, 1999/04
Free full text

2619

We stand on the shoulders of giants in our profession! What do we see?
Heath, D. M., Kelso, A. F.
The AAO Journal, 1999/03
Free full text

2620

So you want to be an ... osteopath
Hocking, J.
Nursing Times, 1999/03

2621

The management of low back pain: Short leg syndrome/postural balance
Nelson, K. E.
The AAO Journal, 1999/03
Free full text

2622

The principles of osteopathic structural therapy – Part IV
Page, L. E.
The AAO Journal, 1999/03
Free full text



2625

The Early History of Osteopathy
Dowling, D. J.
The AAO Journal, 1998/12
Free full text


2627

How does our profession get 100,000 cases of influenza reported?
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/12
Free full text

2628

A century of radiology in osteopathic healthcare
Rosenbaum, R. R.
Journal of Osteopathic Medicine, 1998/12
Free full text

2629


2630

The principles of osteopathic structural therapy – Part III
Page, L. E.
The AAO Journal, 1998/12
Free full text

2631

Women's health osteopathy: an alternative view
Hyne, J.
Nursing Management, 1998/12

2632

Scoliosis and Osteopathic Manipulative Treatment
Weatherly, J.
The AAO Journal, 1998/12
Free full text

2633

Office-based preceptorship: a creative approach to a learning and growth experience
Silverberg, L. I.
Journal of Osteopathic Medicine, 1998/11
Free full text

2634


2635

Truth in science
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/09
Free full text

2636

L'ostéopathie et la chiropraxie.
(Osteopathy and chiropractic)
Klein, P.
Revue médicale de Bruxelles, 1998/09

2637

Integrating cranial osteopathy with gnathologic orthopedics
Kennedy, J. M.
The Journal - American Academy of Gnathologic Orthopedics, 1998/09

2638

The origin and relief of common pain
Irvin, R. E.
Journal of Back and Musculoskeletal Rehabilitation, 1998/09

2639

The principles of osteopathic structural therapy – Part II
Page, L. E.
The AAO Journal, 1998/09
Free full text

2640

Scalene entrapment syndrome
Royder, J. O.
The AAO Journal, 1998/09
Free full text


2642

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text

2643

S.T.A.R.: A more viable alternative descriptor system of somatic dysfunction
Dowling, D. J.
The AAO Journal, 1998/06
Free full text

2644

Osteopathic Clinical Research Communications
Heath, D. M., Kelso, A. F.
The AAO Journal, 1998/06
Free full text

2645

Solar Plexus Injuries: An old injury with a new twist
Jones, J. M., May, T.
The AAO Journal, 1998/06
Free full text

2646

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06

2647

The principles of osteopathic structural therapy – Part I
Page, L. E.
The AAO Journal, 1998/06
Free full text

2648

Role of the DOs in the 'Spanish Flu' Pandemic of 1918-1920
Richardson, M. E.
The AAO Journal, 1998/06
Free full text

2649

Integrating osteopathic training into family practice residencies
Johnson, K. H., Raczek, J. A., Meyer, D.
Family Medicine, 1998/05

2650

Muscle energy concepts and coupled motion of the spine
Gibbons, P., Tehan, P.
Manual Therapy, 1998/05


2652

Dr. Still's Grasp of Truth
Booth, E. R.
The AAO Journal, 1998/03
Free full text

2653

Craniosacral rhythm: reliability and relationships with cardiac and respiratory rates
Hanten, W. P., Dawson, D. D., Iwata, M., Seiden, M., Whitten, F. G., Zink, T.
Journal of Orthopaedic & Sports Physical Therapy, 1998/03
Free full text



2656

The medical school curriculum for the 21st century
Wood, D. L., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/02

2657

An evaluation of the effectiveness of osteopathic treatment on symptoms associated with myalgic encephalomyelitis. A preliminary report
Perrin, R. N., Edwards, J., Hartley, P.
Journal of Medical Engineering & Technology, 1998/02


2659

Positional release techniques in the treatment of muscle and joint dysfunction
Chaitow, L.
Clinical Bulletin of Myofascial Therapy, 1998/01

2660

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01

2661

The basic principles of osteopathic practice
Hollis, A. S.
The AAO Journal, 1997/12
Free full text

2662

The sacrum: A bone of contention
Nelson, K. E.
The AAO Journal, 1997/12
Free full text

2663

Did D.D. Palmer visit A.T. Still in Kirksville?
Hart, J. F.
Chiropractic History, 1997/12

2664

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

2665

Anatomy of an OPTI: Part I. Form, function, and relationships
Meyer, C. T., Mann, M. P., Riley, C., Portanova, R.
Journal of Osteopathic Medicine, 1997/10
Free full text

2666

Osteopathic manifesto. X. The distinctive difference. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/10
Free full text

2667

Managing back pain in general practice--is osteopathy the new paradigm?
Williams, N.
British Journal of General Practice, 1997/10
Free full text


2669

The silver thread – The perennial aspect of osteopathic thought
Comeaux, Z. J.
The AAO Journal, 1997/09
Free full text

2670

Andrew Taylor Still, M.D.: founder of osteopathy
Burns, S. B., Burns, J. L.
The Journal of Alternative and Complementary Medicine, 1997/09

2671

The effect of osteopathic manipulative treatment (OMT) on heart rate and blood pressure in female athletes
Paul, F. A., Norton, J. M., Cross, N. A., Buser, B. R.
The AAO Journal, 1997/09
Free full text

2672

Osteopathic manifesto. IX. What about our distinctiveness? 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/09
Free full text

2673

Pondering the effects of the Reconciliation Budget law on osteopathic medical education
Wood, D. L.
Journal of Osteopathic Medicine, 1997/09
Free full text

2674

The art of osteopathy
Wales, A. L.
The AAO Journal, 1997/09
Free full text

2675

Osteopathic manifesto. VIII. Our distinct image. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/08
Free full text

2676

The controversy of cranial bone motion
Rogers, J. S., Witt, P. L.
Journal of Orthopaedic & Sports Physical Therapy, 1997/08

2677

An osteopathic prescription for medical education reform: Part 2. Specialty mix and community integration
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/08
Free full text

2678

Osteopathic manifesto. VII. Shadows and images. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/07
Free full text

2679

An osteopathic prescription for medical education reform: Part 1. Curriculum and infrastructure
Ross-Lee, B., Wood, D. L., Mann, D. D., Portanova, R. P., Kiss, L. E., Weiser, M. A.
Journal of Osteopathic Medicine, 1997/07
Free full text

2680

Osteopathic research: A challenge to the specialist
Eisenhart, A. W.
The AAO Journal, 1997/06
Free full text

2681

Fluid hydraulics in human physiology
Royder, J. O.
The AAO Journal, 1997/06
Free full text

2682

Osteopathic manifesto. VI. The light of the profession. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/06
Free full text


2684

Looking at the whole. Osteopathic health care in Michigan
Peters, B.
Michigan Health & Hospitals, 1997/06

2685

Introducing the cranial approach in osteopathy and the treatment of infants and mothers
Sullivan, C.
Complementary Therapies in Nursing and Midwifery, 1997/06

2686

Muscle tones
Waldron, B. J.
The AAO Journal, 1997/06
Free full text

2687

From 'Osteopathic Manipulative Procedure in Disorders of the Eye'
Wolf, A. H.
The AAO Journal, 1997/06
Free full text

2688

Repositioning maneuver for benign paroxysmal positional vertigo (BPPV)
Brooks, J. G., Abidin, M. R.
Journal of Osteopathic Medicine, 1997/05
Free full text

2689

Osteopathic medical considerations of reflex sympathetic dystrophy
Nelson, K. E.
Journal of Osteopathic Medicine, 1997/05
Free full text

2690

Osteopathic manifesto. V. Legislative and legal vigilance. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/05
Free full text


2692

Establishment of behavioral parameters for the evaluation of osteopathic treatment principles in a rat model of arthritis
Hallas, B., Lehman, S., Bosak, A., Tierney, S., Galler, R., Jacovina, P., Scandalis, T. A., Wells, M.
Journal of Osteopathic Medicine, 1997/04
Free full text

2693

Osteopathic manifesto. IV. The search. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/04
Free full text

2694

Soft tissue manipulation: neuromuscular and muscle energy techniques
Roberts, B. L.
Journal of Neuroscience Nursing, 1997/04

2695

Interlinear thinking: Are we thinking osteopathy?
Heath, D. M.
The AAO Journal, 1997/03
Free full text

2696

'Visible and recognized': osteopathic invisibility syndrome and the two percent solution
Gevitz, N.
Journal of Osteopathic Medicine, 1997/03
Free full text

2697

Osteopathic manifesto. III. The beginning or the end. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/03
Free full text

2698

Osteopathic manifesto. I. Introduction. II. The roots. 1981
Northup, G. W.
Journal of Osteopathic Medicine, 1997/02
Free full text

2699

Osteopathic physicians and expert medical testimony
McAbee, G. N.
Journal of Osteopathic Medicine, 1997/01
Free full text

2700

Research lacking in osteopathic medical profession
Wood, D. L.
Journal of Osteopathic Medicine, 1997/01
Free full text

2701

Planning research on ambulatory care
Heath, D. M., Kelso, A. F.
The AAO Journal, 1996/12
Free full text

2702

From Principles of Osteopathy
Page, L. E.
The AAO Journal, 1996/12
Free full text

2703

AOA continuing medical education
MacPherson, S. B., Rodgers, D. J.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2704

Osteopathic graduate medical education
Bronersky, V. M., Falbo, P. W.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2705

History of osteopathic medical education accreditation
Ward, W. D., Retz, K. C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2706

Research programs of the AOA and their role in osteopathic medical education
Retz, K. C., McGill, S. L.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2707

Income and expenditures of osteopathic medical colleges
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2708

Undergraduate osteopathic medical education
Rayman, C.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2709

Certification of osteopathic physicians
Glatz, L., Dolan, S.
The Journal of the American Osteopathic Association, 1996/11
Free full text

2710

Osteopathic medical education: the introduction of managed care principles into our undergraduate curriculum
Musser, A. E., Vinn, N.
The Journal of the American Osteopathic Association, 1996/10
Free full text

2711

A manipulative technique of Andrew Taylor Still as reported by Charles Hazzard, DO, in 1905
Van Buskirk, R. L.
The Journal of the American Osteopathic Association, 1996/10
Free full text

2712

Results of the 1996 National Resident Matching Program: family practice
Kahn, N. B., Jr., Garner, J. G., Schmittling, G. T., Ostergaard, D. J., Graham
Family Medicine, 1996/09

2713

Transforming osteopathic medical education
Ross-Lee, B., Kiss, L. E., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/08
Free full text

2714

Factitious disorders and the 'professional patient'
Lande, R. G.
The Journal of the American Osteopathic Association, 1996/08
Free full text

2715

Craniosacral therapy
Elsdale, B.
Nursing Times, 1996/07

2716

Osteopathic manipulative treatment applications for the emergency department patient
Paul, F. A., Buser, B. R.
The Journal of the American Osteopathic Association, 1996/07
Free full text


2718

Outcome Research on Health Care in Ambulatory Care Practice
Heath, D. M., Kelso, A. F.
The AAO Journal, 1996/06
Free full text

2719

An Osteopathic Approach to HIV/AIDS
Mulligan, T.
The AAO Journal, 1996/06
Free full text

2720

Fighting the odds in the UK
Richmond, C.
Canadian Medical Association Journal, 1996/05


2722

Ambulatory care training standards for continuity of care in osteopathic family medicine
Winters, F. D., Zonia, S., Cook, J. N., Dora, D. L., Meyer, C. T.
The Journal of the American Osteopathic Association, 1996/04
Free full text

2723

The osteopathic physician teacher
Grimshaw, D. N.
The AAO Journal, 1996/03
Free full text

2724

A functional approach to heel lift therapy
Johnson, K. H.
The AAO Journal, 1996/03
Free full text

2725

Curriculum goals for the training of osteopathic family practice residents for the year 2000
Dickerman, J., Rich, P.
The Journal of the American Osteopathic Association, 1996/03
Free full text

2726

Osteopathy and medical evolution (1962)
Korr, I. M.
The AAO Journal, 1996/03
Free full text

2727

Sacral shear: Review and a new treatment for obstetrical patients
Treadwell, R. C., Magnus, W. W.
The AAO Journal, 1996/03
Free full text

2728

Update on osteopathic medical concepts and the lymphatic system
Degenhardt, B. F., Kuchera, M. L.
The Journal of the American Osteopathic Association, 1996/02
Free full text

2729

Studying the impact of women on osteopathic physician workforce predictions
Simpson, M. A., Weiser, M. A.
The Journal of the American Osteopathic Association, 1996/02
Free full text

2730

(Manual therapy, chiropractic, osteopathy. From alternative therapy to medicine)
Ylinen, J., Piispanen, J., Silen, K., Airaksinen, O.
Duodecim, 1996/01

2731

Structural and Hormonal Influences on Pelvic Mechanics in Labor and Delivery
Tettambel, M. A.
The AAO Journal, 1995/12
Free full text

2732

Osteopathic postdoctoral training institution: the osteopathic 'road map' to graduate medical education viability
Opipari, M. I.
The Journal of the American Osteopathic Association, 1995/11
Free full text


2734

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text

2735

Hospital guidelines for diagnosis-related groups/osteopathic manipulative treatment
Feely, R. A.
The Journal of the American Osteopathic Association, 1995/09
Free full text

2736

The Nature of Fascia and the Role of Lower Extremity Fascia in Low Back Pain
Hessler, D. D.
The AAO Journal, 1995/09
Free full text

2737

From 'Practical Visions'
Millard, F. P.
The AAO Journal, 1995/09
Free full text

2738

Three-Dimensional Counterstrain Lifts (3-DCL) Theoretical Concept and Applications
Carlson, J. A., Carlson, J. M., Earl, D. T.
The AAO Journal, 1995/06
Free full text

2739

Axoplasmic Transport
Dott, G. A.
The AAO Journal, 1995/06
Free full text

2740

A standardized form for DSM-IV review of symptoms and mental status examination for students and residents
Reeves, R. R., Bullen, J. A.
The Journal of the American Osteopathic Association, 1995/06
Free full text

2741

Continuum Technique
Typaldos, S.
The AAO Journal, 1995/06
Free full text

2742

The Experimental Method of Learning
Young, M. D.
The AAO Journal, 1995/06

2743

Nerve compression syndromes as models for research on osteopathic manipulative treatment
Luckenbill-Edds, L., Bechill, G. B.
The Journal of the American Osteopathic Association, 1995/05
Free full text

2744

Making sense of federal GME reforms: the need for secondary reforms
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/05
Free full text

2745

Emphasizing a preventive medicine orientation during primary care/family practice residency training
Inwald, S. A., Winters, F. D.
The Journal of the American Osteopathic Association, 1995/04
Free full text

2746

Making sense of federal GME reforms: the impact on osteopathic medicine
Meyer, C. T.
The Journal of the American Osteopathic Association, 1995/04
Free full text

2747

Challenges and opportunities in occupational medicine
McCunney, R. J.
The Journal of the American Osteopathic Association, 1995/02
Free full text

2748

Postnatal back care
Parsons, C.
The Modern Midwife, 1995/02

2749

A model for improving generalist physician output: the osteopathic experience
Cummings, M., Ennis, M.
Academic Medicine, 1995/01
Free full text

2750

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text

2751

Thank you, Mr Shaw
Pheils, M. T.
British Medical Journal, 1994/12

2752

Triggerband Technique
Typaldos, S.
The AAO Journal, 1994/12
Free full text

2753

A Hypothesis for the Facilitated Segment Based Upon Biological Principles Associated with Tumorigenesis
Yonuschot, G., Mokler, J., Winterson, B. J.
The AAO Journal, 1994/12
Free full text

2754

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text

2755

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text

2756

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text

2757

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text


2759

Management of the Cervical Area
Denslow, J. S.
The AAO Journal, 1994/09
Free full text

2760



2762


2763

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09

2764

Clinical practice guidelines: a review
Hayes, O. W.
The Journal of the American Osteopathic Association, 1994/09
Free full text

2765

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

2766


2767

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

2768

The outlook for osteopathic medical specialists within a reformed healthcare system
Ross-Lee, B., Weiser, M. A., Kiss, L.
The Journal of the American Osteopathic Association, 1994/07
Free full text


2770

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text

2771

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text

2772

A Tensegrity Model for Osteopathy in the Cranial Field
Cummings, C. H.
The AAO Journal, 1994/06
Free full text

2773

Stranger in a New Land
Mills, M.
The AAO Journal, 1994/06
Free full text

2774

Introducing the Fascial Distortion Model
Typaldos, S.
The AAO Journal, 1994/06
Free full text

2775

Quality of Care: An Assessment of the Contributions of Osteopathic Medicine
Chila, A. G.
The AAO Journal, 1994/06
Free full text

2776

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text

2777

State healthcare reform: an arena for the osteopathic medical profession's influence
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/05
Free full text

2778

Alternative medicine in the United States
Wardwell, W. I.
Social Science & Medicine, 1994/04

2779

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text


2781

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text


2783

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text


2785

Manual Medicine and its Role in Psychiatry
Osborn, G. G.
The AAO Journal, 1994/03
Free full text

2786

Osteopathy – How It Differs from Other Manual Methods
Woodall, P. H.
The AAO Journal, 1994/03
Free full text

2787

Medicaid reform: an opportunity for the osteopathic medical profession
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/03
Free full text

2788

Managed care: an opportunity for osteopathic physicians
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/02
Free full text

2789

Danger and safety in medicines
O'Neill, A.
Social Science & Medicine, 1994/02

2790

Osteopathic manipulative treatment: what does it really do?
Steiner, C.
The Journal of the American Osteopathic Association, 1994/01
Free full text

2791

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text


2793

Definitions of Osteopathy as a School of Medicine
McCole, G. M.
The AAO Journal, 1993/12
Free full text

2794

The osteopathic distinction: fact or fancy?
Peppin, J. F.
The Journal of Medical Humanities, 1993/12

2795

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text


2797

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text

2798

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text

2799

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

2800

We Need National Health – Not National Health Insurance
Clark, R. C.
The AAO Journal, 1993/09
Free full text

2801

The Lesion
Hulett, G. D.
The AAO Journal, 1993/09
Free full text

2802


2803

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text

2804

Complementary medicine. Osteopathy
Trevelyan, J.
Nursing Times, 1993/08

2805

Die vergessenen Gutachten über die Chiropraktik
(Forgotten expertise about chiropractic)
Geiser, M.
Schweizerische Rundschau für Medizin Praxis, 1993/08

2806

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text

2807

Type “O“ disorders
Walker, B. F.
COMSIG Review, 1993/07
Free full text

2808

Pioneer Women in Medicine
Carlton, C.
The AAO Journal, 1993/06
Free full text

2809

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text


2811


2812

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text

2813

Support of collaborative practice
Kuehn, A. F.
The Missouri Nurse, 1993/04

2814

Osteopathy--an aid to the healing process
Waldman, P.
Professional Nurse, 1993/04

2815

Shame and the origin of physician-patient conflict
Martin, J. T.
The Journal of the American Osteopathic Association, 1993/04
Free full text

2816

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text

2817

The Centennial Celebration: The Crime of the Century
Baker, J. T.
The AAO Journal, 1993/03
Free full text

2818

Thoracic outlet syndrome--a myofascial variant: Part 3. Structural and postural considerations
Sucher, B. M., Heath, D. M.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2819

Integrating OMT Into The Hospital Setting
Jones, L. B.
The AAO Journal, 1993/03
Free full text


2821

Primary & Secondary Respiration – Part II
Lee, R. P.
The AAO Journal, 1993/03
Free full text

2822

Osteopathie
(Osteopathy)
Beck, M.
Deutsche Krankenpflegezeitschrift, 1993/03

2823

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2824

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

2825

Early osteopathy gives best results
Nursing Standard, 1993/02

2826

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text

2827

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text

2828

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text

2829

Skin manifestations of human immunodeficiency virus (HIV): Part 2. Noninfectious skin manifestations
Kurgis, B. S.
The Journal of the American Osteopathic Association, 1993/02
Free full text

2830

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text

2831


2832

Patient Education Is Vital to Osteopathy's Future
Jones, L. B.
The AAO Journal, 1992/12
Free full text

2833

The crisis in osteopathic medicine
Meyer, C. T., Price, A.
Academic Medicine, 1992/12

2834

Primary & Secondary Respiration – Part I
Lee, R. P.
The AAO Journal, 1992/12
Free full text

2835

Integrating Osteopathic Medicine into the Second 100 Years
O'Connell, J. A.
The AAO Journal, 1992/12
Free full text

2836

Anatomy, Asthma and Dysautonomia
Sanders, E. C.
The AAO Journal, 1992/12
Free full text

2837

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

2838

Continuing Osteopathic Research in New Zealand
Carruthers, R.
The AAO Journal, 1992/09
Free full text

2839

Mississippi State Board of Medical Licensure annual report July 1, 1990 through June 30, 1991
Morgan, F. J.
Journal of the Mississippi State Medical Association, 1992/09


2841

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text

2842

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09

2843

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09

2844

The evolution of osteopathic manipulative technique: the Spencer technique
Patriquin, D. A.
The Journal of the American Osteopathic Association, 1992/09
Free full text

2845

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text

2846

One doctor's Rx for the recession
Rice, B.
Medical Economics, 1992/08

2847

Will Your Recipe Even Be In The Cookbook?
Ammann-Hasbrouck, L.
The AAO Journal, 1992/06
Free full text

2848

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text

2849

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text

2850

Somatic Dysfunction: A Neurophysiologic & Osteopathic Overview
Tsompanidis, A. J.
The AAO Journal, 1992/06
Free full text

2851

Rheumatoid Arthritis: The Incurable Disease?
Wright, H. O. L.
The AAO Journal, 1992/06
Free full text

2852

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text

2853

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05

2854

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

2855

(Diseases of the autonomic nervous system. General aspect of symptomatology)
Takahashi, A., Hasegawa, Y., Kihara, M., Nakao, N.
Nihon Rinsho, 1992/04

2856

Osteopathy: the 'orthodox' alternative
Kaye, J.
Occupational Health, 1992/04

2857

Osteopathy: the 'orthodox' alternative
Kaye, J.
Occupational Health, 1992/04

2858

Laterally transposed pelvis: a new and proper name for an old problem
Patriquin, D. A.
The Journal of the American Osteopathic Association, 1992/04
Free full text

2859

Osteopathic Research in New Zealand
Carruthers, R.
The AAO Journal, 1992/03
Free full text

2860

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03


2862

Osteopathy & Chronic Pain
Miller, T. D.
The AAO Journal, 1992/03
Free full text

2863

Case presentation as a teaching tool: making a good thing better
Brose, J. A.
The Journal of the American Osteopathic Association, 1992/03
Free full text

2864

Observations on A. T. Still
Willard, A.
The AAO Journal, 1992/03
Free full text

2865

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text

2866

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text

2867

OLIO+: an osteopathic medicine database
Woods, S. E.
Medical Reference Services Quarterly, 1991/12

2868

Cranial Osteopathy: A New Perspective
Ferguson, A.
The AAO Journal, 1991/12
Free full text

2869

Let's Return to the Basics
Heatherington, J. S.
The AAO Journal, 1991/12
Free full text


2871

Evaluation of Managed Care Contracting
Schnack, T. H.
The AAO Journal, 1991/12
Free full text

2872

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text

2873

A tissue pressure model for palpatory perception of the cranial rhythmic impulse
Norton, J. M.
The Journal of the American Osteopathic Association, 1991/10
Free full text

2874

The Tightrope Walk of Osteopathy
Ferguson, A.
The AAO Journal, 1991/09
Free full text

2875

Pathophysiologic Models: Aids to the Selection of Manipulative Techniques
Hruby, R. J.
The AAO Journal, 1991/09
Free full text

2876

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text

2877

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text

2878

Osteopathic Medicine: A Century Old Prophesy of Modern Health, Nutrition and Exercise Principles
Ramirez, M. A., Spillman, D. M., Lipnickey, S. C.
The AAO Journal, 1991/06
Free full text

2879

Clinical Findings in the Suspect Patient with Low Back Pain
Teitelbaum, D.
The AAO Journal, 1991/06
Free full text

2880

Cranial osteopathy
Holmes, P.
Nursing Times, 1991/05

2881

An alternative method of teaching strain/counterstrain manipulation
Woolbright, J. L.
The Journal of the American Osteopathic Association, 1991/04
Free full text

2882

Nursing practice in an osteopathic community
Flarey, D. L.
Nursing Administration Quarterly, 1991/03

2883

Why The Osteopathic Profession Needs a Triple By-Pass In Order to Survive
Jones, L. B.
The AAO Journal, 1991/03
Free full text


2885

Anatomic Metaphors: Clues to the Emotions of Our Patients
Teitelbaum, D.
The AAO Journal, 1991/03
Free full text

2886

Osteopathic research: the needed paradigm shift
Korr, I. M.
The Journal of the American Osteopathic Association, 1991/02
Free full text

2887

Osteopathic medicine
Eaton, J. A., Bates, B. P., Willard, F. H.
Orthopaedic Nursing, 1991/01
Free full text

2888

The sociopolitical development of British chiropractic
Baer, H. A.
Journal of Manipulative and Physiological Therapeutics, 1991/01



2891

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text

2892

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text

2893

L'ostéopathie crânienne, leurre ou realité?
(Cranial osteopathy, delusion or reality?)
Ferré, J. C., Chevalier, C., Lumineau, J. P., Barbin, J. Y.
Actualités odonto-stomatologiques, 1990/09

2894

Osteopathic medicine: the profession's role in society
Korr, I. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text

2895

A model of cooperation between complementary and allopathic medicine in a primary care setting
Budd, C., Fisher, B., Parrinder, D., Price, L.
British Journal of General Practice, 1990/09

2896

Scott Memorial lecture: the challenge of change
Greenman, P. E.
The Journal of the American Osteopathic Association, 1990/08
Free full text

2897

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text

2898

Quality assurance monitoring of osteopathic manipulative treatment
Koss, R. W.
The Journal of the American Osteopathic Association, 1990/05
Free full text

2899

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text

2900

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text

2901

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text

2902

War, politics, and osteopathic medicine
Goldstein, M.
The Journal of the American Osteopathic Association, 1990/02
Free full text

2903

Controversies in temporomandibular joint disorder
Ramer, E.
The Dental Clinics of North America, 1990/01

2904

Management of deafness in otitis media with effusion
Mauer, T. P.
The Journal of the American Osteopathic Association, 1966/12

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends