Advanced search



 
 82.7% of the records
 
 17.3 % of the records
 
 55.7 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Medically Underserved Area*Osteopathic Medicine*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabducens nerveabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsolute alpha powerabstractabstractsacademicacademic barrieracademic difficultiesacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic surgeryacademies and institutesacademy of osteopathyaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive release techniqueactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadmissionadmission criteriaadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced trainingadvancing TBI careadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective empathyaffective touchafferenceAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcoholismalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidangina pectorisangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltingAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappraisalsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismArcticarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory test foilartifical intelligenceartificial jointartificial respirationartificial ventilationartilcleartsartticleasanaaspirationassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattentionattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical swallowingaudiovisual aidsauditory canalauditory channelauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawards and prizesawarenessawareness of spaceaxesaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberinebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioenergetic modelbioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth processbirth traumabladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterbloatingblocadesblockchainblockingbloodblood cell countblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactate levelblood memorial lectureblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood supplyblood systemblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone densitybone developmentbone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel obstructionbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrand disputeBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksC-reactive proteinC-tactileC-tactile afferentsC. BowlesC. DoveC. J. Smutny IIIC. S. GonsteadC. SteeleC. WeaverC1cability crisiscadavercadaver dissectioncadaveric dissectioncadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciumcalfCaliforniacaloric restrictioncalot’s triangleCAMCanadaCanadiancanal syndromecancercancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecarbon dioxidecarbon emissionscarcinoid tumorcarcinomacardiac arrestcardiac frequencycardiac implantable electronic devicecardiac outputcardiac patient managementcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiologycardiopulmonary functioncardiothoracic surgerycardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase reportcase reportscase seriescase studycase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicothoracic diaphragmcervicothoracic junctioncesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wall defectchewingChiari I malformationChicagoChicago College of Osteopathic Medicinechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbedchildbirthchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communitychinese medicinechinese traditional medicinechiropracticchiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclavicleclavicle fractureCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoituscold temperaturecoliccolitis ulcerosacollaborationcollagencollagen fiberscollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasesColoradocolorectal endometriosisCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phasecongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuity of patient carecontinuity of the bodycontinuum distortioncontol interventionscontraceptive carecontract governing medical treatmentcontractilitycontractioncontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapycooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilitycostal cartilagescostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial volumecranial-sacral-motioncraniocranio sacral osteopathycranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-sacral osteopathycranio-sacral osteopathycranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcriticism of scientific basis of osteopathyCrohn diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrowsCRPScruciate ligamentcryingcrying attackscrying infantsCSF-mobilityCSTctCT-guided periradicular infiltrationcubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutionculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniquecybernetic systemcyberneticscynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. HerbertD. J. ClauwD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latadeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdeglutition disordersdegreesdehydrationdelayed developmentdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissolutiondistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdysafferentationdysarthriadysautonomiadyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational measurementeducational modeleducational modelseducational modeseducational possibilitieseducational resourceeducational standardseducational statuseducational technologyeducational toolsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30elastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselbowelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic fieldselectromagnetic interactionelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyempirical approachempirical evidenceempirical researchempiricismemployee disciplineemployment disabilityemu oilenactivismencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineEpley maneuverEpstein-Barr virusEQ-5Dequilibriumeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerythrocyte counterythrocytesesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidenced based osteopathyeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitionexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocular musclesextrinsic sleep disorderseyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeyeballeyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfacefacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial structurefacial tumorsfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitationfactfactor analysisfactual databasesfacultyfaithfakefallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial contractionfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial releasefascial researchfascial skeletonfascial systemfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyfast fourier transformfastingfatal dysrythmiafatiguefatigue statusfatiqueFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst trimester pregnancyfirst year of lifefirst-choice residencyfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexion distraction techniqueflexion rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow ratefluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood hypersensitivityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot lesionsfoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionfracture healingfracturesFraminghamFranceFrankfurt DeclarationFred Mitchellfree energy principlefree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency-tuningfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principlefulcrumfull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfuture of osteopathyG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilityGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenetic mutationgeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenomicsgentlenessgeodesicgeographic factorsGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingivitisgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral jointglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteus maximusglycated hemoglobin Aglycosylationglygoaminoglycansglymphaticglymphatic systemglymphaticsgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgraduategraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongutgut associated lymphoid tissuegut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaitihallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand painhand strengthhandballhandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharmonic techniqueharmonic therapyHawthorne effectheadhead and neck regionhead impulse testhead injuryhead jointshead motionhead movementhead movementshead painhead positionhead repositioninghead retraction reflexheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare costhealthcare costshealthcare deliveryhealthcare initiativehealthcare needshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy metalsheelheel liftheel lift therapyheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicrania continuahemiparesishemipelvishemiplegiahemodynamichemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity, low-amplitudeHigher educationhiphip arthroplastyhip dislocationhip dysplasiahip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhirsutismHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistorical articlehistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organshome carehome exercisehomeless personshomeless populationhomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axishrvHTA-Report 124humanhuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehumanitiesHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourhurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronic acidhydrationhydraulic mechanismhydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogonadismhypomobilitieshypomobilityhypopnoeahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICD-10ICD-11ICFICHDichemic compression techniqueicosahedronICPideal muscle functionidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimage-guided spine interventionimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantationsimpotenceimpotence medicineimpulsein vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationInfrared thermal camerainfrared thermographyinfraspinatusinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninpatientinpatient outcomeinpatient rehabilitationinpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinsufficiency fractureinsulainsulininsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrinsintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8Interleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal medicineinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternationalityinternetinternet useinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview seriesinterviewsintestinalintestinal constipationintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintolerance to drugsintra ocular pressureintra- and inter-rater reliabilityintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemic compressionischemic pressureischialgiaIsele-methodisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohnston’s functional methodsjointjoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejoyful discoursejudgmentjugular compressionjumpingjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketorolac tromethaminekeyword searchkidneykidney mobilitykidney motilitykidney stonekidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematicskinesio tapekinesiographykinesiologykinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee injuriesknee injuryknee jointknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory testlaboratory valueslabral tearlacerationslack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestineLarson syndromelaryngitislarynxLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture seriesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukotriene antagonistsleukotrieneslevator ani syndromelevel of evidencelevels of anxiety and depressionLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdle muscular dystrophylimb injurieslimb placodelimb symmetrylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal studieslongitudinal studylorazepamlordosislordotic angleloss of a childloss of childlovelow anorectal malformationlow backlow back injurylow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic manipulationlumbopelvic painlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelunglung capacitylung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusm. piriformism. rectus capitis posterior minorM. WilsonM. Wyvekensmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratesmatched-pair analysismateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatrix-rhythm-therapymattermaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionmediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical graduatesmedical historymedical history takingmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical practicemedical practice managementmedical prescriptionsmedical professionmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmelancholic wholenessmelanomaMelicien TettambelmembranesmemorymenMeniere’s diseasemeningesmeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental disordermental disordersmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticameridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetastasismetastatic abdominal cancermetastudiesmethodismmethodological qualitymethodologymethodsmethyl-sulfonyl-methanemethylprednisolonemetronidazoleMFI-20mfrMFT challenge discmiceMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild traumatic brain injurymilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studymobile appsmobile clinicmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMöbius syndromemolar shimmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRImsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle contractilitymuscle contractionmuscle developmentmuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tendernessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal injurymusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathyMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymytonometryN. Mithanaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative American studentsnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessneedle biopsyneedlesneeds assessmentnegentropyNelson-Dennyneonatalneonatal abstinence syndromeneonatal hyperbilirubinemianeonatal intensive care unitneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsnephroptosisnerve activitynerve compressionnerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingneumuscular therapyneuracneural canalneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroinflammationneurokinesiologyneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular junctionneuromuscular rehabilitationneuromuscular systemneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuropsychiatric disorderneuropsychological testsneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotransmissionneurotransmitterneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstetic populationobstetric deliveryobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal planeocclusal splintocclusal splint therapyocclusionocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular injuryocular motoricocular painoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline videoonline-surveyonset of laborOntarioopen carpal tunnel releaseopen disclosureopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid use disorderopioid-related disordersopioidsopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoral ?uidoral aversionoral cavityoral diagnosisoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan of perceptionorgan systemsorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic manipulationorthopedic proceduresorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteochondrosisosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisOsteothekOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. KimberlyP. MisslinP. Schwindpad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain managementpain measurementpain neurophysiologypain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepaintingspalatal disjunctionpalatine bonepaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackspanic disorderspapillomavirus infectionspapillomavirus vaccinesparaesophageal herniaparafunctionparallel accreditationparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentpartient-reported outcomesparturitionpassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpelvicpelvic adhesionspelvic anatomypelvic bonespelvic compression testpelvic diagnosispelvic disorderspelvic floorpelvic floor assessmentpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centered carepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalguspharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacypharmacy educationpharynxphase shiftPhD thesisphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphytotherapyPIC syndromepicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpityplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disordersplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastspodiatric medicinepodiatrypoint of balancepoint of entrypoints of referencepolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespopulation dynamicspopulation healthpopulation surveillanceportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromeposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencypovertypowerpower transmissionpptpractical componentpractical nomenclaturepracticepractice administrationpractice guidelinepractice guidelinespractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-menopausal womenpre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive processingpredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematurepremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologypreoperative carepreoperative preparationpreparationpreparationspreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepreserved ejection fraction exacerbationspressurepressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive medicinepreventive workPribadi-Upleger’s signprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprisonprivate collegesprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsproceduresprocess approachprocessesprocessus styloideusprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studyPROMsprone positionproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapyPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR.P. Leeraceracial inequityracing athletesradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionRANTESraperapid diagnosis of adequate muscle effortrasterstereographyratrate of reactionratsrctre-findingsre-orientation processreactionreactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseasesrespiratory disordersrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumeresponses to treatmentrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoscopyretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff reconstructionroutine examinationroutine findingsroutine physical therapyrowingrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. Typaldossacral basesacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal regionsacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsscalesscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsschedulingschematic model of the spineschismschizophreniascholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic neuritissciatic neuropathysciatic painsciaticasciencescientific journalscientific proofscientific publicationscientific researchscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreeningscreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthseasicknessseasonal allergicseated flexion testsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativesseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshared decision makingsharing informationsharp painshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshinglesshockshock wave therapyshoeshoesshort assessment of patient satisfactionshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-effectsidebendingSIDSsighing dyspnoeasigmoid colonsign languagesignal transductionsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinusitissirvaSister Mary Joseph nodulesitting flexion testsituation analysissitus ambiguussitus inversusskatersskeletalskeletal muscleskiersskiingskillskills transferskinskin blood flow indexskin burning sensationskin cancerskin conductanceskin diseaseskin diseasesskin disorderskin lesionsskin microcirculationskin neoplasmsskin temperatureskin testsskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmokerssmokingsmoking cessationsmoking preventionsmooth musclesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessolar keratosissoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspeakingspecial needs childrenspecializationspecialty boardspecialty boardsspecialty trainingspecific adjustmentspecific laryngeal manipulationspecificityspectroscopyspeechspeech acousticsspeech developmentspeech development disordersspeech disorderspeech disordersspeed of blood flowspelling disordersspencer techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainsSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stephen Tyremanstereoidssterilitysternal painsternal recoil techniquesternotomiesternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoragestrabismstrabismusStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniqueStretchingstretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsStudents, Pharmacystudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubclavian arterysubclavian steal syndromesubcutaneous hemorrhageSubject Headingssubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointSubtle energy measurementsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling intolerancesudden infant death syndromeSudeck syndromeSufismsugarsuicidesumatriptanSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperoxide anion radicalssupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessuprarenal gland,supraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurveysSurveys and Questionnairessurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationSynergeticsynostosis sphenooccipitalis,synovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetastwelttattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBI careteachersteachingteaching assistantteaching clinicteaching effectivenessteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteamUP Short-FormteamUP-SFteamworktechnical requirementsTechniquetechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth settingtelemanagementtelemedicinetelemetrytelephonetelescopic bridgeworktemperamenttemperaturetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendonitistendonstenetstennistennis elbowtenotomytensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?TGF-?Thai foot reflex zone massagethai massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical basistheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic interactionstherapeutic modalitiestherapeutic modelsTherapeutic presencetherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal, skin temperaturethermodiagnosisthermographythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic mobilitythoracic outletthoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree months colicthree-dimensional imagingthree-dimensional printingthroacic transverse processesthroatthrombolytic therapythrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticksticstideTietze syndromeTiffeneau indextilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?tnf-?TNF-atnterpretation analysis comparative studiestobacco use disordertoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollisTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal knee arthroplastytotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstrainingtraining deliverytraining hourstraining programmstraining programstraining requirementstraining supporttranscranial Doppler ultrasonographytranscranial magnetic stimulationtransdisciplinarytransferencetransformation phasestransgendertransgender personstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretrauma-informes caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatically induced lesiontraumatized patientstravelTravell trigger pointstreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point therapytrigger pointstriggerstrimesters of pregnancytrinitytrisomy 21triunetriune mantriune osteopathytriunity Routine-diagnosistroponin itroubles musculo-squelettiquestruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk stabilizationtrunk torsiontrusttruthtruth disclosuretryptaminestuba auditiva techniqueTug navicular techniquetumortumor necrosis factortumor necrosis factor-alphatunnel syndrometurbttutoringtwin pregnancytwinstympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderservedunderserved areaunderserved areasunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionUnified Parkinson Disease Rating Scaleunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beingUniversitiesuniversityuniversity outpatient departmentsunna nevusunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamicsurogenital stage or phallic stageurogenital systemurogenital tracturologic systemurologyurticariaUSAusmleUSMLE scoresUSMLE Step 1usmle step 2uterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvaliditityvalidityvalidity of testsvalue added taxvaluesvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevarus forefootVASvascular abnormalityvascular and nerval mobilisationvascular diseasesvascular patencyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverificationVermontvertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHWaleswalkingwantingwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcarewestern worldWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwoman?s organismwomenwomen’s healthworkwork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopworld health organisationWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenZ. ComeauxzenZIMMTzinczinc deficiencyZink modelZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

1011 results (please see below)  Sort:    


3

Osteopathy in the rehabilitation of patients with recurrent musculoskeletal injuries: an experimental study
Sankova, Maria V., Nikolenko, Vladimir N., Vovkogon, Andjela D., Oganesyan, Marine V., Trishina, Aleksandra, Babarzai, Lema, Antonyan, Sevak Zh, Babarzai, Faraidun, Pontes-Silva, André, Zharikov, Yury O.
Manuelle Medizin, 2024/04

4

A tailored training based on students’ and teachers’ needs to improve palpation skills: A quantitative part of a mixed-method study
Lavazza, C., Zangoni, G., Sozzi, F., Abenavoli, A., Barenghi, M.
International Journal of Osteopathic Medicine, 2024/03


6

The inter- and intra-rater reliability of the manual diaphragm assessment scale in healthy participants
Viegas, I., Francisco, C., Farinha, E., Nunes, A.
International Journal of Osteopathic Medicine, 2024/03


8

Is Craniosacral Therapy Effective? A Systematic Review and Meta-Analysis
Ceballos-Laita, L., Ernst, E., Carrasco-Uribarren, A., Cabanillas-Barea, S., Esteban-Pérez, J., Jiménez-del-Barrio, S.
Healthcare, 2024/03

9

Effects of osteopathic manipulative treatment on maternal-fetal hemodynamics in third trimester pregnant women: A prospective study
Arruda Correia, M. L., Peixoto Filho, F. M., Gomes Júnior, S. C., de Jesus, G. R.
PLoS One, 2024/03
Free full text

10

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text


12

(Gender competence in medicine and osteopathy)
Wikus, P., Wimpissinger, A.
Osteopathische Medizin, 2023/12


14

Construct validity and reliability of a test for sacroiliac dysfunction: Downing test
Ribeiro, R. P., Guerrero, F. G., Camargo, E. N., Pivotto, L. R., Aimi, M. A., Candotti, C. T., Loss, J. F.
International Journal of Osteopathic Medicine, 2023/12

15

Preliminary Evaluation of an Osteopathic Manipulative Treatment to Prevent Motion Sickness
Thomas, V. A., Kelley, A. M., Lee, A., Fotopoulos, T., Boggs, J., Campbell, J.
Aerospace Medicine and Human Performance, 2023/12

16

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12

17

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

18

Quantifying the Effect of Thoracic Myofascial Release on Muscle Tone, Stiffness, and Elasticity
Spicer, S. J., Averell, N., Gawash, A., Goodwin, B., Mahmud, R., St. John, R., Lo, D., King, A.
Journal of Osteopathic Medicine, 2023/12



21


22

Integrating osteopathic manipulative treatment into prenatal care visits in a family medicine resident clinic
Rath, T. D., Baum, K. R., Kamstra, B. D., Schriever, J. A.
Journal of Osteopathic Medicine, 2023/09
Free full text

23

The Effectiveness of a Mobile Health Clinic Delivering Mandatory and Elective Middle School Immunizations: A Descriptive Analysis
LaGattuta, N. R., Wilson, T. C., Failla, J. A., Stoner, A. M., Fradua, K., Brown, J., Byrd, S. C., Wilson, A., Jones, D., Carroll, L.
Cureus, 2023/09
Free full text

24

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text

25

Effects of a focused training on first-year osteopathic medical students' ability to incorporate point-of-care ultrasound in assessment of the anterior knee
Weaver, C., Heath, D. M., Makin, I. R. S., Hanamaika'i, K., Kanumalla, R., Matsushita, S., Chatta, P., Adhikari, S.
Journal of Osteopathic Medicine, 2023/07
Free full text

26

Modifying functional brain networks in focal epilepsy by manual visceral-osteopathic stimulation of the vagus nerve at the abdomen
Lehnertz, H., Broehl, T., Rings, T., von Wrede, R., Lehnertz, K.
Frontiers in Network Physiology, 2023/07
Free full text

27

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

28

Effect of Objective Training Programs on Symmetry and Accuracy of Passive Motion Force Application
Hajicek, J., Huhn, M., Starks, Z., Wang, Y.F., Degenhardt, B.
The AAO Journal, 2023/06

29

Effect of Occipito-Atlantal Decompression, Transcutaneous Auricular Vagus Nerve Stimulation, and the Splenic Pump on Circulatory Immune Cell Numbers
Romero, F., Kania, A., Huynh, R., Cerami, K., Wong, J., Chen, M., Viegas, A., Stauss, H.
The AAO Journal, 2023/06

30

Palpatory tests in manual therapies: an international survey on osteopathic clinical practice
Novelli, E., Molinari, L., Consolo, S., Mingrone, L.
Journal of Complementary and Integrative Medicine, 2023/06
Free full text


32

Quantitative ultrasound to assess efficacy of treatment for neck somatic dysfunctions: a feasibility study
Tran, A., Ngo, T., Roberts, T., Ko, E., Holmgren, J. G., Edwards, C., Coleman, M., Gao, J.
Journal of Osteopathic Medicine, 2023/06
Free full text

33

Соматическая дисфункция. Клинические рекомендации 2023
(Somatic Dysfunction. Clinical Guidelines 2023)
Mokhov, D. E., Belash, V. O., Aptekar, I. A., Nenashkina, E. N., Potekhina, Y. P., Tregubova, E. S., Belyaev, A. F.
Russian Osteopathic Journal, 2023/06


35

Assessing Clinical Reasoning in Medical Students Using a Virtual Patient Simulator
Abdulnour, R., O'Rourke, M., Smith, T.
Diagnosis, 2023/05

36

Virtual Deliberate Practice: Assessing Clinical Reasoning Using an Illness Script-based Simulator
Abdulnour, R. E., Furfaro, D., Sternschein, R., Smith, T. M., Drazen, J. M.
American Journal of Respiratory and Critical Care Medicine, 2023/05

37

Comparison of Occupational Therapy and Osteopathic Manipulative Treatment in Neonatal Intensive Care Units
Saleem, S., Burger, K., Takata, B., Zufall, B., Oosterbaan, C.
Journal of Investigative Medicine, 2023/05

38

Associations of clinical personnel characteristics and controlled substance prescribing practices
Millhollon, R., Elenwo, C., Lundberg, A., Roberts, W., Beaman, J., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2023/05
Free full text

39

Validation of subjective manual palpation using objective physiological recordings of the cranial rhythmic impulse during osteopathic manipulative intervention
Pelz, H., Müller, G., Keller, M., Mathiak, K., Mayer, J., Borik, S., Perlitz, V.
Scientific Reports, 2023/04
Free full text


41

Right Shoulder Deformity: Clavicle Fracture
Pargeon, M., Tjiattas-Saleski, L.
Osteopathic Family Physician, 2023/03











52

Reconceptualizing Somatic Dysfunction in the Light of a Neuroaesthetic Enactive Paradigm
Consorti, G., Castagna, C., Tramontano, M., Longobardi, M., Castagna, P., Di Lernia, D., Lunghi, C.
Healthcare, 2023/02
Free full text

53

Structural abnormalities and osteopathic considerations in primary immunodeficiencies
Rowane, M. J., Callahan, M. A., Schend, J. E., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2023/01
Free full text

54

The role of virtual reality (VR) with haptic feedback in enhancing physical examination skills of health care students – A systematic review protocol
Kovanur Sampath, K., Arumugam, A., Yaghi, E., Chidambaranathan, K., Andersen, P.
International Journal of Osteopathic Medicine, 2022/12






60

Evaluation of Osteopathic Principles in Cadaveric Specimens Using Radiological Assessment
Siddiqi, I., Wang, A., Marino, M., Bowen, I., Miulli, D. E.
Cureus, 2022/12
Free full text

61

The Effects of Upper Trapezius Muscle Energy Technique on Pain, Muscle Tension, and Cervical Range of Motion Using the MyotonPRO
Clark, L., Joshi, J., Khalid, A., Jose, R., Furmann, M., Syed, F., Jung, M.K., Yao, S. C., Noto, P.
Journal of Osteopathic Medicine, 2022/12

62

An exploration of the clinical reasoning used by registered osteopaths in their choice of therapeutic approach
Clifford, A., Segal, A., Guterres, A., Orrock, P. J.
International Journal of Osteopathic Medicine, 2022/12

63

Dynamic touch induces autonomic changes in preterm infants as measured by changes in heart rate variability
Manzotti, A., Cerritelli, F., Monzani, E., Savioli, L., Esteves, J. E., Lista, G., Lombardi, E., Rocca, S. L., Biasi, P., Galli, M., Chiera, M., McGlone, F. P.
Brain Research, 2022/11

64

Effectiveness of Mulligan's Two-Leg Rotation Versus Muscle Energy Technique in Subjects With Hamstring Tightness
Jaiswal, P. R., Qureshi, I., Phansopkar, P. A.
Cureus, 2022/09
Free full text

65

Correlation between diminished vagal tone and somatic dysfunction severity in very and extremely low birth weight preterm infants assessed with frequency spectrum heart rate variability and salivary cortisol
Vismara, L., Gianmaria Tarantino, A., Bergna, A., Bianchi, G., Bragalini, C., Billò, E., Farra, F., Buffone, F., Agosti, M.
Medicine (Baltimore), 2022/09
Free full text




69

Exploring lumbo-pelvic functional behaviour patterns during osteopathic motion tests: A biomechanical (en)active inference approach to movement analysis
Ménard, M., Couvertier, M., Awai, L., Esteves, J. E., Bideau, B., Vaucher, P.
International Journal of Osteopathic Medicine, 2022/09

70

Effect of MET training on pain and activities of daily living in COPD patients
Mihçioǧlu, S., Malkoç, M., Özalevli, S., Tüzün, E. H., Yatar, I.
European Respiratory Journal, 2022/09

71

Does the student-led osteopathy clinical learning environment prepare students for practice?
Abrey, C., De Silva, N., Godwin, J., Jacotine, T., Raab, D., Urquhart, K., Mumford, K., McLaughlin, P., Vaughan, B.
BMC Medical Education, 2022/08
Free full text

72

Fourth Ventricle Compression (CV4) as a Method for Stress Management
Chhetri, P., Ghosh, T., Chakrabarti, D., Karmakar, S., Salve, U. R.
Ergonomics for Design and Innovation, 2022/07

73

The Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ) - A content validity study
Thomson, O. P., Vaughan, B., Sampath, K., Draper-Rodi, J., Fleischmann, M., Cerritelli, F.
International Journal of Osteopathic Medicine, 2022/07


75

Does the inter-osseous membrane fascial dysfunction exist ? An observational study comparing palpation to ultrasound measurements
Lecardonnel, T., Salmon, M., Merdy, O., Sarzeaud, R., Matthew, T.
International Journal of Osteopathic Medicine, 2022/06

76

Infants after artificial lung ventilation. New approaches to rehabilitation
Morozov, P. V., Novoseltsev, S. V.
Voprosy Prakticheskoi Pediatrii, 2022/06
Free full text

77

Development of Osteopathic Rhinitis Module in an Allergy/Immunology Fellowship
Huq, M., Daniels, P., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

78

Development of a home-based osteopathic manipulative module
Daniels, P., Rajan, J., Huq, M., Rowane, M., Wu, S. S., Jhaveri, D., Hostoffer, R.
The AAO Journal, 2022/06
Free full text

79

Impact of Osteopathic Manipulative Treatment on Chronic Persistent Gait Dysfunction Following Total Knee Arthroplasty
Hedblom, S. A., Krzak, J. J., Heinking, K. P., Kruger, K. M., Prodoehl, J., Dillon, T. J., Henderson, K. K.
The AAO Journal, 2022/06
Free full text


81

4 M's to make sense of evidence – Avoiding the propagation of mistakes, misinterpretation, misrepresentation and misinformation
Draper-Rodi, J., Vaucher, P., Hohenschurz-Schmidt, D., Morin, C., Thomson, O. P.
International Journal of Osteopathic Medicine, 2022/06

82

A clinician's guide to the management of geriatric musculoskeletal disease: Part 2 – Sarcopenia
Tripodi, N., Wright, B., Lawton, A., Zanker, J., Feehan, J.
International Journal of Osteopathic Medicine, 2022/05

83

Effects of Muscle Energy Technique versus Bruegger's Relief Exercise on the Forward Head Posture among electronic gadget users - A Pilot study
Dalawar, A., Afzal, H., Dalawar, I., Murtaza, A., Ghafoor, A., Fiaz, S.
Pakistan Journal of Medical and Health Sciences, 2022/05
Free full text

84


85

Osteopathic student training on preventing domestic violence
Downing-Larick, C., Moore, M., Dreher, M., Stoner, A., Fadel, N., Cheng, N.
Osteopathic Family Physician, 2022/05
Free full text

86

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text



89

Investigating the safety and feasibility of osteopathic medicine in the pediatric oncology outpatient setting
Belsky, J. A., Stanek, J. R., Rose, M. J.
Journal of Osteopathic Medicine, 2022/04
Free full text


91

Comparative assessment of osteopathy technique with manual therapy associated with biofeedback in patients with the lumbar spine pain.
Mańko, G., Jekiełek, M., Sosulska, A., Pieniążek, M., Jaszczur-Nowicki, J.
Medical Rehabilitation, 2022/04
Free full text




95

Osteopathic manipulative treatment for sinusitis relief: A pilot study
Lee, E. N., Lo, J., Tran, J., Redding, D.
Osteopathic Family Physician, 2022/03
Free full text


97

A clinician's guide to the management of geriatric musculoskeletal disease: Part 1 - Osteoporosis
Feehan, J., Tripodi, N., Fleischmann, M., Zanker, J., Duque, G.
International Journal of Osteopathic Medicine, 2022/03

98

Primary care providers' experiences treating low back pain
Al Sad, S., Start, A. R.
Journal of Osteopathic Medicine, 2022/02
Free full text


100

Neurogenic Bowel Dysfunction Changes after Osteopathic Care in Individuals with Spinal Cord Injuries: A Preliminary Randomized Controlled Trial
Tamburella, F., Princi, A. A., Piermaria, J., Lorusso, M., Scivoletto, G., Masciullo, M., Cardilli, G., Argentieri, P., Tramontano, M.
Healthcare, 2022/01
Free full text

101

Cranial manipulation affects cholinergic pathway gene expression in aged rats
Anandakrishnan, R., Tobey, H., Nguyen, S., Sandoval, O., Klein, B. G., Costa, B. M.
Journal of Osteopathic Medicine, 2022/01
Free full text

102

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

103

Parkinson's Disease Medication Administration During a Care Transition: The Impact of Interprofessional Team Simulation on Student Competency, Comfort, and Knowledge
Ellis, D. M., Hickey, S., Prieto, P., McLaughlin, C., Felgoise, S. H., Becker, M., O'Connor, M., Puleo, M., Reddy, T., Markey, D., Kim, L., Bernhardt, P. W.
Nursing Education Perspectives, 2021/12

104

Osteopathic Models Integration Radar Plot: A Proposed Framework for Osteopathic Diagnostic Clinical Reasoning
Castagna, C., Consorti, G., Turinetto, M., Lunghi, C.
Journal of Chiropractic Humanities, 2021/12






110

The immediate effect of harmonic therapy on peripheral blood flow in young males: A cross-over pilot study
Alsayani, K. Y. A., Aslan, U. B., Büker, N., Şavkın, R., Yağcı, A. B.
International Journal of Osteopathic Medicine, 2021/12


112

Adaptation and validation of the SEGUE checklist to assess osteopathy students' clinical communication skills
Muddle, L., O'Malley, C. J., Stupans, I.
International Journal of Osteopathic Medicine, 2021/12


114

Effects of Compression of the 4th Ventricle (CV4) Treatment on Medical Student Anxiety
Goering, E., Herner, M., Smith, M., Galka, M., Kammerzell, S., Best, K., Anderson, P., Steinauer, M.
The AAO Journal, 2021/12
Free full text

115

Osteopathic structure/function models renovation for a person-centered approach: a narrative review and integrative hypothesis
Baroni, F., Tramontano, M., Barsotti, N., Chiera, M., Lanaro, D., Lunghi, C.
Journal of Complementary and Integrative Medicine, 2021/11

116

Evaluating for a correlation between osteopathic examination and ultrasonography on thoracic spine asymmetry
Chang, S., Maddox, J., Berg, E., Kim, K., Messier, S., Swanson, L., Dobrusin, R., Stein, A. B., Nakken, G. N., Noble, J., Nydam, R.
Journal of Osteopathic Medicine, 2021/10
Free full text



119

Osteopathic Treatment and Evaluation in the Clinical Setting of Childhood Hematological Malignancies
Barbieri, M., Zardo, W., Frittoli, C., Rivolta, C., Valdata, V., Bouquin, F., Passignani, G., Maggiani, A., Jankovic, M., Cossio, A., Biondi, A., Balduzzi, A., Lanfranconi, F.
Cancers, 2021/10
Free full text


121

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09





126

Magnetic resonance imaging in the assessment of brain connectome in patients with chronic tension-type headache
Lepekhina, A., Pospelova, M., Bukkieva, T., Efimtsev, A., Trufanov, G., Alekseeva, T., Piskovatskov, D., Levchuk, A., Kasumova, A.
European Journal of Neurology, 2021/07




130

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text

131

Efficacy of Stretching vs Muscle Energy Technique in Postoperative Elbow Stiffness: A Research Protocol
Shende, G., Deshmukh, M. P., Jain, D. K., Phansopkar, P.
Indian Journal of Forensic Medicine and Toxicology, 2021/06

132

The development and application of a remediation process in an osteopathic curriculum
Aubin, A., Boulanger, C., Gagnon, K., Morin, C.
International Journal of Osteopathic Medicine, 2021/06


134

Osteopathic Manipulative Treatment Affects Renal Mobility and Blood Pressure: A Preliminary Study
Giovanis, A., Roantree, R. A., Burke, D., Sheth, K., Adamo, A.
The AAO Journal, 2021/06
Free full text

135

Effect of osteopathic manipulative therapy on pulmonary function testing in children with asthma
Jones, L. M., Regan, C., Wolf, K., Bryant, J., Rakowsky, A., Pe, M., Snyder, D. A.
Journal of Osteopathic Medicine, 2021/05
Free full text

136

Obstructed defecation syndrome associated with paradoxical puborectalis contraction: osteopathic treatment versus anal biofeedback. Results of a pilot study
Ascanelli, S., Portinari, M., Canella, M., Solari, S., Dall&rsquo, Omo, F., Danese, S., De Troia, A., Carcoforo, P.
Techniques in Coloproctology, 2021/05


138

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

139

Actions Speak Louder Than Words: Exploring Pragmatism in Osteopathy
Macfarlane, C.
Unpublished PhD thesis, 2021/03
Free full text

140

Moderate to Substantial Inter-Rater Reliability in the Assessment of Cranial Bone Mobility Restrictions
Demers, K., Morin, C., Collette, L., DeMont, R.
The Journal of Alternative and Complementary Medicine, 2021/03

141

Objectivation of an Educational Model in Cranial Osteopathy Based on Experience
Requena-García, J., García-Nieto, E., Varillas-Delgado, D.
Medicina (Kaunas), 2021/03

142

Use of Lean Management to Increase Efficiency and Osteopathic Manipulative Treatment in a Family Medicine Residency
Eilerman, A., Jay, R., Smith, C., Fisher, C., Porter, J., Patel, T., Reynolds, J.
Osteopathic Family Physician, 2021/03
Free full text

143

Evaluating disease outbreaks with syndromic surveillance using medical student clinical rotation patient encounter logs
Bruzda, G., Rawlins, F., Sumpter, C., Garner, H. R.
Journal of Osteopathic Medicine, 2021/02
Free full text


145

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02

146

The role of touch in osteopathic practice: A narrative review and integrative hypothesis
Baroni, F., Ruffini, N., D'Alessandro, G., Consorti, G., Lunghi, C.
Complementary Therapies in Clinical Practice, 2021/02

147

Gut Microbiome Changes with Osteopathic Treatment of Constipation in Parkinson's Disease: A Pilot Study
Mancini, J. D., Yao, S., Martinez, L. R., Shakil, H., Li, T. S.
Neurology (ECronicon), 2021/01
Free full text

148

Pilot study assessing the effect of osteopathic manipulative treatment (OMT) on length of stay in neonates after therapeutic hypothermia
Bendixen, K., Beinlich, A., Beck, B., Hashmi, N., Craig, A.
Journal of Osteopathic Medicine, 2021/01

149

Use of osteopathic manipulative treatment for low back pain patients with and without pain medication history
Montrose, S., Vogel, M., Barber, K. R.
Journal of Osteopathic Medicine, 2021/01
Free full text

150

Effects of Craniosacral Osteopathy in Patients with Peripheral Vestibular Pathology
Atay, F., Bayramlar, K., Sarac, E. T.
ORL - Journal for Oto-Rhino-Laryngology and its Related Specialties, 2021/01

151

Osteopathic Principles: The Inspiration of Every Science Is Its Change
Bordoni, B., Escher, A. R.
Cureus, 2021/01
Free full text

152

An Evaluation of Reporting Guidelines and Clinical Trial Registry Requirements Among Addiction Medicine Journals
Cooper, C. M., Gray, H., Barcenas, L., Torgerson, T., Checketts, J. X., Vassar, M.
The Journal of the American Osteopathic Association, 2020/12
Free full text

153

Sister Mary Joseph Nodule
Desai, P., Yamani, N.
The Journal of the American Osteopathic Association, 2020/12
Free full text


155

Efficacy of Muscle Energy Technique and Myofascial Release in Nonspecific Low Back Pain—A Comparative Study
Das, A., Bhattacharya, U., Chauhan, V.
Alternative and Complementary Therapies, 2020/12

156

Septic Pulmonary Emboli With Feeding Vessel Sign
Kemnic, T., Prasad, R.
The Journal of the American Osteopathic Association, 2020/12
Free full text


158

Duty of care in clinical education - Part 1
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

159

Duty of care in clinical education in Australian part II
Moore, K.
International Journal of Osteopathic Medicine, 2020/12

160

Acute Suppurative Thyroiditis
Desai, P., Mbachi, C., Singh, A.
The Journal of the American Osteopathic Association, 2020/11
Free full text

161

Ultrasonography to Assess the Efficacy of Osteopathic Manipulative Treatment for Lumbar Spine Asymmetry
Winter, J., Kimber, A., Montenegro, S., Gao, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text



164

Recurrent Condylomata Acuminata in a Transplant Patient
Delara, R., Chen, L., Young-Fadok, T., Wasson, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text

165

Cerebral tissue oxygenation during cranial osteopathic CV4 procedure in newborns
Malak, R., Kozłowska, Z., Owsiańska, Z., Sikorska, D., Andrusiewicz, M., Szymankiewicz-Bręborowicz, M., Samborski, W., Szczapa, T.
Advances in Clinical and Experimental Medicine, 2020/10
Free full text


167

A Pilot Study of Jugular Compression (Queckenstedt maneuver) for Cranial Movement Perception
Abenavoli, A., Pisa, S., Maggiani, A.
The Journal of the American Osteopathic Association, 2020/10

168

Dysphagia Lusoria
Andersen, K., Hoff, R., Silas, D.
The Journal of the American Osteopathic Association, 2020/10
Free full text

169

Retained Colon in the Subcutaneous Fat After Colostomy Reversal
Arndts, M. K.
The Journal of the American Osteopathic Association, 2020/10
Free full text

170

Gonococcal Arthritis
Mills, K., Jadav, P.
The Journal of the American Osteopathic Association, 2020/10
Free full text

171

“I do it my way” - Italian osteopaths’ beliefs and attitudes about five osteopathic models: A qualitative study
Bettelli, L., Pisa, V., Formica, A.
International Journal of Osteopathic Medicine, 2020/10


173

Evaluation of “Spin“ in the Abstracts of Randomized Controlled Trial Reports in Cardiology
Roberts, W. B., Cooper, C. M., Khattab, M., Neff, P., Wildes, D., Wayant, C., Vassar, M.
The Journal of the American Osteopathic Association, 2020/09
Free full text

174

Cranial Strain Patterns Associated With Concussions
Schwartzberg, L., Aslanyan, L., Angelo, N., Mancini, J., Kooyman, P. S., Abu-Sbaih, R., Zwibel, H., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/09
Free full text

175

Portable Ultrasonography to Assess Adult Hepatosteatosis in Rural Ecuador
Joutovsky, B., Ortiz, A., Bentley, C., Gao, J.
The Journal of the American Osteopathic Association, 2020/09
Free full text

176

Aquatic Osteopathy Treatment Assessment by Infrared Thermography on Healthy Subjects After Thermoneutral Water Immersion
Maxel, X., Girollet, F., Stubbe, L., Boudot, E., Darraillans, L., Bodnar, J. L.
Journal of Chiropractic Medicine, 2020/09
Free full text


178

Mindfulness-Based Stress Reduction in the Management of Chronic Pain and Its Comorbid Depression
Marske, C., Shah, S., Chavira, A., Hedberg, C., Fullmer, R., Clark, C. J., Pipitone, O., Kaiser, P.
The Journal of the American Osteopathic Association, 2020/09
Free full text


180

The development and exploratory analysis of the Osteopaths’ Therapeutic Approaches Questionnaire (Osteo-TAQ)
Thomson, O. P., Anstiss, V.
International Journal of Osteopathic Medicine, 2020/09

181

Undifferentiated Pleomorphic Sarcoma
Ferry, M. J., Lewis, T.
The Journal of the American Osteopathic Association, 2020/08

182

Ultrasound Shear Wave Elastography to Assess Tissue Mechanical Properties in Somatic Dysfunction: A Feasibility Study
Gao, J., Caldwell, J., Wells, M., Park, D.
The Journal of the American Osteopathic Association, 2020/08
Free full text

183

Effect of Hydration on Doppler Velocity of Renal Arteries
Lee, J., Gao, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text

184

Trichoepithelioma
Skorin, L., Bauer, S. A.
The Journal of the American Osteopathic Association, 2020/08
Free full text

185

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

186

Effects of Osteopathic Manipulative Treatment on Sleep Quality in Student Athletes After Concussion: A Pilot Study
Mazzeo, S., Silverberg, C., Oommen, T., Moya, D., Angelo, N., Zwibel, H., Mancini, J., Leder, A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/08
Free full text

187

Primary familial brain calcification
Parasram, M., Levi Chazen, J., Sarva, H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

188

Effect of Opioid Prescribing Education for Obstetrics and Gynecology Residents in a Safety-Net Hospital
Evans, C., McCullough, D., Best, K., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/07
Free full text

189

Eosinopenia and COVID-19
Tanni, F., Akker, E., Zaman, M. M., Figueroa, N., Tharian, B., Hupart, K. H.
The Journal of the American Osteopathic Association, 2020/07
Free full text

190

Evaluating Financial Conflicts of Interest Among Contributors to Clinical Practice Guidelines of the American College of Obstetricians and Gynecologists
Wright, M. R., Frye, L., Vo Solis, L., Checketts, J. X., Guevara, C., Smith, L., Vassar, M.
The Journal of the American Osteopathic Association, 2020/07
Free full text

191

Osteopathic treatment of patients with shoulder pain. A pragmatic randomized controlled trial
Schwerla, F., Hinse, T., Klosterkamp, M., Schmitt, T., Rütz, M., Resch, K.L.
Journal of Bodywork and Movement Therapies, 2020/07

192

Preoperative Osteopathic Manipulative Therapy Improves Postoperative Pain and Reduces Opioid Consumption After Total Knee Arthroplasty: A Prospective Comparative Study
Barral, P., Klouche, S., Barral, N., Lemoulec, Y. P., Thés, A., Bauer, T.
The Journal of the American Osteopathic Association, 2020/07
Free full text

193

Straight Back Syndrome
Perez-Downes, J. C., Leon, A., Reddy, P.
The Journal of the American Osteopathic Association, 2020/07
Free full text

194

A guide to writing a case report of an osteopathic patient
Vaughan, B., Fleischmann, M.
International Journal of Osteopathic Medicine, 2020/06

195

Self-management behaviour and knowledge of patients with musculoskeletal complaints attending an Australian osteopathy clinic: A consecutive sampling design
Vaughan, B., Grant, M., Moroz, J., Ngawaka, C., Mulcahy, J.
International Journal of Osteopathic Medicine, 2020/06

196

Lumbar Diagnosis and Pressure Difference Variance
Voleti, N., Gaspari, M. A., George, E., Angelo, N., Yao, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text


198

The Spanish Osteopathic Practitioners Estimates and RAtes (OPERA) study: A cross-sectional survey
Alvarez, G., Roura, S., Cerritelli, F., Esteves, J. E., Verbeeck, J., van Dun, P. L. S.
PLoS ONE, 2020/06
Free full text

199

Use of manual therapy applied to the viscera: Secondary analysis of a nationally representative sample of Australian osteopaths
Fleischmann, M., Vaughan, B., Fitzgerald, K., Grace, S.
International Journal of Osteopathic Medicine, 2020/06

200

Inter-examiner agreement of musculoskeletal and visceral tests to assess the pelvic region in women with stress urinary incontinence
Arcanjo, G. N., Mendes, M. R., Cavalcante, A., Lima, . O., Vilaça-Alves, J., Rocha, M.
Motricidade, 2020/06
Free full text

201

Нейрофизиологические аспекты энуреза у детей
(Neurophysiological aspects of enuresis in children)
Safiullina, G. I., Yakupov, R. A., Safiullina, A. A.
Russian Osteopathic Journal, 2020/06
Free full text


203

Daily Integrated Care Conferences to Reduce Length of Hospital Stay for Patients With Chronic Obstructive Pulmonary Disease
Shilian, R., Abraham, T., Wynbrandt, J., Jhaveri, D., Hostoffer, R. W., Peppers, B. P.
The Journal of the American Osteopathic Association, 2020/05
Free full text

204

Osteopathic Manipulative Medicine Practice Patterns of Third-Year and Fourth-Year Osteopathic Medical Students: An Educational Research Project
Snider, K. T., Couch, R., Bhatia, S.
The Journal of the American Osteopathic Association, 2020/05
Free full text

205

Osteopathy in the French-speaking part of Switzerland: Practitioners’ profile and scope of back pain management
Bill, A.S., Dubois, J., Pasquier, J., Burnand, B., Rodondi, P.Y.
PLoS ONE, 2020/05
Free full text

206

Academic Advising Using Theoretical Approaches for Medical Students Who Are Struggling in Preclinical Years
Tewary, S., Jordan, J. A., Rana, A. M., Mayi, B.
The Journal of the American Osteopathic Association, 2020/04
Free full text

207

“Soccer-Ball“ Lymphocytosis
Utz, J. L., Bell, H., Wright, W. F., George, T. I.
The Journal of the American Osteopathic Association, 2020/04
Free full text

208

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text

209

Effect of Osteopathic Manipulative Therapy on Generalized Anxiety Disorder
Dixon, L., Fotinos, K., Sherifi, E., Lokuge, S., Fine, A., Furtado, M., Anand, L., Liberatore, K., Katzman, M. A.
The Journal of the American Osteopathic Association, 2020/03
Free full text

210

Success Predictors For Third-Year Osteopathic Medical Students on National Standardized Examinations: A Family Medicine Clerkship Course Study
Glaser, K., Sackett, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2020/03
Free full text


212

Barriers and facilitators experienced by osteopaths in implementing a biopsychosocial (BPS) framework of care when managing people with musculoskeletal pain – A mixed methods systematic review protocol
Kovanur Sampath, K., Darlow, B., Tumilty, S., Shillito, W., Hanses, M., Devan, H., Thomson, O. P.
International Journal of Osteopathic Medicine, 2020/03
Free full text


214

Pre-professional reflective practice: Strategies, perspectives and experiences
McLeod, G. A., Vaughan, B., Carey, I., Shannon, T., Winn, E.
International Journal of Osteopathic Medicine, 2020/03


216


217

‘Tell me your story’ - How osteopaths apply the BPS model when managing low back pain - A qualitative study
Abrosimoff, M., Rajendran, D.
International Journal of Osteopathic Medicine, 2020/03


219

Rectal Tubulovillous Adenoma
Hoff, R. T., Lakha, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text

220

Ultrasound Shear Wave Elastography to Assess Osteopathic Manipulative Treatment on the Iliocostalis Lumborum Muscle: A Feasibility Study
Gao, J., Caldwell, J., McLin, K., Zhang, M.n, Park, D.
Journal of Ultrasound in Medicine, 2020/01


222

Neural and visceral manipulation in infants with congenital muscular torticollis: a feasibility study
Zollars, J. A., Burtner, P. A., Stockman, G., Werbelow, P., Swartzentruber, J., Lowe, J. R.
Journal of Physical Therapy Science, 2020/01
Free full text

223

Determinants of health, health behaviours and demographic profile of patients attending an Australian university student-led osteopathy clinic
Vaughan, B., Fitzgerald, K., Fleischmann, M., Mulcahy, J.
Chiropractic & Manual Therapies, 2020/01
Free full text


225

Fitz-Hugh-Curtis Syndrome
Mersch, M., Martingano, D.
The Journal of the American Osteopathic Association, 2020/01
Free full text

226

Effects of cranial osteopathic techniques in the symptoms of benign positional paroxistic vertical
do Nascimento Oliveira, O. A., de Andrade Mesquita, L. S., Mendes, M. R., Costa de Oliveira, L. M. M., Almeida, L. C.
Manual therapy, posturology & rehabilitation journal, 2020

227

Impact of osteopathic manipulative treatment on range of motion of the pelvis during the one-sided tilt test: a pilot study
Menard, M., Ferrari, M., Bouchet, A., Puchaud, P., Vaucher, P., Sutre, F., Bideau, B., Bourgin, M.
HAL CCSD Taylor & Francis, 2019/12
Free full text


229

Implementing a clinical-educator curriculum to enrich internal medicine residents' teaching capacity
Habboush, Y., Stoner, A., Torres, C., Beidas, S.
BMC Medical Education, 2019/12
Free full text

230

Complaint risk among mental health practitioners compared with physical health practitioners: A retrospective cohort study of complaints to health regulators in Australia
Veness, B. G., Tibble, H., Grenyer, B. F., Morris, J. M., Spittal, M. J., Nash, L., Studdert, D. M., Bismark, M. M.
BMJ Open, 2019/12
Free full text



233

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
Journal of Osteopathic Medicine, 2019/12

234

Osteopathic Manipulative Medicine Vs Counseling in the Treatment of Sports-Related Concussion: Comparative Balance Assessment
Morris, J. Z., Shah, J., Zwibel, H., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2019/12

235

The Efficacy of Osteopathic Manipulative Treatment on Decreasing the Severity of Migraine Headaches
Rhoads, A., Metzgar, M. M., Donovan, P.
Journal of Osteopathic Medicine, 2019/12

236

The Efficacy of Treating Thoracic Cage Counterstrain Tender Points With Varied Mobile Point Time Durations in a Classroom Setting
Smith, J. M., Docherty, J., Kooyman, P., Yao, S. C.
Journal of Osteopathic Medicine, 2019/12


238

Myofascial Release for Vulvar Pain and Pubic Shear After a Straddle Injury in a 3-Year-Old Girl
Dade, M. M., Broecker, J. D.
The Journal of the American Osteopathic Association, 2019/11
Free full text

239

Effectiveness of the muscle energy technique on respiratory muscle strength and endurance in patients with fibromyalgia
Uysal, S. C., Tuzun, E. H., Eker, L., Angin, E.
Journal of Back and Musculoskeletal Rehabilitation, 2019/11
Free full text

240

What is OMT’s Effect on the Autonomic Nervous System?
Waldherr, A.
Poster presentation, 2019/11

241

The Effect of Osteopathic Manual Treatment on Concussion Injury Rehabilitation
Henderson, L. D.
Unpublished MSc thesis, 2019/11
Free full text

242

A comprehensive physical therapy evaluation for Male Chronic Pelvic Pain Syndrome: A case series exploring common findings
Archambault-Ezenwa, L., Markowski, A., Barral, J-P.
Journal of Bodywork and Movement Therapies, 2019/10






248

Osteopathic Manipulative Treatment for Allostatic Load Lowering
Nuno, V., Siu, A., Deol, N., Juster, R. P.
The Journal of the American Osteopathic Association, 2019/10
Free full text

249

Engaging with evidence-based practice in the osteopathy clinical learning environment: A mixed methods pilot study
Vaughan, B., Grace, S., Gray, B., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2019/09

250

Effects of muscle energy technique for quadratus lumborum on respiratory muscle strength in patients with breast cancer
Espinosa, L., Andrea, M., Daza, A., Jorge, E., Pinzón, S., Lina, M., Perdomo-Quiroga, Y., Ruiz, J., Jhoana, P.
Revista de la Facultad de Medicina, 2019/09

251

Osteopathic Manipulation Treatment Improves Cerebro-splanchnic Oximetry in Late Preterm Infants
Marinelli, B., Pluchinotta, F., Cozzolino, V., Barlafante, G., Strozzi, M. C., Marinelli, E., Franchini, S., Gazzolo, D.
Molecules, 2019/09
Free full text

252

Pain perception and thermographic analysis in patients with chronic lower back pain submitted to osteopathic treatment
Neves, E. B., Leal, S., Melo, D., Filgueiras, M., Dantas, E.
Motricidade, 2019/09
Free full text


254

Shared decision making by United Kingdom osteopathic students: an observational study using the OPTION-12 instrument
Rajendran, D., Beazley, J., Bright, P.
Chiropractic & Manual Therapies, 2019/09
Free full text

255

Assessment of shoulder pain and somatic dysfunction in young competitive swimmers: Preventive Osteopathic Manipulative Treatment
Granger, F., Etevenard, M., Kily, J. P., Garet, M.
Journal of Sports Medicine and Therapy, 2019/08
Free full text

256

OMT for the Prevention and Management of Chronic Constipation and Distal Intestinal Obstructive Syndrome in Cystic Fibrosis: A Pilot Study
Modlin, S. E., Borofka, K., Franzini, D., Klene-Bowns, A. C., Nuño, V. A.
The Journal of the American Osteopathic Association, 2019/07
Free full text

257

Effect of muscle energy technique on pain pressure threshold in sacroiliac joint dysfunction
Srivastava, S., U., Dhanesh K. K., Mittal, H.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text

258

Mets and oscillating energy manual therapy in chronic lateral epicondylosis: A comparative study
Unnisa, R., Sivajyothi, N., G., Yatheendra K., Ur Rahman, M. A. W., Ahmed, I.
International Journal of Research in Pharmaceutical Sciences, 2019/07
Free full text

259

Simulation can offer a sustainable contribution to clinical education in osteopathy
Fitzgerald, K. M., Denning, T., Vaughan, B., Fleischmann, M. J., Jolly, B. C.
Chiropractic & Manual Therapies, 2019/07
Free full text

260

Reflective practice enhances osteopathic clinical reasoning
McIntyre, C., Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2019/07



263

Pilot randomized single-blind clinical trial, craniosacral therapy vs control on physiological reaction to math task in male athletes
Wójcik, M., Dziembowska, I., Izdebski, P., Żekanowska, E.
International Journal of Osteopathic Medicine, 2019/06

264

Correlation between otitis media with effusion and cranial deformation in children
Orlando, M. P., Bonanno, M. A., Russo, F. Y., Ralli, M., Turchetta, R., Passali, F. M., Minni, A., Greco, A., De Vincentiis, M., Tattoli, M.
European Review for Medical and Pharmacological Sciences, 2019/06
Free full text

265

To Compare the Effect of Muscle Energy Technique and Ultrasound on Jaw Range of Motion in Subjects with Temporomandibular Joint Dysfunction
Jaspinder, K., Shilpy, J.
International Journal of Trend in Scientific Research and Development, 2019/06
Free full text

266

The value of the osteopathic integrated approach in children
Filisetti, M., Cattarelli, D., Bonomi, S.
Italian Journal of Pediatrics, 2019/06

267

Integrated pilot medical study on 40 patients affected by open angle glaucoma undergoing topical therapy with additional osteopathic manipulation
Paoli, D., Brusini, P., Michelin, L., Vassallo, F., Ciullo, L., Torelli, L.
Acta Ophthalmologica, 2019/06

268

The inter-rater reliability of the mobility tests of the cranial bones as assessed through manual therapy
Demers, K., Morin, C., Collette, L., DeMont, M. R.
Advances in Integrative Medicine, 2019/06

269

Active Visceral Manipulation Associated With Conventional Physiotherapy in People With Chronic Low Back Pain and Visceral Dysfunction: A Preliminary, Randomized, Controlled, Double-Blind Clinical Trial
Villalta Santos, L., Lisboa Cordoba, L., Benite Palma Lopes, J., Santos Oliveira, C., Andre Collange Grecco, L., Bovi Nunes Andrade, A. C., Pasin Neto, H.
Journal of Chiropractic Medicine, 2019/06
Free full text

270

Identifying a need and knowledge gap of osteopathic medicine in pediatric oncology providers
Belsky, J., Stanek, J., Gerhardt, C., Rose, M.
Pediatric Blood and Cancer, 2019/06


272

Effect of Palpatory Neuromodulation of the Trigeminal Nerve for Tenderness in the Posterior Neck Musculature
Hansen, M., Vaghasia, M., Fulda, K., Hensel, K.
Poster presentation, 2019/06

273

The role of osteopathic complementary treatment in high frequency paediatric headache: a randomised controlled study
Rossi, R., Versace, A., Lauria, B., Grasso, G., Bagagiolo, D., Cappitella, E., Altieri, R., Delli Santi, M., Scarinzi, C., Urbino, A. F.
Neurological Sciences, 2019/06

274

Effect of osteopathic treatment on a scar assessed by thermal infrared camera, pilot study
Riquet, D., Houel, N., Bodnar, J. L.
Complementary Therapies in Medicine, 2019/06


276

“Princess and the pea“ - an assessment tool for palpation skills in postgraduate education
Kamp, R., Moltner, A., Harendza, S.
BMC Medical Education, 2019/05
Free full text


278

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text

279

Cerebral Perfusion Changes After Osteopathic Manipulative Treatment: A Randomized Manual Placebo-Controlled Trial
Tamburella, F., Piras, F., Piras, F., Spano, B., Tramontano, M., Gili, T.
Frontiers in Physiology, 2019/04
Free full text

280

Effects of osteopathic manipulative treatment on patients with multiple sclerosis: A pilot study
Porcari, B., Russo, M., Naro, A., La Via, C., Pullia, M., Accorinti, M., De Luca, R., Calabro, R. S.
Complementary Therapies in Medicine, 2019/04

281

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text


283

Osteopathic Structural Findings in Women During Menstruation
Cabrera, K. L., Darwish, A. M., Lurz, K. L., L., McClain. R., McClain, E., Cox, J., Segars, L.
The AAO Journal, 2019/03
Free full text

284

Point-of-Care Ultrasonography Integration in Undergraduate Medical Education: A Student-Driven Approach
Goodcoff, A., Keane, D., Bialczak, A., Ziner, E., Hanna, J. B.
The Journal of the American Osteopathic Association, 2019/03
Free full text

285

Magnetic Resonance Imaging Parameters Selected for Optimal Visualization of the Occipitoatlantal Interspace
Hallgren, R. C., Rowan, J. J.
The Journal of the American Osteopathic Association, 2019/03
Free full text

286

Complementing or conflicting? A qualitative study of osteopaths’ perceptions of NICE low back pain and sciatica guidelines in the UK
Inman, J., Thomson, O. P.
International Journal of Osteopathic Medicine, 2019/03
Free full text

287

Assessment of Pulmonary Function After Osteopathic Manipulative Treatment vs Standard Pulmonary Rehabilitation in a Healthy Population
Lorenzo, S., Nicotra, C. M., Mentreddy, A. R., Padia, H. J., Stewart, D. O., Hussein, M. O., Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/03
Free full text


289

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

290

Effectiveness of manual therapy in COPD: A systematic review of randomised controlled trials
Simonelli, C., Vitacca, M., Vignoni, M., Ambrosino, N., Paneroni, M.
Pulmonology, 2019/02


292

Fascial manipulation vs. standard physical therapy practice for low back pain diagnoses: A pragmatic study
Harper, B., Steinbeck, L., Aron, A.
Journal of Bodywork and Movement Therapies, 2019/01

293

Effectiveness of Combined General Rehabilitation Gymnastics and Muscle Energy Techniques in Older Women with Chronic Low Back Pain
Wendt, M., Cieslik, K., Lewandowski, J., Waszak, M.
BioMed Research International, 2019/01
Free full text


295

Diagnosis and Treatment of Slipping Rib Syndrome
Foley, C. M., Sugimoto, D., Mooney, D. P., Meehan, W. P., Stracciolini, A.
Clinical Journal of Sport Medicine, 2019/01

296

Tolerance of Rib Raising Among Hospitalized Patients: A Pilot Study
Chin, A. J., Fischione, A. D., Shilian, R., Walter, L. M., Ratay, S. M., Bejanishvili, T. Y., Wynbrandt, J. H., Rowane, M. P.
The Journal of the American Osteopathic Association, 2019/01
Free full text

297

Osteopathic Manipulative Treatment Alters Gastric Myoelectric Activity in Healthy Subjects
Shadiack, E., Jouett, N., van den Raadt, A., Liganor, R., Watters, J., Hensel, K., Smith, M.
The Journal of Alternative and Complementary Medicine, 2018/12

298

Osteopathic Manipulative Treatment Effect on Pain Relief and Quality of Life in Oncology Geriatric Patients: A Nonrandomized Controlled Clinical Trial
Arienti, C., Bosisio, T., Ratti, S., Miglioli, R., Negrini, S.
Integrative Cancer Therapies, 2018/12
Free full text

299

Adjuvant Lymphatic Osteopathic Manipulative Treatment in Patients With Lower-Extremity Ulcers: Effects on Wound Healing and Edema
Kilgore, T., Malia, M., Di Giacinto, B., Minter, S., Samies, J.
The Journal of the American Osteopathic Association, 2018/12
Free full text

300

Attitudes, skills and use of evidence-based practice among UK osteopaths: a national cross-sectional survey
Sundberg, T., Leach, M. J., Thomson, O. P., Austin, P., Fryer, G., Adams, J.
BMC Musculoskeletal Disorders, 2018/12
Free full text

301

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

302

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text


304

Occipital Neuralgia: a noninvasive therapeutic approach
López-Soto, P. J., Bretones-García, J. M., Arroyo-García, V., García-Ruiz, M., Sánchez-Ossorio, E., Rodríguez-Borrego, M.
Revista Latino-Americana de Enfermagem, 2018/11
Free full text

305

Osteopathic Manipulation Increases Cognitive Ability in Patients With Chronic Pain: A Rationale for a New Approach
Alsaqri, R. R., Rizkalla, M. N., Huntington-Alfano, K., Heinking, K., Impens, A. J., Henderson, K.
Journal of Osteopathic Medicine, 2018/11



308

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11

309

Managing Tremor in Parkinson Disease Using Osteopathic Manipulative Medicine
Li, R., Docherty, J., Koo, S. L., Shinners, J., Leder, A., Cheriyan, G., DiFrancisco-Donoghue, J., Mancini, J., Yao, S. C.
Journal of Osteopathic Medicine, 2018/11

310

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
Journal of Osteopathic Medicine, 2018/11

311

Interrater Reliability of Osteopathic Sacral Palpatory Diagnostic Tests Among Osteopathy Students
Consorti, G., Basile, F., Pugliese, L., Petracca, M.
The Journal of the American Osteopathic Association, 2018/10
Free full text

312

Results of Osteopathic Treatment of Patients with paroxysmal atrial Fibrillation
Tabina, A, Leleka, E, Mazalskiy, K
Journal of Bodywork and Movement Therapies, 2018/10

313

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text

314

Changes on cervical range of motion in migraine patients after a strain counterstrain treatment
Giustino, V., Contrò, V., Brusa, J., Proia, P., Messina, G., Brighina, F.
The Journal of Headache and Pain, 2018/10

315


316

Changes in pain knowledge, attitudes and beliefs of osteopathy students after completing a clinically focused pain education module
Fitzgerald, K., Fleischmann, M., Vaughan, B., de Waal, K., Slater, S., Harbis, J.
Chiropractic & Manual Therapies, 2018/10
Free full text

317

Osteopathie und Essenzielle Hypertonie
(Osteopathy and Essential Hypertension)
Bär, J.
Unpublished MSc thesis, 2018/10
Free full text

318

Effect of gong’s mobilisation versus muscle energy technique on pain and functional ability of shoulder in phase II adhesive capsulitis
Gopinath, Y., Seenivasan, S. K., Veeraraghavan, S. N. C., Viswanathan, R., Govindaraj, M. K.
Journal of Clinical and Diagnostic Research, 2018/09

319

Is digital image correlation able to detect any mechanical effect of cranial osteopathic manipulation? – A preliminary study
Pellet, M., Chenel, A., Behr, M., Thollon, L.
International Journal of Osteopathic Medicine, 2018/09

320

Osteopathic Manipulative Therapy and Multiple Sclerosis: A Proof-of-Concept Study
Cordano, C., Armezzani, A., Veroni, J., Pardini, M., Sassos, D., Infante, M. T., Tacchino, A., Lapucci, C., Cellerino, M., Calabro, V., Ciullo, L., Nourbakhsh, B.
The Journal of the American Osteopathic Association, 2018/08
Free full text

321

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text

322

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

323

Cardiac autonomic response after cranial technique of the fourth ventricle (cv4) compression in systemic hypertensive subjects
Curi, A. C. C., Maior Alves, A. S., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2018/07

324

Role of osteopathic manipulative treatment in cystic fibrosis: A pilot study
Fainardi, V., Benecchi, S., Longo, F., Tripodi, M. C., Villani, M. L., Teopompi, E., Chetta, A. A., Pisi, G.
Journal of Cystic Fibrosis, 2018/07

325

UK trained osteopaths' relationship to evidence based practice - An analysis of influencing factors
Weber, V., Rajendran, D.
International Journal of Osteopathic Medicine, 2018/07

326

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text

327

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

328

Clinical reasoning in osteopathy: Experiences of novice and experienced practitioners
King, L., Kremser, S., Deam, P., Henry, J., Reid, D., Orrock, P., Grace, S.
International Journal of Osteopathic Medicine, 2018/06

329

Osteopathic clinical reasoning: An ethnographic study of perceptual diagnostic judgments, and metacognition
McIntyre, C, Lathlean, J., Esteves, J. E.
International Journal of Osteopathic Medicine, 2018/06

330

Attitudes and self-reported practices of New Zealand osteopaths to exercise consultation
Mistry, R. A., Bacon, C. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2018/06


332

Profile of osteopathic practice in Spain: Results from a standardized data collection study
Alvarez Bustins, G., López Plaza, P. V., Carvajal, S. R.
BMC Complementary and Alternative Medicine, 2018/04
Free full text

333

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text




337

Influence of Transverse Process Landmark Localization on Palpation Accuracy of Lumbar Spine Models
Snider, E. J., Pamperin, K., Pazdernik, V., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

338

Clinical versus radiological findings: A paradox in diagnosing minor hamstring injuries
Arumugam, A.
International Journal of Osteopathic Medicine, 2018/03

339

A Mokken scale analysis of the peer physical examination questionnaire
Vaughan, B., Grace, S.
Chiropractic & Manual Therapies, 2018/03
Free full text


341

Clinical reasoning for complex cervical spine conditions
Reid, D., Rebbeck, T., McCarthy, C.
International Journal of Osteopathic Medicine, 2018/03


343

Reliability of diagnosis and clinical efficacy of visceral osteopathy: a systematic review
Guillaud, A., Darbois, N., Monvoisin, R., Pinsault, N.
BMC Complementary and Alternative Medicine, 2018/02
Free full text

344

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

345

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

346

Effect of Ultrasonography on Student Learning of Shoulder Anatomy and Landmarks
de Vries, K. D., Brown, R., Mazzie, J., Jung, M. K., Yao, S. C., Terzella, M. J.
The Journal of the American Osteopathic Association, 2018/01
Free full text

347

Moving Toward Milestone-Based Assessment in Osteopathic Manipulative Medicine
Seals, R. A.
The Journal of the American Osteopathic Association, 2018/01
Free full text

348

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

349

Postural and autonomic modifications following osteopathic manipulative treatment (OMT): Comparison between two techniques. A pilot study
Scoppa, F., Pirino, A., Belloni, G., Gallamini, M., Messina, G., Iovane, A.
Acta Medica Mediterranea, 2018/01
Free full text

350

The Validity and Reliability of Provocation Tests in the Diagnosis of Sacroiliac Joint Dysfunction
Telli, H., Telli, S., Topal, M.
Pain Physician, 2018/01
Free full text

351

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

352

Palpatory and Ultrasound Assessment of Cervical Dysfunctions and the Effect of Cervical High-Velocity, Low-Amplitude (HVLA) Technique
Flaum, T. B., Mirza, A., Rusnack, F. M-A., Apoznanski, T. E., Munarova, A., Mazzie, J., Terzella, M. J., Yao, S. C.
The AAO Journal, 2017/12
Free full text

353

Compression of the Fourth Ventricle Using a Craniosacral Osteopathic Technique: A Systematic Review of the Clinical Evidence
Zurowska, A., Malak, R., Kolcz-Trzesicka, A., Samborski, W., Paprocka-Borowicz, M.
Evidence-based Complementary and Alternative Medicine, 2017/12
Free full text

354

MRI Assessment of Changes in Swelling of Wrist Structures Following OMT in Patients With Carpal Tunnel Syndrome
Ramey, K. A., Kappler, R. E., Chimata, M., Hohner, J., Mizera, A. C.
The AAO Journal, 2017/12
Free full text

355

Simulated learning activities as part replacement of clinical placements in osteopathy: A case study
Fitzgerald, K., Denning, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2017/12

356

Influence of perceived difficulty of cases on student osteopaths' diagnostic reasoning: a cross sectional study
Noyer, A. L., Esteves, J. E., Thomson, O. P.
Chiropractic & Manual Therapies, 2017/12
Free full text



359

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text

360

Effect of Pedal Pump Lymphatic Technique on Exercise Recovery After Maximal Exercise
Docherty, J., Schatz, A., Grohman, R., de Vries, K., Chan, T., Yao, S. C., DiFrancisco-Donoghue, J.
Journal of Osteopathic Medicine, 2017/11

361

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
Journal of Osteopathic Medicine, 2017/11

362

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text

363

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

364

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

365

A comparison of the effect of the active release and muscle energy techniques on the latent trigger points of the upper trapezius
Sadria, G., Hosseini, M., Rezasoltani, A., Akbarzadeh Bagheban, A., Davari, A., Seifolahi, A.
Journal of Bodywork and Movement Therapies, 2017/10

366

Osteopathic management of chronic constipation in women patients. Results of a pilot study
Belvaux, A., Bouchoucha, M., Benamouzig, R.
Clinics and Research in Hepatology and Gastroenterology, 2017/10


368

Near-peer teaching in osteopathy clinical education
Vaughan, B., Moore, K., Kleinbaum, A.
International Journal of Osteopathic Medicine, 2017/09


370

Intuitive Judgement in the Context of Osteopathic Clinical Reasoning
Liem, T.
The Journal of the American Osteopathic Association, 2017/09
Free full text

371

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

372

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

373

Sensitivity for palpating lumbopelvic soft- tissues and bony landmarks and its associated factors: A single-blinded diagnostic accuracy study
Ferreira, A. P. A., Póvoa, L. C., Zanier, J. F. C., Machado, D. C., Ferreira, A. S.
Journal of Back and Musculoskeletal Rehabilitation, 2017/08

374

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text

375

Interexaminer reliability study of a standardized myofascial diagnostic technique of the superior thoracic inlet
Hutchinson, D., Hines, S., Vijayaraghavan, N., Sammond, A., Metzler-Wilson, K., Kuchera, M. L.
Journal of Bodywork and Movement Therapies, 2017/07

376

Osteopathic manipulative treatment in soccer players with chronic groin pain: a pilot study
Nolli, L., Baraggiolo, S., PaganiI, M, Origo, D., Bergna, A., Vismara, L.
Gazzetta Medica Italiana Archivio per le Scienze Mediche, 2017/06

377

A pilot study to develop a tool for the assessment of students' clinical record keeping
Moore, K., Vaughan, B., Cox, A.
International Journal of Osteopathic Medicine, 2017/06


379

Osteopathic manipulation of the ankle improves spinal flexibility in elite alpine skiers: a pilot study
Parisio, C., Vismara, L., Micotti, V., Cimolin, V., Aprile, D., Cavigioli, M., Panzeri, A., Manzotti, A., Galli, M., Capodaglio, P.
Gazzetta Medica Italiana Archivio Per Le Scienze Mediche, 2017/05


381

Clinical classification in low back pain: best-evidence diagnostic rules based on systematic reviews
Petersen, T., Laslett, M., Juhl, C.
BMC Musculoskeletal Disorders, 2017/05
Free full text

382

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

383

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

384

Non-pharmacological therapies for primary open angle glaucoma: A quasi-experimental pilot study
Pandey, R., Samuel, A. J., Aranha, V. P., Pandey, A., Narkeesh, K.
Saudi Journal of Ophthalmology, 2017/04
Free full text


386

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

387

Response to the Editorial “The enigmatic case of cranial osteopathy: Evidence vs clinical practice”
Monro, M., Farwell, S., Downes, W., Wilson, M., Carter, P. V.l, Douglas-Mort, D., Möckel, E., Zwierzchowska, Z., Apeztegia, J.
International Journal of Osteopathic Medicine, 2017/03

388

Enhancing clinical education in the private practice setting: A case study in osteopathy
Moore, K., Field, B. J.
International Journal of Osteopathic Medicine, 2017/03


390

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text



393

Reliability of a viva assessment of clinical reasoning in an Australian pre-professional osteopathy program assessed using generalizability theory
Vaughan, B., Orrock, P., Grace, S.
Journal of Educational Evaluation for Health Professions, 2017/01
Free full text



396

Effectiveness of osteopathic manipulative treatment versus osteopathy in the cranial field in temporomandibular disorders - a pilot study
Gesslbauer, C., Vavti, N., Keilani, M., Mickel, M., Crevenna, R.
Disability and Rehabilitation, 2016/12


398

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text





403

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

404

Multimodal compared to pharmacologic treatments for chronic tension-type headache in adolescents
Przekop, P., Przekop, A., Haviland, M. G.
Journal of Bodywork and Movement Therapies, 2016/10



407

The enigmatic case of cranial osteopathy: Evidence versus clinical practice
Zegarra-Parodi, R., Cerritelli, F.
International Journal of Osteopathic Medicine, 2016/09
Free full text

408

Does Using a Shim Improve the Diagnostic Reliability of the Standing Flexion Test? A Pilot Study
Marquez, A. P., Yim, M., Zelimkhanian, B., Quiamas, J., Davidge, R. E., Siri, M., Hruby, R. J.
The AAO Journal, 2016/09

409

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

410

Osteopathy for Endometriosis and Chronic Pelvic Pain - a Pilot Study
Sillem, M., Juhasz-Boss, I., Klausmeier, I., Mechsner, S., Siedentopf, F., Solomayer, E.
Geburtshilfe Frauenheilkunde, 2016/09

411

Preliminary development of a complex intervention for osteopathic management of dysfunctional breathing
Benjamin, J. G., Bacon, C. J., Verhoeff, W. J., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/09

412

R18 - Osteopathy for Post-Mastectomy Pain Syndrome (PMPS) in early breast cancer (EBC) patients: a pilot study in an Italian Oncology Unit
Putignano, F., Bidin, L., Belfiglio, B., Bordoni, F., Seghini, P., Cavanna, L.
Annals of Oncology, 2016/09

413

Tensegrity and manual therapy practice: a qualitative study
Hohenschurz-Schmidt, D. J., Esteves, J. E., Thomson, O. P.
International Journal of Osteopathic Medicine, 2016/09

414

Teaching and Assessment of High-Velocity, Low-Amplitude Techniques for the Spine in Predoctoral Medical Education
Channell, M. K.
The Journal of the American Osteopathic Association, 2016/09
Free full text

415

Efficacy of Osteopathic Manipulative Treatment for Management of Postpartum Pain
Hastings, V., McCallister, A. M., Curtis, S. A., Valant, R. J., Yao, S.
The Journal of the American Osteopathic Association, 2016/08
Free full text

416

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text

417

Exploration of clinical changes following a novel mobilisation technique for treatment of chronic low back pain: A single cohort design
Hanson, G. C., Jones, B., Bacon, C. J., Moran, R. W.
Journal of Bodywork and Movement Therapies, 2016/07

418

Targeted Pressure on Abductor Hallucis and Flexor Hallucis Brevis Muscles to Manage Moderate to Severe Primary Restless Legs Syndrome
Kuhn, P. J., Olson, D. J., Sullivan, J. P.
The Journal of the American Osteopathic Association, 2016/07
Free full text

419

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text

420

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

421

Masterclasses – integrating research evidence with expertise into clinical practice
Thomson, O. P., Evans, D. W.
International Journal of Osteopathic Medicine, 2016/06




425

Osteopathic Manipulative Treatment improves gait pattern and posture in adult patients with Prader–Willi syndrome
Vismara, L., Cimolin, V., Galli, M., Grugni, G., Ancillao, A., Capodaglio, P.
International Journal of Osteopathic Medicine, 2016/03




429

Understanding clinical reasoning in osteopathy: a qualitative research approach
Grace, S., Orrock, P., Vaughan, B., Blaich, R., Coutts, R.
Chiropractic & Manual Therapies, 2016/03
Free full text


431

Assessment of Australian osteopathic learners
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

432

Comparative assessment of tactile sensitivity between undergraduate and postgraduate health sciences students
Nascimento, L. P., Oliva-Pascual-Vaca, A., Renan-Ordine, R., Riquelme, I., Ricard, F., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2016/03

433

Osteopaths' clinical reasoning during consultation with patients experiencing acute low back pain: A qualitative case study approach
Roots, S. A., Niven, E., Moran, R. W.
International Journal of Osteopathic Medicine, 2016/03

434

Assessment of Australian osteopathic learners' clinical competence during workplace learning
Moore, K., Vaughan, B.
International Journal of Osteopathic Medicine, 2016/03

435

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text



438

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

439

The Osteopathic Clinical Practice Assessment – a pilot study to develop a new workplace-based assessment tool
Vaughan, B., Moore, K.
International Journal of Osteopathic Medicine, 2015/12

440

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text

441

Reassessing the accuracy and reproducibility of Diers formetric measurements in healthy volunteers
Lason, G., Peeters, L., Vandenberghe, K., Byttebier, G., Comhaire, F.
International Journal of Osteopathic Medicine, 2015/12

442

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text

443

Incidence of Somatic Dysfunction in Healthy Newborns
Waddington, E. L., Snider, K. T., Lockwood, M. D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2015/11
Free full text


445

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text


447

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text

448

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text






454

Impact of forefoot varus on standing and gait kinematics in children
Villarroya-Aparicio, A., Franco-Sierra, M. A., García-Muñoz, I., Marcén-Román, Y., Alonso-Vázquez, A., Rodriguez-Blanco, C.
International Journal of Osteopathic Medicine, 2015/09

455




458

Rehabilitation with osteopathic manipulative treatment after lumbar disc surgery: A randomised, controlled pilot study
Kim, B. H. J., Ahn, J. H., Cho, H. C., Kim, D. Y., Kim, T. Y., Yoon, B. C.
International Journal of Osteopathic Medicine, 2015/09

459

Improving our impact and developing high-level clinical expertise
Moran, R.
International Journal of Osteopathic Medicine, 2015/09
Free full text

460

Becoming an expert: A Masterclass in developing clinical expertise
Petty, N. J.
International Journal of Osteopathic Medicine, 2015/09


462

Using Simulation-Based Medical Education to Meet the Competency Requirements for the Single Accreditation System
Riley, B.
The Journal of the American Osteopathic Association, 2015/08
Free full text

463

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text

464

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

465

Osteopathic Manipulative Therapy in Women With Postpartum Low Back Pain and Disability: A Pragmatic Randomized Controlled Trial
Schwerla, F., Rother, K., Rother, D., Ruetz, M., Resch, K.L.
The Journal of the American Osteopathic Association, 2015/07
Free full text

466

Immediate changes in electroencephalography activity in individuals with nonspecific chronic low back pain after cranial osteopathic manipulative treatment: study protocol of a randomized, controlled crossover trial
Martins, W. R., Diniz, L. R., Blasczyk, J. C., Lagoa, K. F., Thomaz, S., Rodrigues, M. E., de Oliveira, R. J., Bonini-Rocha, A. C.
BMC Complementary and Alternative Medicine, 2015/07
Free full text

467

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

468

Relationship between somatic dysfunction of the lumbosacral joint and changes in the gait pattern
Croonenborghs, H., Peeters, L., De Schepper, J.
International Journal of Osteopathic Medicine, 2015/06

469

What evidence is good evidence? A Masterclass in critical appraisal
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2015/06

470

A global view of osteopathic practice – mirror or echo chamber?
McGrath, M. C.
International Journal of Osteopathic Medicine, 2015/06



473

American sign language and deaf culture competency of osteopathic medical students
Lapinski, J., Colonna, C., Sexton, P., Richard, M.
American Annals of the Deaf, 2015/05

474

Lymphatic pump treatment as an adjunct to antibiotics for pneumonia in a rat model
Hodge, L. M., Creasy, C., Carter, K., Orlowski, A., Schander, A., King, H. H.
The Journal of the American Osteopathic Association, 2015/05
Free full text

475

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text


477

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

478

Osteopathic manipulative treatment and pain in preterms: study protocol for a randomised controlled trial
Cerritelli, F., Cicchitti, L., Martelli, M., Barlafante, G., Renzetti, C., Pizzolorusso, G., Lupacchini, M., D'Orazio, M., Marinelli, B., Cozzolino, V., Fusilli, P., D'Incecco, C.
Trials, 2015/04
Free full text

479



481

Evidence, theory and variability in osteopathic practice
Vogel, S.
International Journal of Osteopathic Medicine, 2015/03
Free full text




485

Rocky Vista University, College of Osteopathic Medicine Hyperrealistic Simulation Center, Parker, Colorado
Lea, M. S., Slattery Oms-Iii, R., LaPorta, A. J., Tieman, M., Bowden, R., Stasio, J., Moloff, A., Franciose, R., Hoang, T.
Journal of Surgical Education, 2015/03


487

Effectiveness of osteopathic manipulative treatment for carpal tunnel syndrome: a pilot project
Burnham, T., Higgins, D. C., Burnham, R. S., Heath, D. M.
The Journal of the American Osteopathic Association, 2015/03
Free full text


489

Osteopathic graduates perceptions of stress and competence – A longitudinal study
Subramaniam, P., Eaton, S.A., Cranfield, J., Mulcahy, J., McLaughlin, P., Morrison, T., Vaughan, B.
International Journal of Osteopathic Medicine, 2015/03

490

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text

491

A pilot study on spatial changes in the maxilla caused by osteopathic therapy
Walter, C., Lechner, K. H., Karl, M.
Quintessence International, 2015/01

492

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text




496

The role of clinicians in osteopathic research
Zegarra-Parodi, R.
International Journal of Osteopathic Medicine, 2014/12







503




506

Effekt von Lebermobilisation
(Effects of liver mobilization)
March, S.
Unpublished MSc thesis, 2014/10
Free full text

507

Benchmarking the strategies for assessing clinical reasoning in osteopathic curricula
Moore, K., Grace, S., Orrock, P., Coutts, R., Blaich, R., Vaughan, B.
International Journal of Osteopathic Medicine, 2014/09

508

Osteopaths' professional views, identities and conceptions – A qualitative grounded theory study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/09

509

Grounding osteopathic research – Introducing grounded theory
Thomson, O. P., Petty, N. J., Scholes, J.
International Journal of Osteopathic Medicine, 2014/09

510

Clinical education in the osteopathy program at Victoria University
Vaughan, B., MacFarlane, C., Florentine, P.
International Journal of Osteopathic Medicine, 2014/09

511

Developing a viva exam to assess clinical reasoning in pre-registration osteopathy students
Orrock, P., Grace, S., Vaughan, B., Coutts, R.
BMC Medical Education, 2014/09
Free full text

512

H-reflex responses to High-Velocity Low-Amplitude manipulation in asymptomatic adults
Groisman, S., Silva, L., Rocha, N., Hoff, F., Rodrigues, M. E., Ehlers, J. A., Diniz, L. R.
International Journal of Osteopathic Medicine, 2014/09


514

Diagnostic reasoning in osteopathy – A qualitative study
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2014/06


516

Clinical audit in osteopathic practice: A Masterclass
Fawkes, C., Ward, E., Carnes, D.
International Journal of Osteopathic Medicine, 2014/06

517

A New Model for Educating Our Nation's Primary Care Physicians
Buser, B. R.
The Journal of the American Osteopathic Association, 2014/06
Free full text

518

Shorter Training Is No Solution for Building the Primary Care Physician Workforce
Henwood, C. L.
The Journal of the American Osteopathic Association, 2014/06
Free full text

519

Diagnostic palpation and decision making: A neurocognitive model of expertise.
Esteves, J. E., Spence, C.
Russian Osteopathic Journal, 2014/06
Free full text

520

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text


522

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text


524

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text

525

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text

526

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

527

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text


529

A different view of the Middle East
Bach, A.
The Journal of the American Osteopathic Association, 2014/03
Free full text

530

Clinical effectiveness of manual therapy for the management of musculoskeletal and non-musculoskeletal conditions: systematic review and update of UK evidence report
Clar, C., Tsertsvadze, A., Court, R., Hundt, G. L., Clarke, A., Sutcliffe, P.
Chiropractic & Manual Therapies, 2014/03
Free full text


532

Osteopathic manipulative therapy induces early plasma cytokine release and mobilization of a population of blood dendritic cells
Walkowski, S., Singh, M., Puertas, J., Pate, M., Goodrum, K., Benencia, F.
PLoS One, 2014/03
Free full text




536

Effect of synchronized or desynchronized music listening during osteopathic treatment: an EEG study
Mercadie, L., Caballe, J., Aucouturier, J. J., Bigand, E.
Psychophysiology, 2014/01

537

Patterns of misrepresentation of clinical findings on patient notes during the COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Gallagher, L. A., Langenau, E. E.
The Journal of the American Osteopathic Association, 2014/01
Free full text


539

Script concordance test: Insights from the literature and early stages of its implementation in osteopathy
Esteves, J. E., Bennison, M., Thomson, O. P.
International Journal of Osteopathic Medicine, 2013/12


541

Assessing undergraduate osteopaths in the identification of patients' excess body weight
Bright, P., Wasik, C.
International Journal of Osteopathic Medicine, 2013/12


543

Effect of selected manual therapy interventions for mechanical neck pain on vertebral and internal carotid arterial blood flow and cerebral inflow
Thomas, L. C., Rivett, D. A., Bateman, G., Stanwell, P., Levi, C. R.
Physical Therapy, 2013/11
Free full text

544


545

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

546

High-velocity low-amplitude thrust manipulation of the lumbar spine immediately modifies soleus T reflex in asymptomatic adults
Boët, C., Fugier, S., Marsault, J., Toublan, D., Valot, M.E., Cheval, A., Amyot d'Inville, G., Niel, S., Guihéneuc, P., Guihard, G.
International Journal of Osteopathic Medicine, 2013/09


548

Changes in alpha band activity associated with application of the compression of fourth ventricular (CV-4) osteopathic procedure: A qEEG pilot study
Miana, L., Hugo do Vale Bastos, V., Machado, S., Arias-Carrión, O., Nardi, Antonio E., Almeida, L., Ribeiro, P., Machado, D., King, H., Silva, J. G.
Journal of Bodywork and Movement Therapies, 2013/07
Free full text

549

Developing competence in diagnostic palpation: Perspectives from neuroscience and education
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2013/07

550

Ruling out other causes than chest wall syndrome for patients with chest pain
Vaucher, P.
International Journal of Osteopathic Medicine, 2013/06


552

Osteopathie und Unfruchtbarkeit
(Osteopathy and infertility)
Kermorgant, G.
Osteopathische Medizin, 2013/06

553

Osteopathic treatment of patients with long-term sequelae of whiplash injury: effect on neck pain disability and quality of life
Schwerla, F., Kaiser, A. K., Gietz, R., Kastner, R.
The Journal of Alternative and Complementary Medicine, 2013/06

554

An international health elective in Haiti: a case for osteopathic medicine
Coupet, S., Howell, J. D., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2013/06
Free full text

555

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

556

Use of the SMART Balance Master to quantify the effects of osteopathic manipulative treatment in patients with dizziness
Fraix, M., Gordon, A., Graham, V., Hurwitz, E., Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text

557

Sham manual medicine protocol for cervical strain-counterstrain research
Brose, S. W., Jennings, D. C., Kwok, J., Stuart, C. L., O', Connell, S. M., Pauli, H. A., Liu, B.
PM&R: The Journal of Injury, Function and Rehabilitation, 2013/05

558

Osteopathic intervention in chronic non-specific low back pain: a systematic review
Orrock, P. J., Myers, S. P.
BMC Musculoskeletal Disorders, 2013/04
Free full text

559

The use of placebo interventions in clinical practice
Linde, K.
Complementary Therapies in Medicine, 2013/04
Free full text

560

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

561

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

562

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

563

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

564

A rising tide of older patients: preparing future DOs
Shannon, S. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

565


566

The effects of experience on the inter-reliability of osteopaths to detect changes in posterior superior iliac spine levels using a hidden heel wedge
Sutton, C., Nono, L., Johnston, R. G., Thomson, O. P.
Journal of Bodywork and Movement Therapies, 2013/04


568

Clinical decision making and therapeutic approaches of experienced osteopaths
Thomson, O.
Unpublished PhD thesis, 2013/04
Free full text

569

Evaluation of behavioural and gastrointestinal symptoms in autistic children after visceral osteopathic treatment
Castellarin, I. B., Drysdale, I. P., Patel, V.
International Journal of Osteopathic Medicine, 2013/03


571

Reconsidering the patient-centeredness of osteopathy
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

572

Clinical reasoning and therapeutic approaches of experienced osteopaths
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2013/03

573

Electromyographic responses of deep thoracic transversospinalis muscles to osteopathic manipulative interventions
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2013/03

574

Lumbosacral Muscle Energy Technique produces immediate decreases in corticospinal and spinal reflex excitability in asymptomatic participants
Fryer, G., Glynn, B., Masin, K., Wroe, M., Pearce, A. J.
International Journal of Osteopathic Medicine, 2013/03

575

Stabilometric platform as a diagnosis support for pain? Example of chronic low back pain
Huard, Y., Bertucci, W.
The AAO Journal, 2013/03
Free full text







582

A systematic review to evaluate the clinical benefits of craniosacral therapy
Jäkel, A., von Hauenschild, P.
Complementary Therapies in Medicine, 2012/12

583

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text

584

Establishing the content validity of palpatory examination for the assessment of the lumbar spine using ultrasonography: a pilot study
Shaw, K. A., Dougherty, J. J., Treffer, K. D., Glaros, A. G.
The Journal of the American Osteopathic Association, 2012/12
Free full text







591

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text

592

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

593

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text

594

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

595

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text

596

Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia
Marszalek, S., Niebudek-Bogusz, E., Woznicka, E., Malinska, J., Golusinski, W., Sliwinska-Kowalska, M.
International Journal of Occupational Medicine and Environmental Health, 2012/06

597

Iliacus tender points in young adults: a pilot study
Liu, Y., Palmer, J. L.
The Journal of the American Osteopathic Association, 2012/05
Free full text

598

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text


600

Osteopathic medical student learning competency
Bell, H., Donohue, W., Liang, Y. J., Kim, J., Cettin, M.
Family Medicine, 2012/03

601

Stress reduction with osteopathy assessed with GDV electrophotonic imaging: effects of osteopathy treatment
Korotkov, K., Shelkov, O., Shevtsov, A., Mohov, D., Paoletti, S., Mirosnichenko, D., Labkovskaya, E., Robertson, L.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text

602

Osteopathic manipulative treatment effectiveness in severe chronic obstructive pulmonary disease: a pilot study
Zanotti, E., Berardinelli, P., Bizzarri, C., Civardi, A., Manstretta, A., Rossetti, S., Fracchia, C.
Complementary Therapies in Medicine, 2012/02-04
Free full text



605

Assessment of osteopaths: Developing a capability-based approach to reviewing readiness to practice
Stone, C., Boud, D., Hager, P.
International Journal of Osteopathic Medicine, 2011/12


607

Exploring the impact of osteopathic treatment on cranial asymmetries associated with nonsynostotic plagiocephaly in infants
Lessard, S., Gagnon, I., Trottier, N.
Complementary Therapies in Clinical Practice, 2011/11
Free full text

608

Comparative Analysis of Muscle Energy Technique and Conventional Physiotherapy in Treatment of Sacroiliac Joint Dysfunction
Dhinkaran, M., Sareen, A., Arora, T.
Indian Journal of Physiotherapy & Occupational Therapy, 2011/10

609

Muscle fatigue in chronic fatigue syndrome/myalgic encephalomyelitis (CFS/ME) and its response to a manual therapeutic approach: A pilot study
Perrin, R. N., Richards, J. D., Pentreath, V., Percy, D. F.
International Journal of Osteopathic Medicine, 2011/09






615

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?
Shaw, H. H.
The Journal of the American Osteopathic Association, 2011/08
Free full text

616

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text

617

The Hawthorne effect: stronger than the placebo effect?
Berthelot, J. M., Le Goff, B., Maugars, Y.
Joint Bone Spine, 2011/07
Free full text

618


619

The assessment of pelvic landmarks using palpation: A reliability study of undergraduate students
Rajendran, D., Gallagher, D.
International Journal of Osteopathic Medicine, 2011/06

620

Clinical reasoning in osteopathy – More than just principles?
Thomson, O. P., Petty, N. J., Moore, A. P.
International Journal of Osteopathic Medicine, 2011/06

621

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text

622

Effects of comprehensive osteopathic manipulative treatment on balance in elderly patients: a pilot study
Lopez, D., King, H. H., Knebl, J. A., Kosmopoulos, V., Collins, D., Patterson, R. M.
The Journal of the American Osteopathic Association, 2011/06
Free full text

623

Effect of osteopathic manipulative treatment on gastrointestinal function and length of stay of preterm infants: an exploratory study
Pizzolorusso, F., Turi, P., Barlafante, G., Cerritelli, F., Renzetti, C., Cozzolino, V., D'Orazio, M., Fusilli, P., Carinci, F., D'Incecco, C.
Chiropractic & Manual Therapies, 2011/06
Free full text




627

The effectiveness of osteopathic treatment in women with endometriosis-related pain
Schneider-Milo, U.
Unpublished MSc thesis, 2011/06
Free full text


629

Palpatory accuracy of lumbar spinous processes using multiple bony landmarks
Snider, K. T., Snider, E. J., Degenhardt, B. F., Johnson, J. C., Kribs, J. W.
Journal of Manipulative and Physiological Therapeutics, 2011/06
Free full text

630

Diagnostic Palpation in Osteopathic Medicine: A Putative Neurocognitive Model of Expertise
Esteves, J. E. d. J.
Unpublished PhD thesis, 2011/06
Free full text



633

Are clinical protocols for osteopathic manipulative procedures truly “osteopathic“?
Kirsch, J. R.
The Journal of the American Osteopathic Association, 2011/05
Free full text

634

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

635

Interprofessional education: cooperation among osteopathic medicine, pharmacy, and physician assistant students to recognize medical errors
Meszaros, K., Lopes, I. C., Goldsmith, P. C., Knapp, K. K.
The Journal of the American Osteopathic Association, 2011/04
Free full text

636

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

637

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

638

An Osteopathic Approach to Chronic Sinusitis
Lee-Wong, M., Karagic, M., Doshi, A., Gomez, S., Resnick, D.
Journal of Allergy & Therapy, 2011/04
Free full text

639

The palpated cranial rhythmic impulse (CRI): Its normative rate and examiner experience
Sergueef, N., Greer, M. A., Nelson, K. E., Glonek, T.
International Journal of Osteopathic Medicine, 2011/03

640

Maintenance and improvement of interobserver reliability of osteopathic palpatory tests
Marino, R. V., Elkiss, M.
The Journal of the American Osteopathic Association, 2011/03
Free full text


642

Osteopathie an Kliniken (Interviews)
(Osteopathy in hospitals)
Hogrefe, H.C., Graf, A., Bockius, D.
Osteopathische Medizin, 2011/03



645

Low back pain, somatic dysfunction, and segmental bone mineral density T-score variation in the lumbar spine
Snider, K. T., Johnson, J. C., Degenhardt, B. F., Snider, E. J.
The Journal of the American Osteopathic Association, 2011/02
Free full text

646

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

647

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text

648

Osteopathic manipulation as a complementary treatment for the prevention of cardiac complications: 12-Months follow-up of intima media and blood pressure on a cohort affected by hypertension
Cerritelli, F., Carinci, F., Pizzolorusso, G., Turi, P., Renzetti, C., Pizzolorusso, F., Orlando, F., Cozzolino, V., Barlafante, G.
Journal of Bodywork and Movement Therapies, 2011/01
Free full text


650

What are the factors that guide an osteopath during the process of technique choice?
Albertson, P.
Unpublished MSc thesis, 2011/01
Free full text

651




654

Osteopathic Medicine's Holistic Approach Is More Important Than Ever
Goldberg, P. M.
The Journal of the American Osteopathic Association, 2010/12
Free full text


656

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text


658

New COMLEX-USA-to-USMLE conversion formula needed
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2010/10
Free full text





663

Test-dependent osteopathic treatment of patients with tinnitus and craniomandibular dysfunctions (CMD): A pre-post pilot trial
Salomon, J., Kronau, S., Moshövel, N., Niggemeier, H., Rütz, M.
International Journal of Osteopathic Medicine, 2010/09/


665

Effect of osteopathic treatment on the gastrointestinal system function of autistic children
Castellarin, I. B., Hucklebridge, F., Patel, V. B., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2010/09

666

Osteopathic treatment of patients with lower urinary tract symptoms and benign prostatic hyperplasia: A pre-post pilot trial
Conrad, U., Scheuer, K., Hebgen, E., Schwerla, F.
International Journal of Osteopathic Medicine, 2010/09

667

A possible contribution of osteopathic medicine in the management of children affected by ADD/ADHD
Cozzolino, V., Accorsi, A., Di Mattia, L., Granchelli, C., Lucci, C., Pizzolorusso, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

668

Somatic dysfunctions in newborns: prevalence and interoperator correlation
Cozzolino, V., Boccuzzi, M., Evangelista, S., Germinario, G., Cerritelli, F., Barlafante, G.
International Journal of Osteopathic Medicine, 2010/09

669

Investigating the role of vision and touch in the diagnosis of somatic dysfunction
Esteves, J. E., Spence, C.
International Journal of Osteopathic Medicine, 2010/09

670


671

Hamo-Study 3, Phase 1: Effects of sternotomy on the mobility of the heart under influence of respiration at 3-months postoperative
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2010/09


673

Osteopathic manipulative treatment and vertigo: a pilot study
Fraix, M.
PM&R: The Journal of Injury, Function and Rehabilitation, 2010/07

674

Anterior superior iliac spine asymmetry assessment on a novel pelvic model: an investigation of accuracy and reliability
Stovall, B. A., Bae, S., Kumar, S.
Journal of Manipulative and Physiological Therapeutics, 2010/06
Free full text



677

Relating a manual medicine diagnostic test of cervical motion function to specific three-dimensional kinematic variables
Bush, T. R., Vorro, J., Alderink, G., Gorbis, S., Li, M., Leitkam, S.
International Journal of Osteopathic Medicine, 2010/06

678

Brief report of a clinical trial on the duration of middle ear effusion in young children using a standardized osteopathic manipulative medicine protocol
Steele, K. M., Viola, J., Burns, E., Carreiro, J. E.
The Journal of the American Osteopathic Association, 2010/05
Free full text

679

Effect of pedal pump and thoracic pump techniques on intracranial pressure in patients with traumatic brain injuries
Cramer, D., Miulli, D. E., Valcore, J. C., Taveau, J. W., Do, N., Hutton, D. S., Sonti, G., Wogu, E., Boorman, C. F., Panchal, R. R.
The Journal of the American Osteopathic Association, 2010/04
Free full text

680

Biomechanical Disorders in the Patients with Lumbar Discal Hernias and Their Osteopathic Correction
Novoseltsev, S. V., Vcherashny, D. B.
The AAO Journal, 2010/03
Free full text


682

The effect of Osteopathic Treatment on Chronic Constipation – A Pilot Study
Brugman, R., Fitzgerald, K., Fryer, G.
International Journal of Osteopathic Medicine, 2010/03

683

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

684

Five-year summary of COMLEX-USA level 2-PE examinee performance and survey data
Langenau, E. E., Dyer, C., Roberts, W. L., Wilson, C., Gimpel, J.
The Journal of the American Osteopathic Association, 2010/03
Free full text


686

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

687

Accreditation standards of DO- and MD-granting medical schools: an incomplete comparison
Hunt, D., Barzansky, B., Sabalis, R.
Academic Medicine, 2010/01
Free full text




691


692

NICE clinical guidelines. Low back pain: The early management of persistent non-specific back pain
Vogel, S.
International Journal of Osteopathic Medicine, 2009/12
Free full text






698

Can intraocular pressure be influenced by osteopathic treatment?
van de Kraats, A.
Unpublished MSc thesis, 2009/12
Free full text

699

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text








707

The effects of osteopathic treatment on constipation in children with cerebral palsy: a pilot study
Tarsuslu, T., Bol, H., Simsek, I. E., Toylan, I. E., Cam, S.
Journal of Manipulative and Physiological Therapeutics, 2009/10
Free full text

708

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text



711

Measurement of Cranial Palpation Pressures used by Professional Osteopaths
Zegarra-Parodi, R., De Chauvigny De Blot, P., Rickards, L., Naili, S., Renard, E.
European Journal of Pain, 2009/09
Free full text


713

Inter-examiner reliability of palpation for tissue texture abnormality in the thoracic paraspinal region
Paulet, T., Fryer, G.
International Journal of Osteopathic Medicine, 2009/09




717

The road to becoming an osteopathic physician is long for a good reason
Zubcevik, N.
The Journal of the American Osteopathic Association, 2009/07
Free full text


719

Aufruf Arbeitskreis klinische Osteopathie
(Appeal for a Working Group Clinical Osteopathy)
Schroeder, K.H.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

720

Osteopathie bei akuten Erkrankungen
(Osteopathy for acute diseases)
Seider, R.
DO - Deutsche Zeitschrift für Osteopathie, 2009/07

721

The appropriate amount of force used must always be individualized for each patient during each treatment session
Abu-Sbaih, R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

722

Comments on cranio-sacral method and efficacy
Blacklaw-Jones, R. D.
International Journal of Osteopathic Medicine, 2009/06

723

Clinical guidelines, adverse events and SQUID
Lucas, N. P., Moran, R.
International Journal of Osteopathic Medicine, 2009/06


725

Monitoring self-reported adverse events: A prospective, pilot study in a UK osteopathic teaching clinic
Rajendran, D., Mullinger, B., Fossum, C., Collins, P., Froud, R.
International Journal of Osteopathic Medicine, 2009/06


727

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

728

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

729

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

730

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text


732

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text

733

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text




737

O efeito imediato da manipulação talocrural na estabilidade unipodal de tornozelo
(Immediate effects of talocrural manipulation on ankle monopodalic stability)
Xavier, M., Pires, V. A., Albertini, R. A., Arrieiro, A. N., Manuard, P., Almeida, L. C., de, Souza R. A.
Revista terapia manual, 2009/05-06

738

The three leaves of Glénard- An examination of a functional aspect
Wolke, N.
Unpublished MSc thesis, 2009/05
Free full text


740

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

741

Treatment of the monosymptomatic Nocturnal enuresis
Scheible, B.
Unpublished MSc thesis, 2009/03
Free full text


743

What do patients expect, who come to an osteopathic clinic?
Meuser, A.
Unpublished MSc thesis, 2009/02
Free full text




747

The effects of lumbar spine high velocity low amplitude thrust (HVLAT) manipulation on upper limb cutaneous blood supply
Sugrue, N., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2008/12

748

Lymphatic pump treatment mobilizes leukocytes from the gut associated lymphoid tissue into thoracic duct lymph
Schander, A., Bearden, M. K., Huff, J. B., Williams, A., Stoll, S. T., Simecka, J. W., King, H. H., Downey, H. F., Hodge, L. M.
International Journal of Osteopathic Medicine, 2008/12

749

Hamo-study ii: effects of sternotomy on the mobility of the heart under influence of respiration
Roncada, G., Bijnens, E., Dendale, P.
International Journal of Osteopathic Medicine, 2008/12

750

The standing flexion test is reproducible but fails to reveal sacroiliac joint ankylosis
Mandara, A., Sosio, S., Di Mattia, C.
International Journal of Osteopathic Medicine, 2008/12


752

Clinical competence examination – Improvement of validity and reliability
Fletcher, P.
International Journal of Osteopathic Medicine, 2008/12

753

Multisensory integration in an osteopathic clinical examination setting
Esteves, J. E., Geake, J., Spence, C.
International Journal of Osteopathic Medicine, 2008/12

754

Pilot clinical study of osteopathic manipulative treatment in pregnant patients with acute low back pain
Caragan, C., Tang, P.Y., Slack, M., Leiber, J. D., Koskinen, J., Zust, D., Cragun, T.
International Journal of Osteopathic Medicine, 2008/12


756

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text

757

Investigation of an electromyographic normalization task for the deep thoracic paraspinal muscles
Fryer, G., Bird, M., Robbins, B., Johnson, J. C.
International Journal of Osteopathic Medicine, 2008/12




761




764

End-of-life care curricula in undergraduate medical education: a comparison of allopathic and osteopathic medical schools
Rothman, M. D., Gugliucci, M. R.
American Journal of Hospice and Palliative Care, 2008/10-11

765

Osteopathie bei chronischem Schmerz
(Osteopathy applied to chronic pain patients)
Deichmeier, A., von Fischern, F., Heinbücher, I.
Unpublished D.O. thesis, 2008/10



768

Echinacea purpurea and osteopathic manipulative treatment in children with recurrent otitis media: a randomized controlled trial
Wahl, R. A., Aldous, M. B., Worden, K. A., Grant, K. L.
BMC Complementary and Alternative Medicine, 2008/10
Free full text




772

Osteopathy with Enuresis
Kargl, D.
Unpublished MSc thesis, 2008/09
Free full text

773

Osteopathic Prevention Study in Achievement-orientaded Young Soccer Players
Angleitner, C.
Unpublished MSc thesis, 2008/09
Free full text

774

Intraobserver reliability of cranial strain patterns as evaluated by osteopathic physicians: a pilot study
Halma, K. D., Degenhardt, B. F., Snider, K. T., Johnson, J. C., Flaim, M. S., Bradshaw, D.
The Journal of the American Osteopathic Association, 2008/09
Free full text

775

Clinical and research protocol for osteopathic manipulative treatment of elderly patients with pneumonia
Noll, D. R., Degenhardt, B. F., Fossum, C., Hensel, K.
The Journal of the American Osteopathic Association, 2008/09
Free full text


777

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text

778

Osteopathic manipulative treatment and its relationship to autonomic nervous system activity as demonstrated by heart rate variability: a repeated measures study
Henley, C. E., Ivins, D., Mills, M., Wen, F. K., Benjamin, B. A.
Osteopathic Medicine and Primary Care, 2008/06
Free full text

779

Osteopathische Diaphragmen und Wandlungsphasen
(Osteopathic diaphragms and transformation phases)
Wendling, D.
KIM - Komplementare und Integrative Medizin, Ärtztezeitschrift fur Naturheilverfahren, 2008/04

780

The virtual haptic back: a simulation for training in palpatory diagnosis
Howell, J. N., Conatser, R. R., Williams II., R. L., Burns, J. M., Eland, D. C.
BMC Medical Education, 2008/04


782

About the ligaments of the pleural dome
Scheiterbauer, F.
Unpublished MSc thesis, 2008/02
Free full text


784

Growing pains in children- can osteopathy improve the clinical picture?
Kramer, B.
Unpublished MSc thesis, 2008/02
Free full text

785

The Integration of Clinical Reasoning in Osteopathy
Fink-Koller, B.
Unpublished MSc thesis, 2008/02
Free full text

786

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text

787

Revisiting Castlio and Ferris-Swift's experiments on direct splenic stimulation in patients with acute infectious disease
Noll, D. R., Johnson, J. C., Brooks, J. E.
The Journal of the American Osteopathic Association, 2008/02
Free full text

788

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text


790

Palpatory diagnosis training on the virtual haptic back: performance improvement and user evaluations
Howell, J. N., Conatser, R. R., Williams, R. L., Burns, J. M., Eland, D. C.
The Journal of the American Osteopathic Association, 2008/01
Free full text

791

Intertester reliability and validity of motion assessments during lumbar spine accessory motion testing
Landel, R., Kulig, K., Fredericson, M., Li, B., Powers, C. M.
Physical Therapy & Rehabilitation Journal, 2008/01
Free full text

792

Postnatal Emotional Disorder and Osteopathy
Leitner-Wagger, F.
Unpublished MSc thesis, 2007/12
Free full text


794

An investigation into the side of joint cavitation associated with cervical spine manipulation
Bolton, A., Moran, R. W., Standen, C.
International Journal of Osteopathic Medicine, 2007/12


796

The influence of osteopathic treatment on the lung function of COPD patients
Grabner, A.
Unpublished MSc thesis, 2007/10
Free full text

797

Examining the Somatic Dysfunction: Lessons Learned in Practice
Danto, J. B., Danto, D. Z., Burns, A. T.
The AAO Journal, 2007/09
Free full text



800

Developing clinical guidelines for the physiotherapy management of whiplash associated disorder (WAD)
Mercer, C., Jackson, A., Moore, A.
International Journal of Osteopathic Medicine, 2007/06

801

Attitudes to back pain amongst musculoskeletal practitioners: a comparison of professional groups and practice settings using the ABS-mp
Pincus, T., Foster, N. E., Vogel, S., Santos, R., Breen, A., Underwood, M.
Manual Therapy, 2007/05

802

Competence levels in musculoskeletal medicine: a call to action
Ruane, J. J.
The Journal of the American Osteopathic Association, 2007/05
Free full text

803

Osteopathic specialty board certification
Ramirez, A. F., Bell, E. C.
The Journal of the American Osteopathic Association, 2007/03
Free full text


805

Unexplained Subfertility and Osteopathic Treatment
Kapper, A.
Unpublished MSc thesis, 2007/03
Free full text

806

Dysgnathia as a correlative to an SBS – Lesion?
Krenner, E.
Unpublished MSc thesis, 2007/03
Free full text

807

Temporomandibular- and Hip Joint - an Osteopathic Relation?
Brenner, E.
Unpublished MSc thesis, 2007/03
Free full text


809





813

The Effectiveness of Osteopathic Treatment in Perimenopause
Zanon, B.
Unpublished MSc thesis, 2007/03
Free full text


815

Examination of Refraction in Myopia - An Osteopathic Treatment Approach
Bayer, C.
Unpublished MSc thesis, 2007/03
Free full text

816

The Influence of osteopathy on the vegetative nervous system in chronic pain patients
Fürpaß, E.
Unpublished MSc thesis, 2007/03
Free full text



819

Does an osteopathic treatment influence the human voice?
Hempel, G.
Unpublished MSc thesis, 2007/03
Free full text

820

Osteopathy in idiopathic sudden hearing loss
Staffa, U.
Unpublished MSc thesis, 2007/03
Free full text






826

Comparison between CV4 and EV4 via Biofeedback-measurement
Grill, M.
Unpublished MSc thesis, 2007/01
Free full text

827

Does Osteopathy Influence Diabetes Mellitus Type II?
Kiegerl, G.
Unpublished MSc thesis, 2007/01
Free full text

828

Status post abortus - Usefulness of osteopathic treatment after miscarriage
Krasser, E.
Unpublished MSc thesis, 2007/01
Free full text

829

Osteopathic Treatment During Transition of Perimenopause
Mückler, A.
Unpublished MSc thesis, 2007/01
Free full text

830

Influence of Osteopathic Treatment on Congestive Menstrual Disorders and Premenstrual Syndrome
Riepler-Reisecker, I.
Unpublished MSc thesis, 2007/01
Free full text

831

Observation Cv4-technique - Hypertension Hypertension - Osteopathic Disfunctions
Schögler, M.
Unpublished MSc thesis, 2007/01
Free full text

832

Touching Reliability
Sommerfeld, P.
Unpublished MSc thesis, 2007/01
Free full text



835

Osteopathy and the Breech Presentation after 30 Weeks of Gestation
Georgiades, O.
Unpublished MSc thesis, 2007/01
Free full text

836

The influence of sitting position on (ventro-) dorsal head translation
Hoffmann, F.
Unpublished MSc thesis, 2007/01
Free full text

837

Along The Dura Mater in Patients with Multiple Sclerosis
Toth, A.
Unpublished MSc thesis, 2007/01
Free full text


839

Osteopathy and Tinnitus
Plamberger, M.
Unpublished MSc thesis, 2007
Free full text



842

Stretch reflex and Hoffmann reflex responses to osteopathic manipulative treatment in subjects with Achilles tendinitis
Howell, J. N., Cabell, K. S., Chila, A. G., Eland, D. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

843

Interexaminer reliability of three methods of combining test results to determine side of sacral restriction, sacral base position, and innominate bone position
Tong, H. C., Heyman, O. G., Lado, D. A., Isser, M. M.
The Journal of the American Osteopathic Association, 2006/08
Free full text


845

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

846

OMT: evidence, research, and practice
McCombs, T. M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

847

Maintaining competence and leadership in manual medicine
Beal, M. C.
The Journal of the American Osteopathic Association, 2006/06
Free full text

848

Competence levels in musculoskeletal medicine: comparison of osteopathic and allopathic medical graduates
Stockard, A. R., Allen, T. W.
The Journal of the American Osteopathic Association, 2006/06
Free full text


850

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

851

Investigation into the affectivity on cutaneous blood perfusion of different application time lengths of cold hydrotherapy
Crossland, S., Drysdale, I. P.
International Journal of Osteopathic Medicine, 2006/03

852

Recurring Limitations in OMT Research
Cardarelli, R.
The Journal of the American Osteopathic Association, 2006/03
Free full text

853

Trunk and limb muscle activity during the application of a mobilisation type force to the vertebral column
Blaich, R., Ginn, K., Cathers, I., Lee, M.
International Journal of Osteopathic Medicine, 2006/03

854

The effect of osteopathic treatment on people with sub-chronic and chronic neck pain: A pilot study
Alvizatos, J., Lamaro, J., Fryer, G.
International Journal of Osteopathic Medicine, 2006/03

855

Reliability of visual assessment for lumbar curves in standing: Does clinical experience matter?
Moran, R. W., Ljubotenski, E.
International Journal of Osteopathic Medicine, 2006/03


857

The electromyographic activity of thoracic paraspinal muscles identified as abnormal with palpation
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03

858

Electromyographic characteristics of deep, thoracic paraspinal musculature
Fryer, G., Morris, T., Gibbons, P., Briggs, A.
International Journal of Osteopathic Medicine, 2006/03

859

(Osteopathic treatment of newborns with sucking dysfunction)
Mahdi, S.
Osteopathische Medizin, 2006/02
Free full text

860

Osteopathic Preparation of Birth
Reiter-Horngacher, M.
Unpublished MSc thesis, 2006/01
Free full text


862

Revisiting Castlio and Ferris-Swift's experiments testing the effects of splenic pump in normal individuals
Noll, D. R., Johnson, J. C.
International Journal of Osteopathic Medicine, 2005/12




866

Interobserver reliability of osteopathic palpatory diagnostic tests of the lumbar spine: improvements from consensus training
Degenhardt, B. F., Snider, K. T., Snider, E. J., Johnson, J. C.
The Journal of the American Osteopathic Association, 2005/10
Free full text



869

Hemodynamic effects of osteopathic manipulative treatment immediately after coronary artery bypass graft surgery
Olivencia-Yurvati, A. H., Carnes, M. S., Clearfield, M. B., Stoll, S. T., McConathy, W. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text




873

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

874

The active knee extension test and Slump test in subjects with perceived hamstring tightness
Kuilart, K. E., Woollam, M., Barling, E., Lucas, N. P.
International Journal of Osteopathic Medicine, 2005/09

875

The effect of osteopathic treatment on people with chronic and sub-chronic neck pain: A pilot study
Fryer, G., Alvizatos, J., Lamaro, J.
International Journal of Osteopathic Medicine, 2005/06

876

Advancing a traditional view of osteopathic medicine through clinical practice
Rogers, F. J.
The Journal of the American Osteopathic Association, 2005/05
Free full text

877

Outpatient Osteopathic SOAP Note Form: preliminary results in osteopathic outcomes-based research
Sleszynski, S. L., Glonek, T.
The Journal of the American Osteopathic Association, 2005/04
Free full text

878

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

879

Manipulative treatment of carpal tunnel syndrome: biomechanical and osteopathic intervention to increase the length of the transverse carpal ligament: part 2. Effect of sex differences and manipulative “priming“
Sucher, B. M., Hinrichs, R. N., Welcher, R. L., Quiroz, L. D., St Laurent, B. F., Morrison, B. J.
The Journal of the American Osteopathic Association, 2005/03
Free full text

880

Expanded Spinal Flexion Test: A New Palpatory Tool for LBP Analysis or an Old Test Revisited?
McTurk, P. T., Harding, H. H.
The AAO Journal, 2005/03
Free full text

881

The relationship between palpation of thoracic tissues and deep paraspinal muscle thickness
Fryer, G., Morris, T., Gibbons, P.
International Journal of Osteopathic Medicine, 2005/03

882

Hysteresis as a measure of ankle dysfunction
Cohen, A. M., Mertz, J., Stewart, P., Warner, M. J., Kuchera, M. L.
The Journal of the American Osteopathic Association, 2005/01
Free full text







889

Cranial Manipulation Induces Sequential Changes in Blood Flow Velocity on Demand
Nelson, K. E., Sergueef, N., Glonek, T.
The AAO Journal, 2004/09
Free full text


891

Eliminating tobacco use, a continuing challenge
Allen, T. W.
The Journal of the American Osteopathic Association, 2004/08
Free full text



894

Osteopathie bei Kindern
(Osteopathy in children)
Dijs, P.
DO - Deutsche Zeitschrift für Osteopathie, 2004/05

895

Assessing the ability of medical students to perform osteopathic manipulative treatment techniques
Boulet, J. R., Gimpel, J. R., Dowling, D. J., Finley, M.
The Journal of the American Osteopathic Association, 2004/05
Free full text

896

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text



899

Why are our patients still in pain? Finding a balance in treating patients for nonmalignant pain
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2004/02
Free full text


901

Reflective practice in an osteopathic student clinic: a pilot study
Atkinson, J.
Unpublished MSc thesis, 2004/01
Free full text

902

Accuracy of the OMRON M4 automatic sphygmomanometer
Clarke, A.
Unpublished MSc thesis, 2004/01
Free full text



905

Neuromusculoskeletal Medicine/ OMM: Useful to ALL DOs
van Buskirk, R. L.
The AAO Journal, 2003/12
Free full text


907

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11







914

Emergency medicine resident work productivity and procedural accomplishment
Deveau, J. P., Lorenz, J. E., Hughes, M. J.
The Journal of the American Osteopathic Association, 2003/06
Free full text

915

Evaluating the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, D. O., Errichetti, A. M.
The Journal of the American Osteopathic Association, 2003/06
Free full text

916


917

Using National Medical Care Survey data to validate examination content on a performance-based clinical skills assessment for osteopathic physicians
Boulet, J. R., Gimpel, J. R., Errichetti, A. M., Meoli, F. G.
The Journal of the American Osteopathic Association, 2003/05
Free full text

918

Osteopatia in neonatologia
(Osteopathy in neonatology)
Colli, R., Biagiotti, I., Sterpa, A.
La Pediatria medica e chirurgica : Medical and surgical pediatrics, 2003/03

919

Failure to convince osteopathic medical students of OMT's worth increases risk of subspecialization
Corbett, R. M.
The Journal of the American Osteopathic Association, 2003/02
Free full text

920

Clinical thinking: does your choice of university make a difference?
Harris, M.
Unpublished MSc thesis, 2003/01
Free full text

921

The effect of prophylactic ankle braces on postural sway
Hellyer, D.
Unpublished MSc thesis, 2003/01
Free full text

922

Peak pressure under the forefoot in classical ballet
Mamone, A.
Unpublished MSc thesis, 2003/01
Free full text


924

Sacroiliac joint assessment within the Australian osteopathic profession
Peace, S.
Unpublished MSc thesis, 2003/01
Free full text

925

Osteopathie am Knie: Erfolgreich, wenn nichts half?
(Osteopathy on the knee: Successful when nothing helped?)
Resch, K.L., Schwerla, F.
DO - Deutsche Zeitschrift für Osteopathie, 2003/01

926

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

927

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

928

The effect of cranial manipulation on the Traube-Hering-Mayer oscillation as measured by laser-Doppler flowmetry
Sergueef, N., Nelson, K. E., Glonek, T.
Alternative Therapies in Health and Medicine, 2002/11

929

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text



932

Common Mother-Infant Treatment. A Way to Attachment Security
Kreutz, M.
Unpublished MSc thesis, 2002/10






938

Osteopathy for Back- and Pelvic Pain in Pregnancy
Kofler, G.
Unpublished MSc thesis, 2002/09
Free full text

939

Understanding the Combined Motions of the C3/C4 Vertebral Unit: A Further Look at Fryette's Model of Cervical Biomechanics
Capobianco, J. D., Protopapas, M. G., Rivera-Martinez, S.
The AAO Journal, 2002/09
Free full text

940

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text


942

Effects of osteopathic manipulative treatment and concentric and eccentric maximal-effort exercise on women with multiple sclerosis: a pilot study
Yates, H. A., Vardy, T. C., Kuchera, M. L., Ripley, B. D., Johnson, J. C.
The Journal of the American Osteopathic Association, 2002/05
Free full text


944

The Impact of Osteopathic Manipulative Medicine On Inpatient Outcomes
Klock, G. B.
The AAO Journal, 2002/03
Free full text

945

Improved Pain Score Outcomes Achieved Through The Cooperative And Cost-Effective Use Of Physical (Osteopathic Manipulative) Medicine In The Treatment Of Outpatient Musculoskeletal Complaints
Lipton, J. A., Meneses, P., Martin, J. B., Mizera, A. C., Kappler, R. E., Brooks, J. S., Parr, C.
The AAO Journal, 2002/03
Free full text

946

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

947

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text




951

Leukemia immune changes following massage therapy
Field, T., Cullen, C., Diego, M., Hernandez-Reif, M., Sprinz, P., Beebe, K., Kissell, B., Bango-Sanchez, V.
Journal of Osteopathic Medicine, 2001/10

952

Examining diagnostic tests: An evidence-based perspective
Fritz, J., Wainner, R.
Journal of Osteopathic Medicine, 2001/10


954

The effective forces transmitted by high-speed, low-amplitude thoracic manipulation
Herzog, W., Kats, M., Symons, B.
Journal of Osteopathic Medicine, 2001/10

955



957

Intra-examiner and inter-examiner reliability of a positional diagnostic screen for the lumbar spine
Spring, F., Gibbons, P., Tehan, P.
Journal of Osteopathic Medicine, 2001/10

958

Pain and muscular responses to a neural tissue provocation test in the upper limb
van der Heide, B., Allison, G. T., Zusman, M.
Journal of Osteopathic Medicine, 2001/10


960

Osteopathic treatment in rehabilitation of whiplash injury
Stockinger, V.
Unpublished MSc thesis, 2001/10

961

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text

962

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

963

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text


965

The concept of function in osteopathy and conventional medicine: a comparative study
Tyreman, S. J.
Unpublished PhD thesis, 2001/06
Free full text

966

Inter-examiner reliability of the Johnson and Friedman percussion scan of the thoracic spine
Ghoukassian, M., Nicholls, B., McLaughlin, B.
Journal of Osteopathic Medicine, 2001/04




970

Centralization phenomenon as a prognostic factor for chronic low back pain and disability
Werneke, M., Hart, D. L.
Journal of Osteopathic Medicine, 2001/04


972

Cranial rhythmic impulse related to the Traube-Hering-Mayer oscillation: comparing laser-Doppler flowmetry and palpation
Nelson, K. E., Sergueef, N., Lipinski, C. M., Chapman, A. R., Glonek, T.
The Journal of the American Osteopathic Association, 2001/03
Free full text

973

Electromyographic studies of structural abnormalities. 1941
Denslow, J. S., Clough, G. H.
The Journal of the American Osteopathic Association, 2001/02
Free full text

974

On becoming a doctor
Kelly, M.
The Journal of the American Osteopathic Association, 2001/02
Free full text

975

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

976

Collaboration on research picks up steam
Dyer, M. J., Wood, D. L.
The Journal of the American Osteopathic Association, 2001/01
Free full text

977

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

978

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

979

Managed care education in osteopathic medical schools: development of a fourth-year predoctoral healthcare management clerkship
Riley, C., Adelman, M., Algan, E., Campanella, T.
The Journal of the American Osteopathic Association, 2000/11
Free full text

980

The clinical spectrum of acute coronary syndromes
Rogers, F. J.
The Journal of the American Osteopathic Association, 2000/11
Free full text



983

Muscle energy concepts - a need for change
Fryer, G
Journal of Osteopathic Medicine, 2000/10
Free full text

984

Objectivity and accuracy of mammogram interpretation using the BI-RADS final assessment categories in 40- to 49-year-old women
McKay, C., Hart, C. L., Erbacher, G.
The Journal of the American Osteopathic Association, 2000/10
Free full text


986

Standing flexion test study
Kappler, R. E.
The AAO Journal, 2000/09
Free full text

987

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text



990

The effectiveness of osteopathic manipulative treatment as complementary therapy following surgery: a prospective, match-controlled outcome study
Jarski, R. W., Loniewski, E. G., Williams, J., Bahu, A., Shafinia, S., Gibbs, K., Muller, M.
Alternative Therapies In Health And Medicine, 2000/09

991

Comparison of osteopathic and allopathic results in dementia praecox. 1933
Still, F. M.
The Journal of the American Osteopathic Association, 2000/08
Free full text

992

Increasing osteopathic manipulative treatment skills and confidence through mastery learning
Mann, D. D., Eland, D. C., Patriquin, D. A., Johnson, D. F.
The Journal of the American Osteopathic Association, 2000/05

993

Physical Medicine and Rehabilitation Clinics of North America
Stoll, S. T., Simmons, S. L.
American Journal of Physical Medicine and Rehabilitation, 2000/02


995

Benign prostatic hyperplasia treated with saw palmetto: a literature search and an experimental case study
McPartland, J. M., Pruitt, P. L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

996

Inpatient rehabilitation and manual medicine
Stoll, S. T., Simmons, S. L.
Physical Medicine and Rehabilitation Clinics of North America, 2000/02



999

New England Journal of Medicine article may be misleading about OMT
Coughlin, P., Kriebel, R., Fogel, R.
Journal of Osteopathic Medicine, 1999/11
Free full text



1002

Making a difference: the osteopathic approach lecture series
Danto, J. B., Kavieff, T. R.
Journal of Osteopathic Medicine, 1999/03
Free full text

1003

Standard osteopathic manipulative treatment acutely improves gait performance in patients with Parkinson's disease
Wells, M. R., Giantinoto, S., D'Agate, D., Areman, R. D., Fazzini, E. A., Dowling, D., Bosak, A.
Journal of Osteopathic Medicine, 1999/02
Free full text


1005




1008

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text




 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends