Advanced search



 
 80% of the records
 
 20.0 % of the records
 
 57.8 % of the records
 
   List of keywords

Keywords



*Attitude of Health Personnel*Chiropractic*Complementary Therapies*Diagnosis*Medically Underserved Area*Osteopathic Medicine*Osteopathic Medicine/trends*Palpation*Physical Therapy Modalities*SARS-CoV-2*Schools, Medical18th century19th century19th century history20th century20th century history21st century3 phases test3D digital applications3D models3D-kinematics7-step palpation methodA. carotisA. G. ChilaA. GoldmanA. mesenterica inferiorA. mesenterica superiorA. uterinaA. WalesA.T. StillA.T. StillA.T. Still Research InstituteA.T. Still UniversityA.T. Stills philosophyAACOMAAOAAO convocationabacterial prostatitisabbreviationsabdomenabdominal adhesionsabdominal aortic aneurismabdominal brainabdominal cavityabdominal diaphragmabdominal distensionabdominal massageabdominal painabdominal pump techniqueabdominal scarsabdominal surgeryabdominal traumaabdominal wallabdomino-phrenic dyssynergiaabducens nerveabducens nerve palsyabductionabnormal breathing pattern disordersabnormal positionabnormal reflexabortionAbraham Flexnerabreactionabsenteeismabsolute alpha powerabstractabstractsacademiaacademicacademic backgroundacademic barrieracademic detailingacademic difficultiesacademic entitlementacademic failureacademic health centersacademic health sciences librariesacademic medical centersacademic medicineacademic performanceacademic productivityacademic remediationacademic successacademic supportacademic surgeryacademies and institutesacademy of osteopathyacalculous cholecystitisaccelerometeracceptanceacceptance and commitment therapyacceptance of osteopathyaccessibilityaccidentaccident compensationaccident preventionaccidental fallsaccidentsacclimatisationaccommodationaccommodation spasmaccordaccreditationAccreditation Council for Graduate Medical Educationaccreditation systemaccuracyacetabular indexacetabulumACGMEachievementachilles tendonachilles tendon ruptureachillodyniaacid refluxACLacneacommodative abilityacoustic impedance testsacquired heart defectactiv-perceptive allianceactive inferenceactive knee extensionactive learningactive mandibular testactive mobilityactive mouth openingactive muscle performanceactive releaseactive release techniqueactive straight leg raiseactivities of daily livingactivityactivity of the brainacupunctureacupuncture pointsacupuncture therapyacuteacute ankle injuryacute anterior uveitisacute appendicitisacute cardiopulmonary symptomsacute careacute cerebrovascular accidentacute coronary syndromeacute dental painacute diseaseacute diseasesacute generalized exanthematous pustulosisacute hearing lossacute infectionacute infectious diseaseacute intermittent porphyriaacute knee dislocationsacute knee painacute liver failureacute low back painacute lumbar disc herniationacute myocardial infarctionacute neck painacute nonspecific low back painacute otitis mediaacute painacute respiratory distress syndromeacute respiratory syndromeacute small-bowel pseudo-obstructionadaptive reactionsADDADD/ADHDaddictionaddiction researchAddison’s diseaseaddressadductor magnusadductor strainadenocarcinomaadenomyosisADHDadhesive capsulitisADHSadipose tissueadjacent segment pathologyadjunct therapyadjunctive therapyadjustmentadjuvant chemotherapyadministrative trainingadministratorsadmissionadmission criteriaadmission requirementsadmissionsadolescenceadolescence stageadolescentadolescent healthadolescent idiopathic scoliosisadolescentsadrenal dysfunctionadrenal glandadrenergic systemadultadult learningadultsadvance care planningadvance decisionadvance directiveadvance directivesadvanced degreeadvanced glycation end productsadvanced practice provideradvanced trainingadvancing TBI careadverse childhood experienceadverse childhood experiencesadverse effectadverse effectsadverse eventadverse eventsadversityadvertisingaerobic exercisesaerobicsaestheticsaetiologyaffected facet jointaffective commitmentaffective disorderaffective empathyaffective touchafferenceaffiliationaffirmative actionAfrican Americansafter childbirthageage and gender characteristicsage dependenceage distributionage factorsage trend of changes of spineagedaged 65 and overaged 80 and overaged careageingageusiaagingagopraphobiaagoraphobiaAGRagricultureahesive capsulitisAIAIDSairway functionairway managementairway resistanceajulemic acidAlaskaAlcock canalalcoholalcohol usealcohol use disorderalcoholismalertnessalexythymiaalgomenorrheaalgometeralgometryalgorithmsalkalosisall tissue tension testAllan Phillipsallergic asthmaallergic asthmatic patientsallergiesallergyalliance of potencyallied healthallied health personnelallied health servicesallied healthcareallopathic applicantsallopathic emergency physiciansallopathic medical schoolallopathic medical schoolsallopathic medicineallopathic physicianallopathic physiciansallopathic residency trainingallopathic residentsallopathsallopathyallostasisallostatic loadallostatic regulationalopathic medical educationalopeciaalpha rhythmalpha wave (EEG)alpine skiersALSALSPACALSWHaltered state of consciousnessalternative medical therapiesalternative medicinealternative non-pharmacological therapiesalternative practitioneralternative therapiesalternative treatmentalveolar nerveAlzheimers diseaseAlzheimer’s dementiaAlzheimer’s diseaseamalgam fillingamateur football playerambulance officersambulatory careambulatory care facilitiesambulatory electrocardiographyAMDameliorationAmerican academy of osteopathyAmerican board of medical specialtiesAmerican board of surgeryAmerican Medical AssociationAmerican Osteopathic AssociationAmerican osteopathic board of surgeryAmerican osteopathic professionAmerican Red CrossAmerican School of Osteopathyamitriptylineamniotic fluidamputationamputation defectsamputation of the lower extremitiesamygdalaamyotrophic lateral sclerosisanaerobic performanceanaerobiosisanaesthesiaanal incontinenceanale stage or musculoskelettalanalgesiaanalgesicsanalysis of varianceanalytic decision-making strategyanalytical reasoninganamnesisanastomosisanatomic investigationanatomic landmarkanatomic landmarksanatomic modelsanatomic structuresanatomical landmarksanatomical namesanatomical structureanatomical studyanatomical variationanatomyanatomy educationanatomy facultyanatomy labanatomy,Andean healingandragogyandrogen antagonistsandrogensandrologyanemiaanesthesiaanesthesiological aidanesthesiologyangina pectorisangioedemaangiogenesisangioplastyangle class IIangle classificationangle degreesangle of valgus deviationanhidrosisanimalanimal disease modelsanimal experimentanimal studyanimalsanismusankleankle braceankle disorderankle dorsiflexionankle felxion-extension testankle injuriesankle injuryankle jointankle painankle plantarflexionankle rigidityankle sprainankle sprainsanklesankyloglossiaankylosing pelvospondylitisankylosing spondylitisAnne Walesannouncementanococcygeal ligamentanorexiaanorexia nervosaanosmiaanoxiaANSantenatal careanterior cruciate ligamentanterior cruciate ligament injuryanterior disc displacementanterior pelvic tiltinganterior scaleneanterior temporalisanterolateral ligamentanterolateral mobilityAnthony G. Chilaanthropo-ecological narrativeanthropologyanthropometricsanthroposophyanti-allergic agentsanti-anxiety agentsanti-bacterial agentsanti-infective agentsanti-inflammatoryanti-inflammatory agentsanti-inflammatory cytokinesanti-reflux barrierantiapicalantibiotic agentantibiotic therapyantibiotic useantibioticsantibodiesantibody responseanticholesteremic agentsanticoagulantsantidepressantantidepressant agentantidepressive agentsantidromic activityantiestrogen hormonal treatmentantigen-presenting cellsantihistaminic agentantiinflammatory reflexantimicrobial stewardshipantimicrobial therapyantioxidantsantiparasitic agentantipsychotic agentsantipsychoticsantithrombinsantithrombotic therapyantitumoral treatmentantiviral agentsanusanxietyanxiety disorderanxiety disordersAOAAOA constitutionaortaaortic archaortic diseasesaortic hiatusaortic valveApgar Scoreaphasiaapicalapnoeaaponeurosisaponeurotomyapparent functional leg length differenceappearanceappendectomyappendiceal neoplasmsappendicitisappendixappetiteapplicantsapplicationapplied kinesiologyappointment reminderappraisalsapproachappsaptitudeaptitude testsaquatic osteopathyaquatic therapyaquaticsaqueous humourarachidonic acidsarachnoideaarch of the footarchitectural dynamismarchivalArcticarcuate foramenarea health education centersarea of greatest restrictionArizonaarmarm painaromatherapyarousalarrhythmiaarrythmiaartarterialarterial occlusive diseasesarterial oxygenationarterial pressurearterial spin labelingarteriesarteriosclerosisarteritisarteryarthritisarthrographyarthrogryposis multiplex congenitaarthrokinematicsarthroplastyarthroscopic meniscectomyarthroscopyarthrosisarticlearticulararticular adjustmentarticular balancearticular ligamentsarticular range of motionarticular releasearticular surfacearticular techniquearticular thrust techniquearticulated motionarticulationarticulation loopsarticulation techniquearticulatory techniquearticulatory test foilartifical intelligenceartificial intelligenceartificial jointartificial knee jointartificial respirationartificial ventilationartilcleartsartticleasanaASDaspirationaspirinassessmentassessment of painassessment outcomesassessment platformassessment rubricsassessment scaleassisted reproductive technologyassisted suicideassociated water phaseasthenoptic complaintsasthmaastigmatismastrocytesasymmetric babiesasymmetric postureasymmetrical pelvisasymmetryatherosclerosisathetosisathleteathletesathletic injuriesathletic injuryathletic performanceathletic pubalgiaathletic tapeathleticsatlanto-axialatlanto-axial jointatlanto-axial subluxationatlanto-occipital jointatlanto-occipital junctionatlantoaxial jointatlas adjustmentatlas load bearingatlas medicineatomic emission spectrometryatopic dermatitisatraumatic shoulder painatrial fibrillationatrioventricular blockatrioventricular conductionatrophic scarattachmentattachment theoryattachmentsattempted suicideattendanceattentionattention deficitattention deficit disorderattention deficit disordersattention deficit hyperactivity disorderattention deficit hyperactivity disorder syndromeattention disorder syndromeattentivenessattireattitudeattitude of health personnelattitude to computersattitude to deathattitude to healthattitudesattitudes and beliefsattitudes of primary care providersattrition rateatypical fibroxanthomaatypical swallowingaudiovisual aidsauditory canalauditory channelauditory cuesauditory disorderauditory perception disordersauditory processing disordersauditory vestibular nerveaugmentationaugmented realityauraauricleauscultationAustraliaAustralia and New ZealandAustralian osteopathsAustralian osteopathy studentsAustriaAustrian health marketauthorizationauthorshipautismautism spectrum disordersautistic childrenautistic spectrum disorderautistic spectrum disordersautoaggressionautoantibodiesautobiographyautogenic inhibitionautogenic trainingautoimmuneautoimmune diseaseautoimmune disorderautoimmune myopathyautoimmune rheumatic diseaseautoimmunological thyroiditisautomobile drivingautonomicautonomic dysfunctionautonomic dysfunctionsautonomic nervous systemautonomic nervous system diseasesautonomic nervous system modulationautonomic responesautonomous nervous systemautonomyautophoniaautopoiesisautotransplantavascular necrosisaverage flow rateaviationavoidanceawake bruxismawardawards and prizesawarenessawareness of spaceaxesaxial cervical rotationaxial processaxial rotationaxial spondyloarthritisaxillary nerve paresisaxisaxonal transportazithromycinazygos veinAzythromycinB-lymphocytesB. ArbuckleB. Hartwigbabiesbabies approachbabybaby ambulancesbaby talkBach remediesbackback beliefsback injuriesback painback pain mythsback pain scaleback thermogramback-laying positionback-related disabilitybackground musicbackpacksbacteriabacterial infectionsbacterial spreedingbacterial translocationbacterium colonybaffling medical disordersbalancebalance disordersbalance ligamentous tensionbalance testbalance-testbalance-treatment conceptBalanced Emotional Empathy Scalebalanced fascial tensionbalanced fluid interchangebalanced ligamentous techniquebalanced ligamentous techniquebalanced ligamentous tensionbalanced ligamentous tensionbalanced membranous tensionbalanced tensionbalancing ligamentous tensionbalancing testbalint groupsballetballet dancersballoon angioplastybalneologybankruptcyBAObarefoot trainingbariatric surgerybaropodometrybarrier conceptbarriersbarriers and facilitatorsbasal cell carcinomabaseballbaseline studybasic sciencebasic sciencesbasic system of PischingerbasketballBDOÄBeckerBecker approachBecker techniquebedwettingbehaviorbehavior changebehavior therapybehavioral medicinebehavioral risk factor surveillance systembehavioral therapybehavioural symptomsbehavioural therapybelchingBelgiumbeliefsbeliefs and attitudesBEMER therapybenchmarkingbenign hair follicle tumorsbenign paroxysmal positional vertigobenign pelvic tumorbenign prostate enlargementbenign prostate syndromebenign prostatic hyperplasiaberberineBertolotti syndromebest practicebeta-endorphinbetacoronavirusbezoarsbiasbibliographic databasebibliographic databasesbibliographybibliometric analysisbibliometric reviewbibliometricsbibliotherapybifocal integrationbilaminar zonebilateral blood pressure measurementbiliarybiliary dyskinesiabiliary painbiliary tract diseasesbilirubin levelsBill Wyattbillingbinge drinkingbinocular visionbio compatibilitybio cybernetic connectionsbio-electro-magnetic energy regulationbio-electromagnetic energy regulationbio-energeticbio-psycho-social model of diseasebiochemicsbiochemistrybiodynamicbiodynamic modelbiodynamic osteopathybiodynamic treatmentbiodynamicsbioelectric activitybioelectrical activitybioenergetic modelbioenergetic osteopathybioenergy healersbioengineeringbioethicsbioethics and professional ethicsbiofeedbackbiogenbiographybioinformaticsbiological assaybiological effectsbiological evolutionbiological modelsbiological oscillationbiological rhythmbiological science disciplinesbiological transportbiologybiomarkersbiomechanicbiomechanic regulatorsbiomechanical analysisbiomechanical breathing dysfunctionbiomechanical disordersbiomechanical dysfunctionbiomechanical indicatorsbiomechanical modelbiomechanical modelingbiomechanical phenomenabiomechanicsbiomechanics sacroiliac jointbiomedicalbiomedical principlesbiomedical researchbiomedical research conceptsbiomedical sciencebiomedical studiesbiomedical technologybiomedicalismbiomedicinebionatorbiophotonic emissionbiophysical phenomenabiophysicsbiopsybiopsychosocialbiopsychosocial approachbiopsychosocial environmentbiopsychosocial factorsbiopsychosocial modelbiopsychosocial modelsbiopsychosocial outcomebiopsychosocial rehabilitationbioreductionismbiorhythmsbiosocialbiostatisticsbiotensegritybioterrorismbipartate patellabipolar disorderBircher-Bennerbirthbirth complicationbirth complicationsbirth defectsbirth processbirth traumabirth weightblack menbladderbladder augmentationbladder disorderbladder dysfunctionbladder massbladder outlet obstructionbladder pain syndromebladder weaknessbladder-trainingBlagrave procedureblast injuryBlechschmidtbleeding gumsblended learningblinded trialsblindingblinding healthcare providersblinding methodsblinding observersblinding patientsblink reflexblinking reflexblisterblisteringblistersbloatingblocadesblockchainblockingbloodblood cell countblood cellsblood circulationblood flowblood flow disordersblood flow velocityblood gas analysisblood glucoseblood lactateblood lactate levelblood memorial lectureblood oxygen saturationblood pressureblood pressure determinationblood pressure monitorblood pressure regulationblood sugarblood supplyblood systemblood transfusionblood vesselsblood volumeblood volume synchronizationblood-brain barrierblood-brain barrierbloodlettingBLTblue ocean strategyblunt eye traumaBMIBMTBMT techniqueBNT162 vaccineboard certificationboard examinationsboardsbodily existencebodily functional unitybodybody adjustmentbody and mindbody awarenessbody compositionbody conceptbody fluidsbody functional statusbody languagebody massbody mass indexbody perceptionbody positionbody posturebody psychotherapybody region silosbody representationbody schemabody sensationsbody unitbody weightbody-mind interdependencebody-mind-spiritbodyplethysmographybodyworkBohemiabonebone bruisebone cancerbone densitybone developmentbone diseasebone diseasesbone formationbone fracturesbone growthbone lossbone marrow edemabone marrow oedema syndromebone metastasesbone mineral densitybone remodelingbone resorptionbone tissuebone transplantationbone treatment principlesbonesbones landmarksbonesetterbony integrationbookbook excerptbook reviewbookletsBoolean logicborborygmusBoston carpal tunnel questionnairebottle feedingbotulinum toxinsBouba/Kiki effectbowelbowel complaintbowel diseasebowel functionbowel movementsbowel obstructionbowel preparationbowel resectionBowen techniqueboyBPbracesbrachial plexusbrachial plexus compressionbrachial plexus neuritisbrachial plexus neuropathiesbrachialgiabrachycephalusbrachycephalyBradford Hillbrainbrain activitybrain concussionbrain connectivitybrain curriculumbrain damagebrain drainagebrain functional connectivitybrain gut axisbrain inflammationbrain injuriesbrain injurybrain networksbrain physiologybrain structurebrain tumorbrain vascular systembrain wavesbrain-derived neurotropic factorbrainwavesbrandbrand disputebrandingBrazilbreastbreast anatomybreast cancerbreast examinationbreast gland tissuebreast neoplasmsbreast surgerybreast-feedingbreastbonebreastfeedingbreastfeedingbreastfeeding difficultiesbreastfeeding difficultybreath of lifebreathingbreathing and relaxation exercisesbreathing assessmentbreathing disordersbreathing dysfunctionbreathing exercisebreathing exercisesbreathing frequencebreathing frequencybreathing patternbreathing pattern disorderbreathing pattern disordersbreathing patternsbreathing retrainingbreathing symptom questionnairebreathing techniquebreathing therapybreech presentationbrief psychotherapyBrighton criteriaBritish College of Osteopathic MedicineBritish osteopathic professionBritish School of Osteopathybroadistsbronchial asthmabronchiectasisbronchiolitisbronchitisbronchopericardial membraneBronfortBrowning–Parks ScalebruxismBuddhismbudgetsbulimiabullous lesionsbullous pemphigoidbuprenorphineburdened anamnesisburn outburning mouth syndromeburning painburnoutburnout syndromebursitisbursitis trochantericabuttock painbuttocksbypassC-reactive proteinc-sectionC-tactileC-tactile afferentsC. BauerC. BowlesC. DoveC. G. BeckwithC. J. Smutny IIIC. S. GonsteadC. SchwartzkopfC. SteeleC. WeaverC1C3CABGcability crisiscadavercadaver dissectioncadaveric dissectioncadaveric simulationcadmiumcaecumcaesarean sectioncafe stillpointcalcaneal apophysitiscalcaneal spurcalcific tendinopathycalcific tendonitiscalcificationcalciphylaxiscalciumcalfcalibration protocolCaliforniacaloric restrictioncalot’s triangleCAMCamerooncampus environmentCanadaCanadiancanal syndromecancellationcancercancer controlcancer paincancer patientcancer preventioncancer rehabilitationcancer screeningcancer survivorscancer treatmentcandlenutcannabinoid receptor cb2cannabinoid receptor modulatorscannabinoid receptorscannabinoidsCannabiscapabilitiescapabilitycapacitycapital financingcapsular ligamentous apparatuscapsular tissuecaptioningcarbon dioxidecarbon emissionscarcinogenscarcinoid tumorcarcinomacardiac arrestcardiac controlcardiac frequencycardiac implantable electronic devicecardiac implantable electronic devicescardiac ischemiacardiac outputcardiac patient managementcardiac rehabiliationcardiac rehabilitationcardiac skeletoncardiac surgerycardiac transplantationcardiogenic shockcardiologycardiopulmonary functioncardiothoracic surgerycardiovagal tonecardiovascular complicationscardiovascular diseasecardiovascular diseasescardiovascular disorderscardiovascular functioncardiovascular healthcardiovascular implantable electronic devicescardiovascular physiological phenomenacardiovascular pulsationscardiovascular responsecardiovascular stresscardiovascular symptomscardiovascular systemcardiovascular trainingcardiovascular-related deathcare modelcareer choicecaregiverscariesCarl Jungcarotid arteriescarotid arterycarotid artery diseasescarotid endarterectomycarotid stenosiscarpal bonescarpal canal syndromecarpal tunnel syndromecartesian objectivismcartilagecartilage tissuecartilago cricoideacartilago thyroideacase control studycase historycase managementcase of liabilitycase presentationcase reportcase reportscase seriescase studycase-based learningcase-control studyCastillo MoralesCatalystcataractcatechol-O-methyltransferase (COMT)cauda equina syndromecausalitycausationcause and effectcause-specific treatmentcavernous sinuscavitationCCD-angleCD4 countceasarean deliveriesceasarean scarsceasarean section deliveryceasarian sectioncecumceliac artery compression syndromeceliac diseaseceliac plexuscellcell culture techniquescell memorycell microenvironmentcell movementcell phenotypecell proliferationcellscellular agingcellular cooperationcellular memorycellular pathologycellular respirationcengancer patientcenter of pressurecenter of rotationcentralcentral canalcentral chaincentral diabetes insipiduscentral nervous diseasecentral nervous systemcentral nervous system diseasescentral nervous system disordercentral neurological disorderscentral organisationcentral regulationcentral sensitizationcentralizationcentre of coordinationcentre of foot pressurecephalalgiacephalgiacephalohematomacerebellar diseasescerebellopontine anglecerebral angiographycerebral blood flowcerebral bloodflowcerebral cavernous malformationcerebral hemodynamicscerebral oxygenationcerebral palsycerebral ventriclescerebrospinal fluidcerebrospinal fluid biomarkerscerebrospinal fluid motioncerebrospinal venous systemcerebrovascular circulationcerebrovascular systemcerebrumceremonial behaviorcertainty of perceptioncertificationcervicalcervical cancercervical cancer ratescervical cordcervical disc herniationcervical dysfunctioncervical dystoniacervical ependymomacervical facetcervical facet joint mobilizationcervical flexibilitycervical flexion trainingcervical instabilitycervical joint dysfunctioncervical lymphadenitiscervical manipulationcervical mobilisationcervical mobilitycervical muscular tensioncervical paincervical pain syndromecervical radiculopathycervical range of motioncervical ribcervical rib syndromecervical ribscervical spinecervical spine dysfunctioncervical spine syndromecervical spondylosiscervical subluxationcervical sustained natural apophyseal glidescervical syndromecervical techniquescervical treatmentcervical vertebraecervicalgiacervico-oral synergiescervicobrachialgiacervicocranialgiacervicogenic headachecervicogenic vertigocervicothoracic diaphragmcervicothoracic junctioncervicothoracic manipulationcervicothoracic paincervicotrigeminal convergencecesarean section scarsCFL injuriesCFSchain dysfunctionchallengeschangechange managementchange of lifechanges of pregnancychanges of spinechaoschaperoneChapman pointsChapman reflexChapman reflex pointChapman reflex pointsChapmans pointChapman’s pointsChapman’s reflexesCharcot-Marie-Tooth syndromeCharlotte WeaverChatGPTchecklistchemokineschemonucleolysischemopreventionchemotherapychestchest expansionchest painchest wallchest wall asymmetrychest wall compressionchest wall defectchest wall expansionchewingChiari I malformationChiari malformationChicagoChicago College of Osteopathic MedicineChicago techniquechief residentChikungunya feverchildchild abusechild abuse, neglectchild birthchild developmentchild health expertschild osteopathychild protectionchild psychiatrychildbearingchildbedchildbirthchildhoodchildhood cancerchildhood developmentchildhood diseaseschildhood experienceschildhood injurychildhood obesitychildhood pneumoniachildrenchildren at riskchildren in needChinaChinese herbal drugsChinese immigrant communityChinese manipulative therapychinese medicinechinese traditional medicinechiropracticchiropractic carechiropractic decompressionchiropractic manipulationchiropractic methodschiropractic researchchiropracticschiropractorchiropractorschocolatechoice behaviorchoice of interventionschoirchokingcholecystectomycholesterolcholesterol levelcholinergic pathwaycholinergic systemchondrocraniumchoroid plexuschristianitychronicchronic adenoiditischronic back painchronic bronchitischronic cervical painchronic conditionschronic constipationchronic coughchronic diseasechronic disease managementchronic diseaseschronic diseases of the lower extremity veinschronic dry coughchronic fatigue syndromechronic functional constipationchronic gastritischronic headachechronic heart failurechronic illnesschronic inflammationchronic inflammatory demyelinating polyneuropathychronic inflammatory diseasechronic inflammatory diseaseschronic kidney diseasechronic kidney failurechronic knee painchronic lateral epicondylitischronic low back painchronic lower back painchronic lymphocytic leukemiachronic migrainechronic neck painchronic non-specific low back painchronic non-specific neck painchronic noncancerous painchronic nonspecific low back painchronic obstructive and restrictive pulmonary diseasechronic obstructive lung diseasechronic obstructive pulmonary diseasechronic painchronic pain managementchronic pain sifferschronic pain syndromchronic pain syndromeschronic pelvic painchronic pelvic pain syndromchronic pelvic pain syndromchronic pelvic pain syndromechronic persistent gait dysfunctionchronic prostatitischronic pyelonephritischronic regional pain syndromechronic rhino sinusitischronic scrotal painchronic shoulder painchronic sinusitischronic spinal painchronic symptomschronic tension headachechronic tension-type headachechronic testicular painchronic thoracic painchronic trapezius myalgiachronic traumatic encephalopathychronic unspecific neck painchronic venous insufficiencychronic visceral painchronic widespread painchronic woundschronical bladder troublechronical headachechronicitychronificationcicatriceCIEDCinahlcinical competencecircadiancircadian rhythmcirculationcircumventricular organscisnormativitycitationcitespacecivic-mindednesscivil liability legislationclassic massageclassical osteoapthic field theoryclassical osteopathic medicineclassificationclassroomclavicleclavicle fractureclavicular dysfunctionCLBPclearance-fittedcleft jawcleft lipcleft lip and palatecleft palateclenchingclerkshipclerkship yearsclimacteric complaintsclimacteric syndromeclimateclimate changeclimberclimbersclimbingclincal educationclincal trialclinicClinic for Manual Therapyclinica trialclinical anatomyclinical articleclinical assessmentclinical assessment programclinical auditclinical benefitclinical capabilitiesclinical clerkshipclinical clerkshipclinical competenceclinical competence examinationclinical decision makingclinical decision-makingclinical educationclinical educatorclinical educatorsclinical effectivenessclinical efficacyclinical enzyme testsclinical ethicsclinical evaluationclinical evidenceclinical examinationclinical experienceclinical expertiseclinical expertsclinical guidanceclinical guidelineclinical guidelinesclinical hypnosisclinical imageclinical imagesclinical learningclinical medicineclinical neurodynamicsclinical osteopathic practiceclinical outcomeclinical outcomesclinical practiceclinical practice guidelinesclinical prediction ruleclinical protocolsclinical reasoningclinical recordsclinical relevanceclinical researchclinical resoningclinical rotationclinical significanceclinical skillsclinical skills curriculumclinical studiesclinical teacherclinical teachingclinical testingclinical testsclinical trainingclinical trialclinical trial methodsclinical trial registryclinical trialsclinical trials as topicclinical uncertaintyclinical useclinical utilityclinical workplaceclinical-electroneurophysiological examinationcliniciansclivusclosed-head injuryclothesclub-head velocityClubfootcluneal nervescluster headacheCMDCMSCMTCMT-SCSCNSCNS maturityco-operationco-pathologiescoachesCobb anglecoccydyniacoccygodyniacoccyxcochlear implantcochlear implantationCochraneCochrane back and neck groupCochrane LibraryCochrane reviewcodes of ethicscodrivercoeliac trunkcognitioncognitive abilitycognitive behavioral therapycognitive decisioncognitive declinecognitive distortionscognitive dysfunctioncognitive easecognitive empathycognitive evaluationcognitive impairmentcognitive latencycognitive learningcognitive processescognitive processingcognitive-load theorycoherencecohortcohort analysiscohort studiescohort studycoitusCOL4A1colchicinecold applicationcold temperaturecold therapycoliccolitiscolitis ulcerosacollaborationcollagencollagen fiberscollarbonecollegecollege admissioncollege admission testcollege athletescollege athletscollege of osteopathic medicinecollege sportscollegescolleges of osteopathic medicinecollegiate sportsColombiacoloncolon cancercolon resectioncolonic diseasescolonoscopyColoradocolorectal cancercolorectal endometriosiscomaCOMATcomatose patientscombat medicscombat veteranscombined lever-techniquecombined MET approachcombined modality therapyCOMEcoming outCOMLEXCOMLEX Level 1comlex-usacommentcommentarycommentsCommission on Osteopathic College Accreditationcommitmentcommitteecommon coldcommon compensatory patterncommotio cerebricommunicationcommunication assessment toolcommunication barrierscommunication skillscommunication skills developmentcommunication stylecommunitycommunity carecommunity health centerscommunity health planningcommunity health servicesCommunity Health Services/*organization & administrationcommunity hospitalscomorbiditiescomorbiditycomparabilitycomparative effectivenesscomparative effectiveness researchcomparisonCOMPASScompassioncompensationcompensation claimscompensatory patterncompensatory patternscompetencecompetenciescompetencycompetency assessmentcompetency based medical educationcompetency-Based educationcompetency-based trainingcompetitive behaviorcomplaintscomplaints during pregnancycomplement system proteinscomplementary therapiescomplementary alternative medicinecomplementary and alternative medicinecomplementary and alternative treatmentcomplementary and integrative medicinecomplementary healthcomplementary healthcarecomplementary integrative healthcomplementary integrative medicinecomplementary medicinecomplementary therapiesComplementary Therapies/*methods/standardscomplementary therapycomplex regional pain syndromecomplex systemscomplex systems theorycomplex therapycomplex treatmentCOMPLEX-USAcompliancecomplicated lesioncomplicationcomplicationscomplications to manipulationcomponents of somatic dysfunctioncomposite testscomprehensioncomprehensivecomprehensive health carecomprehensive osteopathic medical licensing examinationcomprehensivenesscompressioncompression and extension arrayscompression of fourth ventriclecompulsionscompulsory vaccinationcomputed tomographycomputer simulationcomputer stabilometrycomputer systemscomputer tomographycomputer vision syndromecomputer-assisted clinical casecomputer-assisted instructioncomputer-assisted learningcomputer-assisted radiographic image interpretationcomputer-based learningcomputersCOMSAEconcatenation syndromeconcatenationsconcentrationconceptconcept developmentconceptsconceptual frameworkconceptual modelconceptualizationconcernsconcussionconcussion symptomsconditionally healthy peopleconditions of the far northconductive hearing losscondylar compressioncondylar decompression techniquecondylomata acuminataconferenceconference abstractconference abstractsconfidenceconfidence intervalconfidence intervalsconfidentialityconflictconflict of interestconfrontation phaseconfusioncongenitalcongenital dysplasia of the hipcongenital heart defectcongenital infantile torticolliscongenital lung cystcongenital muscular torticolliscongenital myasthenic syndromecongenital talipes equinovaruscongestive heart failurecongestive menstrual paincongressconjointnessconjunctivitisconnection ligamentconnective systemconnective tissueconnective tissue dysplasiaconnectomeConners Scalaconscientious objectionconscious sedationconsciousnessconsensusconsentconseptual modelsconservative finger therapyconservative treatmentconsortCONSORT statementconstant murley scoreconstipationconstitution and bylawsconstruct validityconstructivismconsultationconsultation rateconsultationsconsumer behaviorconsumer expectationscontact-based educationcontact-modulationcontent analysiscontent analysis of osteopathic curriculacontent validitycontergancontext factorscontextual effectscontextual factorscontinental population groupscontinuing educationcontinuing medical educationcontinuing professional developmentcontinuity of patient carecontinuity of the bodycontinuum distortioncontinuum techniquecontol interventionscontraceptioncontraceptive carecontract governing medical treatmentcontractilitycontractioncontractionscontractscontraindicationcontraindicationscontrol interventionscontrol systemscontrolled clinical studycontrolled clinical trialcontrolled studycontrolled substancescontusio bulbiconvectionconvenience sampleconventional medicineconventional therapyconversation techniquescoolingcooperationcooperation of doctors with osteopathscooperative behaviorcooperative learningCOPDCOPD Assessment Testcopingcoping behaviorCoPPScopyrightcore competenciescore stabilitycorneacorona viruscoronary artery bypasscoronary artery bypass graftcoronary artery bypass graft surgerycoronary artery diseasecoronary blood vesselcoronary circulationcoronary diseasecoronary thrombosiscoronaviruscoronavirus 2coronavirus disease 2019coronavirus infectioncoronavirus pandemiccorporealitycorrective exercisecorrective orthodonticscorrelationcorrespondenceCORTECS reportcorticoid injectioncorticoidscorticosteroidcorticosteroid injectioncorticosteroidscorticotropin-releasing hormonecortisolcortisol levelcortisonecosmologycostcost allocationcost analysiscost benefit analysiscost controlcost effectivecost effectivenesscost effectiveness analysiscost of illnesscost of matriculationcost of treatmentcost savingscost utility analysiscost-benefit analysiscost-effectivenesscost-effectivness-analysiscost-related nonadherence to medical carecost-utilityCosta Ricacostal cartilagescostochondritiscostoclavicular maneuvercostotransverse jointscostscosts and cost analysiscoughcounselingcounter-transferencecounterstain and METcounterstraincounterstrain techniquescountriescoupled movementscourse of birthcourse of pregnancycoursescourseworkcourt casecourt decisionCovid-19COVID-19 boosterCOVID-19 fatigueCOVID-19 pandemicCovid-19 prosectioncovid-19 vaccinationCOVID-19 vaccinecovid-19 vaccinescoxalgiacoxarthritiscoxarthrosisCPPSCRAFTA conceptcraftscrampscranialcranial asymmetriescranial asymmetrycranial basecranial base releasecranial base straincranial bonecranial bone mobilitycranial bonescranial conceptcranial deformationcranial deformationscranial deformitiescranial deformitycranial diagnostic methodcranial dysfunctioncranial dysmorphycranial dystoniacranial field osteopathycranial growthcranial manipulationcranial manipulative treatmentcranial membranecranial mobilitycranial morphologycranial motioncranial movementcranial nervecranial nervescranial osteopathic manipulationcranial osteopathic treatmentcranial osteopathycranial palpation pressurecranial rhythmcranial rhythm frequencycranial rhythm impulsecranial rhythmic impulsecranial roofcranial straincranial strain patternscranial suturecranial suturescranial synchondrosescranial techniquecranial therapycranial vault holdcranial venous drainagecranial volumecranial-sacral-motioncraniocranio sacral motioncranio sacral osteopathycranio-caudalcranio-cerebral traumacranio-cervical flexion testcranio-cervical musclescranio-mandibular disorderscranio-sacral osteopathycranio-sacral osteopathycranio-sacral outflowcranio-sacral pulsationscranio-sacral rhythmcranio-sacral rhythmcranio-sacral systemcranio-sacral techniquecranio-sacral therapycraniofacialcraniofacial developmentcraniofacial dysmorphismcraniofacial paincraniomandibular complexcraniomandibular disorderscraniomandibular dysfunctioncraniomandibular dysfunctionscraniomandibular paincraniomandibular systemcraniomanibular systemcranioplastycraniosynostosiscraniotomycraniovertebralcraniumcreatine kinasecreationismcreative expressioncreativitycredentialingcredentialscreepcremaster veinsCRICRI ratecricketcrimecriteria for the typology of the statics of the spinecritical access hospitalscritical appraisalcritical carecritical reviewcritical theorycriticism of scientific basis of osteopathyCrohn diseaseCrohns diseaseCrohn’s diseasecross over studycross sectional studiescross sectional studycross sectional surveycross-over studiescross-over studycross-sectional areacross-sectional studiescross-sectional studycross-sectional surveycrossbitecrossed legscrossed-helixcrossover studycrowsCRPScruciate ligamentcryingcrying attackscrying infantscryotherapyCSF-mobilityCSTctCT scansCT-guided periradicular infiltrationCTECTScubital tunnel syndromeculinary medicineculpitiscultural competencecultural competencycultural competency trainingcultural disparitycultural evolutioncultural sensitivityculturally competent careculturally integrated educationculturally sensitive carecultureculture techniquescultured cellscumulative trauma disorderscuringcurrent health care structurecurriculacurricular reformcurriculumcurvescurvimeter-goniometercutaneous diseasescutaneous nerve entrapment syndromecutaneous t-cell lymphomaCV-4CV-4 techniqueCV4CV4 techniqueCVHcybernetic systemcyberneticscyclescynefin frameworkcystadenocarcinomacystic arterycystic fibrosiscystic trianglecystoscopycytokinecytokinescytologycytoskeletonD. D. PalmerD. EhrlichD. HerbertD. J. ClauwD. LuthinD.O. thesisdacryostenosisdaily routinedamaging factorsdancedancingdatadata analysisdata collectiondata collection formdata collection toolsdata correlationdata protectiondatabasedatabasesDatabases as TopicDatabases, Bibliographic/*standardsDavener’s dermatosisDavid S. FestingerDavid Sackettdaytime sleepinessDDL LorenzinDe Kleyn testde lege ferendade lege latade Quervain syndromedeafnessdeath and euthanasiaDeath With Dignity Actdebatedebtdebt and loan forgivenessdeceptiondecernmentdecision makingdecision making processdecision-makingdecision-making processdecompressiondeconditioningDEDdeep fasciadeep gluteal syndromedeep infiltrating endometriosisdeep musclesdeep posterior sacrococcygeal ligamentdeep transverse friction massagedeep transverse muscledefecationdefense behaviourdefense cascadedefense reactiondefense reactionsdefensive behaviordeficienciesdefinitiondeformational plagiocephalydegenerationdegenerative cervical myelopathydegenerative spinal conditionsdegenerative spine diseasedeglutition disordersdegreesdehydrationdelayed developmentdelayed speechdeliriumdeliverydelivery of health caredelphi consensusdelphi methoddelphi studydelphi techniquedeltoiddementiademographicsdemographydemoscopic surveydendritic celldendritic cellsdensdental caredental dysfunctiondental educationdental extractiondental occlusiondental paindental prothesisdental schoolsdental splintdental splint therapydentationdentistdentistrydentistsdentofacial systemdependant variabledepersonalizationdepressiondepressive disorderdepth psychologydermal blood flowdermascopedermatitisdermatofibrosarcoma protuberansdermatologicdermatological diseasesdermatologydermatology programsdermatoloydermatomesdermatomyositisdescension of the hard palatedescensus genitalisdescriptive studydescuajedesire for childrendesmocraniumdesmopressindesynchronosisdetection biasDeutsches Ärzteblattdeveloping countriesdevelopmentdevelopment of movementdevelopment supportdevelopmental diagnosticsdevelopmental dynamicsdevelopmental psychologydevelopmental testsdextrose prolotherapyDGKODGOMDGSdiabetesdiabetes complicationsdiabetes mellitusdiabetes mellitus type 2diabetes mellitus type Idiabetes-related distressdiabetic angiopathiesdiabetic ketoacidosisdiabetic late complicationsdiagnosingdiagnosisdiagnosis and treatmentdiagnosticdiagnostic accuracydiagnostic approachdiagnostic errorsdiagnostic guidelinesdiagnostic imagingdiagnostic judgementsdiagnostic methoddiagnostic palpationdiagnostic reasoningdiagnostic techniquesdiagnostic techniques and proceduresdiagnostic testsdiagnostic touchdiagnosticsdialogdiametral contradictionsdiapersdiaphragmdiaphragm fatiguediaphragm interventiondiaphragm strengthdiaphragm techniquediaphragm testdiaphragmadiaphragma thoracalediaphragma urogenitalediaphragma, venous systemdiaphragmatic releasediaphragmsdiarrheadiarydiastasis recti abdominisdiastasis rectus abdominisdiastolic arterial pressurediastolic blood pressurediastolic heart failuredicycloverinedidacticsDiers 4-Ddietdietarydietary habitsdietary supplementsdifferential diagnosisdifferential diagnosticsdifferentiated neurological diagnosticsdiffuse idiopathic skeletal hyperostosis syndromedigestiondigestive systemdigestive tractdigital caredigital healthdigital imagedigital mediadigital worldDIMDI-Studydimensional modeldimensions of breathing sensationdimethyl mercurydiplomaDiprospandirect cranial techniquesdirect manipulationdirective counselingdirectorydisabilitiesdisabilitydisability evaluationdisabled childrendisabled personsdisaster medicinedisaster planningdisaster reliefdisastersdisc degenerationdisc diseasedisc disordersdisc displacementdisc herniationdisc prolapsediscal herniadisciplinary actiondisclosurediscogenic SI radiculopathydiscoursediscourse-analysisdiscriminationdiscus luxationdiscussiondiseasedisease definitiondisease exacerbationdisease outbreaksdisease preventiondisease progressiondisease severitydisengagement-techniquedisinfectiondisinfection protocoldisinfection protocolsdisk herniationdisk prolapsediskussiondislocated acromioclavicular jointdislocation reductiondismissaldisplacementdissectiondisseminationdissertationdissipative medicinedissipative structuresdissociationdissolutiondistal arthrogryposisdistal intestinal obstructive syndromedistal latencydistal radius fracturedistal radius fracturesdistancedistance educationdistance learningdistinctiondistinctivenessdistractiondistressdisturbance in central coordination in infancydistusion functionsdiurnal profilediversitydivine naturedizzinessdizziness handicap inventoryDO studentsDO thesisDO-Touch.netdoctor of medicineDoctor of Osteopathic Medicinedoctor of osteopathydoctors for individual vaccination decisiondoctors of medicinedoctors of osteopathic medicinedocumentdocument managementdocumentationdogdog techniquedogsdolescentdomestic abusedomestic violencedominant lesiondoming diaphragmdopaminedopamine homeostasisdopplerdoppler sonographyDoppler-ultrasounddorsal sacral ramidorsalgiadorsiflexiondorsopathydose responsedose-responsedouble crush syndromedouble-blind methodDown syndromeDowney Regional Medical Center (DRMC)downing testDRAdrainagedrainage of bile secretionsDREEMdrinking disorderdroolingdrop footdropoutsdrugdrug and narcotic controldrug combinationdrug industrydrug legislationdrug prescriptionsdrug reactiondrug researchdrug safetydrug therapydrug utilizationdrug-free childbirthdrug-related side effectsdrugsdry eye diseasedry needlingdual process theorydually accredited programsDuchenne muscular dystrophyDunbar syndromeDunning-Kruger effectduodenal diseasesduodenojejunal junctionduodenumdupilumabDupuytren contracturedura materdura mater spinalisdural membranedural nerve sheathdural sinusduration of deliveryduration of infertilitydurometerduty of candourduty of careduty to informdynamic balancedynamic stillnessdynamic strain vectordynamic strain-vector releasedynamicsdynamometerdysafferentationdysarthriadysautonomiadysbiosisdyscalculiadysesthesiadysfunctiondysfunction of regulationdysfunctional breathingdysfunctional suckdysfunctionsdysgnathiadysgnathia patientdyskinesiadyslaliadyslexiadyslipidemiadyslipidemiasdysmenorrheadysmenorrhoeadysosmiadyspareuniadyspepsiadysphagiadysphagia lusoriadysphoniadysplasiadyspneadyspnea on exertiondyspnoeadyssomniasdyssynergic defecationdysthymiadystociae-cigarettee-cigarettese-consultatione-learninge-smokingE. CayceE. CloetE. LedermanE. M. LayE. Mayer-FallyE. MöckelE. StilesE. Swedenborgear diseasesear painear symptomseardrumearly childhood developmentearly childhood regulation disorderearly childhood stressearly clinical diagnosticsearly interventionearly recognitionearly therapyease-disease-continuumeastern europeanEastern medicine systemseating disordereating disordersEBMEBPechinaceaecological nicheeconomic analysiseconomic competitioneconomic evaluationeconomicsEcoute-testectodermectodermal ringectopic pregnancyEcuadorecuteeczemaedemaEden testedge light pupil cycle timeEdinburgh Postnatal Depression Scaleeditorialeditorial boardeditorial policiesedmentiaEdmonton Symptom Assessment Systemeducationeducation medicaleducation departmenteducation programEducation, Medical, GraduateEducation, Medical, Graduate/*methodseducationaleducational approacheducational backgroundeducational brochureeducational debteducational guidelineseducational interventioneducational measurementeducational modeleducational modelseducational modeseducational moduleeducational possibilitieseducational reformeducational resourceeducational standardseducational statuseducational supporteducational technologyeducational toolseducational valueeducational videoseducatorsEdward Via College of Osteopathic MedicineEEGef?ciencyef?ciencyef?ciencyef?ciencyef?ciencyeffectivenesseffectiveness trialeffectiveness,effectseffects of OMTefficacyefficacy paradoxefficacy researchefficiencyeffiency of treatmentehealthEhlers Danlos syndromeehlers-danlos syndromeEHP-30EHRelastic open aktivatorelastic weight-bearing elementselasticityelasticity of tissueselastographyelbowelbow joint painelbow painelbow stiffnesselderlyelderly patientselderly populationelective surgeryelectrical activityelectrical activity of the skinelectrical impulseselectrical stimulationelectrocardiogramelectrocardiogramselectrocardiographyelectrocortical correlateselectrodermal activityelectrodiagnosiselectroencephalographyelectrogastrographyelectromagnetic activityelectromagnetic fieldselectromagnetic interactionelectromagnetic stimulationelectromyogramelectromyographicelectromyographic (EMG)electromyographic activityelectromyographic patternselectromyographyelectron-donor activityelectroneurophysiological researchelectronic cigaretteelectronic data processingelectronic deviceselectronic health recordelectronic health researchelectronic medical recordselectropunctural diagnosticselectrostimulationelectrotherapyelementary schoolelementsElisabeth Kübler-Rosselite athletesELPCTEmbaseembodied cognitionembodied learningembodimentembryoembryological axisembryological developmentembryological developmental movementsembryologyembryonic developmentemergency departmentemergency medical servicesemergency medicineemergency respondersemergency serviceemergency treatmentEMGEMG median frequencyemigration and immigrationemotinal stressemotionemotional competenceemotional exhaustionemotional healthemotional integrationemotional intelligenceemotional processingEmotional Processing Scaleemotional regulationemotional stimulus processing systememotional wellbeingemotionsempathic skillsempathyemphysemaempirical approachempirical evidenceempirical knowledgeempirical researchempiricismemployee disciplineemployeesemploymentemployment disabilityemu oilenactivismencephalomyelitisencopresisend-of-life careendfeelendocannabinoid systemendocannabinoidsendocardiumendocrineendocrine systemendocrine system diseaseendocrinologyendogenetic and exogenetic rhythmendogenous compoundendometriosisendometriosis genitalis internaendometriumendoscopic discomfortendoscopic retrograde cholangiopancreatographyendothelial dysfunctionendothelial functionenduranceendurance sportsenergetic developmentenergyenergy cystenergy medicineengagementEnglandenhanced primary careenrollmententeric and autonomic nervous systementeric nervous systementeropathyentitlemententrapmententrapment neuropathyentropic principleentropyentrustable professional activitiesenuresisenvironmental conditionsenvironmental healthenvironmental stimulusenvironmental toxinseosinophil counteosinophiliaeosinophilsependymaepicondylitisepicondylopathia humeri radialisepicranial aponeurosisepidemiologic studyepidemiological studyepidemiologyepidermolysis bullosaepidural haematomaepidural injectionepidural ligamentepidural lipamtosisepidural plexusepidural spaceepigastric painepigeneticsepilepsyepinephrineepiploic appendagitisepipteric bonesepisiotomyepisodic migraineepistemologyepithelializationEpley maneuverEpstein-Barr virusEQ-5Dequalityequilibriumequineequityeraserectile dysfunctionergojumpergometerergonomicsergonomics of the workplaceergotamineEric PratErich BlechschmidtEROP guidelines:erratumerrorerror reductionerythemaerythrocyte counterythrocytesescape roomesophageal atresiaesophageal sphincteresophagogastric junctionesophagusesotropiaesportsessentialessential hypertensionestimated treatment effectsestrogenestrogen replacement therapyethanolaminesethical decision-makingethical reportingethicsethics of treatmentethmoid sinusethnic groupsethnic inequityethnicityetiologyetiology of paineulogyEuropaEuropeEuropean guidelinesEuropean osteopathyEuropean Register for Osteopathic Physicianseuropean symposiumEuropean Symposium of Traditional Osteopathyeustachian tubeeustachian tube dysfunctoneuthanasiaevaluationevaluation criteriaevaluation studiesevaluationseventevidenceevidence based medicineevidence based practiceevidence implementationevidence in healthcareevidence informed practiceevidence of effectivenessevidence-based clinical practice guidelinesevidence-based dentistryevidence-based medicineEvidence-Based Medicine/instrumentation/methodsevidence-based osteopathyevidence-based practiceevidence-informed medicineevidence-informed therapyevidenced based osteopathyevidence–based practiceeVideoevoked potentialsevolutionevolutionary medicineevolutionary osteopathyexam performanceexam scoresexaminationexamination routineexamination tablesexamsexcessive cryingexcitabilityexclusion zone waterexerciseexercise counselingexercise induced anaphylaxisexercise prescriptionexercise programexercise rehabilitationexercise therapyexercise toleranceexercisesexercises therapyexertionexhaled nitric oxidexhaustionexhibitexhibitionexocrine glandsexogenetic timerexpanded spinal flexion testexpansionexpectancyexpectationsexperienceexperienced bodyexperienced osteopathexperiencesexperimental researchexpert practiceexpert testimonyexperts’ opinionexpirationexpiratory reserve volumeexplorative studyexplosionsexplosive strengthexposureextended abdominal operationsextensibilityextension dynamic testextension rotation testextensor musclesextensor muscles handexternal sphincterexternal stillpointexternal versionexteroceptive awarenessextracellular fluidextracellular matrixextracorporeal shock wave therapyextracurricular activitiesextraneous materialextraocclusal disordersextraocular musclesextrinsic sleep disordersextubation failureeyeeye diseaseeye dominanceeye lengtheye movementeye movementseye muscle palsyeye paineye pumping techniqueeye socketeye-trackingeyeballeyelideyesF. CerritelliF. G. RobertsF. L. MitchellF. Mitchell Jr.F. Mitchell Sr.F. WillardF. X Mayr-therapyF. X. MayrF. X. Mayr-diagnosticF.X. MayrFAAOfaceface masksfacet jointfacial anatomyfacial bonesfacial developmentfacial effleuragefacial hemispasmfacial injuriesfacial lymphedemafacial musclesfacial neoplasmsfacial painfacial paralysisfacial structurefacial swellingfacial tumorsfacial twitchingfacilitated oscillatory releasefacilitated positional releasefacilitated positioningfacilitated segmentfacilitationfactfactitious disordersfactor analysisfactual databasesfacultyfaecal incontinencefailurefaithfakefallfallingfallsfalls preventionfalse self-employmentfalx cerebrifamilial hypercholesterolemiafamiliesfamily healthfamily medicinefamily medicine residency clinicfamily physicianfamily physiciansfamily planningfamily practicefarmworkersFASfasciafascia anatomyfascia clavipectoralisfascia distortion modelfascia distortion model (FDM)fascia innervationsfascia renalisfascia researchfascia rollerfascia thoracolumbalisfascia tubefasciaefascial circuitsfascial continuumfascial contractionfascial counterstrainfascial distortion echniquesfascial distortion modelfascial distortion model (FDM)fascial distortionsfascial dysfunctionfascial imagingfascial innervationfascial listeningfascial manipulationfascial manipulation methodfascial mechanismsfascial pelvic testfascial releasefascial researchfascial skeletonfascial systemfascial tapingfascial testfascial therapyfascial tissuefascial treatmentfasciitis plantarisfascilitationfasciotomyFASDfast fourier transformfastingfat contentfatal dysrythmiafatiguefatigue statusfatiqueFCSFDMFDM-therapyFDTfear avoidancefear of engagingfear-avoidance beliefsfeasibilityfeasibility studiesfecundityfee-for-service plansfeedbackfeeding behaviorfeeding disorderfeeding disordersfeeding dysfunctionfeeding tolerancefeeding vessel signfeelfeelingfees and chargesfeetfeet injuryfeet planovalgus deformityFeldenkraisfellow of the American Academy of Osteopathyfellowshipfellowship programsfellowship thesisfellowshipsfellowships and scholarshipsfelt sensefemalefemale breastfemale first respondersfemale genital mutilationfemale infertilityfemale osteopathsfemale urogenital diseasesfeminismfemoral arteryfemoral headfemoral neck anteversionfemoral nervefemoro-acetabular impingementfemoroacetabularfemoroacetabular impingement syndromefemoroacetabular jointfemurfennelfertilityfertility disordersfetal alcohol spectrum disorderfetal alcohol syndromefetal developmentfetal diseasesfetal positionfetal stagefeto-fetal transfusion syndromefetusfeverfibonaccifibrillar networkfibrinolytic agentsfibroblastfibroblastsfibromyalgiafibroplastsfibrosisfibulafibula headfibular nerve palsyfictionfield theoryfield-based learningfield-specific languagefieldsfields of studyfightfigure skatingfilamentfilum terminalefinancial conflicts of interestfinancial distressfinancial managementfinancial servicesfinancial supportfinancingfindingsfine motor skillsfingerfinger injuriesfinger-floor-distancefingersfinite element methodFinlandfirearmfirefighter cadetsfirefightersfirst aidfirst cryfirst explorationfirst ribfirst semesterfirst trimester pregnancyfirst year of lifefirst-choice residencyfitnessfive diaphragmsfive modelsfive transformation phasesfixationflat epithelial atypiaflat feetflat footflexibilityflexionflexion distraction techniqueflexion rotation testflexion testflexion-rotation testflexor hallucis longusflexor tendonflightflight reactionflipped classroomfloating field adjustmentFloridaflossingflour vaginalisflow rateflu testingfluidfluid balance techniquefluid bodyfluid drivefluid dynamicsfluid shearfluid techniqueFluid8fluidsfluids of lifefluocinolone acetonidefluoresceinfluorescencefMRIfocal adhesionsfocus groupsFoetal and early infant developmentfolatefolate deficiencyfoldingfollow upfollow-Up Studiesfollow-up studyfontanelsfoodfood allergyfood attitudesfood hypersensitivityfood insecurityfood intolerancefood sensivityfootfoot deformityfoot diseasesfoot dropfoot dystoniafoot lesionsfoot massagefoot orthosisfoot orthoticsfoot painfoot progression anglefootballforamenFORCEforce applicationforce distributionforce transmissionforced expiratoryforced expiratory volumeforced vital capacityforcepsforearmforearm fractureforecastingforefootforefoot varusforeheadforeign medical graduatesformformation of limb muscles and jointsformation of skeletonformetricformsforms and records controlforward headforward head posturefoundationFoundation of Osteopathic Research and Clinical Endorsementfoundationsfour diaphragmafour quadrant modelfourth ventriclefourth ventricle compressionfourth ventricle compression techniquefourth ventricular compressionFPRfracturefracture healingfracturesfragilityFraminghamFranceFrankfurt DeclarationfraudFred Mitchellfree energy principlefree radical scavenger therapyfree-energy principlefreezefreeze-reactionfreezingFreiburg Personality InventoryFreiburg Personality Questionnairefrequencyfrequency of congenital anomalies of the spinefrequency of diagnoses coincidencefrequency of osteopathic manipulative treatmentfrequency specific microcurrentfrequency-tuningfrictional hypermelanosisfront-rear axis of the vertebraefrontal bonefrontal liftfrontal sinusfrontoethmoidal suturefrontosphenoidal suturefrostbitefrozen shoulderfrozen shoulder syndromeFryette mechanicsfryette principleFSMfulcrumFulford techniquefull squat range of motionfunctionfunctionalfunctional abdominal pain disordersfunctional appliance therapyfunctional approachfunctional bowelfunctional bowel disordersfunctional cardiovascular dysfunctionsfunctional connectivityfunctional constipationfunctional disabilityfunctional dyspepsiafunctional dysphoniafunctional immobilityfunctional instabilityfunctional magnetic resonance imagingfunctional methodsfunctional neuroimagingfunctional orthopedicsfunctional osteopathic techniquefunctional radiographyfunctional somatic syndromefunctional statefunctional statusfunctional techniquefunctionalityfunctions of breathingfundamental researchfundingfungal infectionfungusfuture of osteopathyG. D. HulettG. FryerG. HarrerG. HeimG. RotterG. W. NorthupGabapentingaitgait analysisgait disordersgait disturbancegait dysfunctiongait patternsgalactostasisGalbreath techniquegallbladdergallbladder diseasesgallbladder dyskinesiagallbladder removal surgerygalvanic skin responsegamesganglion cyst formationgas exchangegastric asthmagastric bypassgastric cancergastric circulationgastric manipulationgastric mobilitygastric motilitygastric secretory functiongastric ulcergastritisgastro-phenic ligamentgastroenterologistsgastroenterologygastroesophagealgastroesophageal junctiongastroesophageal refluxgastroesophageal reflux diseasegastrointestinalgastrointestinal agentsgastrointestinal bleedinggastrointestinal diseasegastrointestinal diseasesgastrointestinal disordersgastrointestinal distressgastrointestinal dysfunctiongastrointestinal endoscopygastrointestinal fluid lossgastrointestinal functiongastrointestinal hemorrhagegastrointestinal issuesgastrointestinal lymphoid tissuegastrointestinal markergastrointestinal motilitygastrointestinal motility disorderGastrointestinal Quality of Life Indexgastrointestinal symptomgastrointestinal symptomsgastrointestinal systemgastrointestinal tractgastrointestinal transitgastroparesisgelgendergender awarenessgender biasgender differencesgender diversegender dysphoriagender health gapgender identitygender impactgender medicinegender minoritiesgender-specific treatmentgene expressiongeneral diagnosticsgeneral healthgeneral movementgeneral movement assessmentgeneral movementsgeneral nutritiongeneral osteopathic treatmentgeneral practicegeneral practitionergeneral practitionersgeneral preventing medicinegeneral surgerygeneral surgery residency programgeneralismgeneralistsgeneralized anxiety disordersgeneralized muscle hyperfacilitationgenesgenetic mutationgenetic testinggeneticsgenital descensusgenital diseasesgenital mutilationgenital stage or oedipal stagegenitourinary systemgenomicsgentlenessgeodesicgeographic atrophygeographic factorsGeorge Bernard ShawGeorgiaGERDGERDlower esophageal sphincterGerdQ questionnairegeriatricgeriatric assessmentgeriatric examinationgeriatric nursinggeriatric patientsgeriatricsGerman congressGerman health systemGerman lawGerman Medical AssociationGerman Osteopathic AssociationGerman osteopathic journalsGerman osteopathic schoolsGerman osteopathsGermanygerontologygestationgestation periodsgestational agegiardiasisGillick competenceGIMFOTgingival recessiongingivitisGIRDgirdle paingirlgirlsglandula suprarenalisglandular tissueGlasgow coma scaleglaucomaGlenárdglenohumeralglenohumeral internal rotation deficitglenohumeral jointglenohumeral motionglidinggliding testglioblastoma multiformeglobal healthglobal health educationglobal health programglobal listeningglobal listening testglobal osteopathic treatmentglobalizationglobus hystericusglossariesglossaryglucocorticoidsglucosaminosulfateglucosegluteal claudicationglutengluteusgluteus maximusgluteus mediusglycated hemoglobinglycated hemoglobin Aglycemic controlglycosylationglygoaminoglycansglymphaticglymphatic systemglymphatic-lymphatic couplingglymphaticsGMAgnathological therapygodly intentionGoethe-Oken vertebral theorygolfgolf swinggonalgiagonarthritisgonarthrosisgoniometrygonococcal arthritisGonstead-modelGordon syndromeGOTgovernmentgovernment financinggovernment programsgovernment regulationgowers signGRADE systemgradinggraduategraduate degree holdersgraduate educationgraduate medical educationgraduatesgraduationgrantsgranulocyte colony stimulating factorgranuloma facialegranulomatous disordergratuated medical educationGraves diseasegravitygravity therapygravity treatmentgreater occipital nervegreater osteopathic lesion complexgreater tubercle of the humerusgreen nail syndromegrindinggrip strengthGrisel syndromegroingroin injurygroin paingross anatomy educationgrounded theorygroup exercisegroup muscle strengtheninggroup practicegroup processesgroup sizeGROUPIE programgrowing paingrowing painsgrowthgrowth adductiongrowth disturbancegrowth factorsgrowth hormoneGrulier scaleGrynfeltt-testgsrguanidinesGuatemalaguided visualizationguidelineguideline adherenceguideline developmentguidelinesGuillain-Barré syndromegum recessiongun violencegutgut associated lymphoid tissuegut microbiomegut microbiotagut-brain axisgymnasticsgymnastsgynaecologicalgynaecologygynecologic cancergynecologic malignanciesgynecological diseasegynecologistsgynecologyh-reflexH. D. FriedmanH. FrankeH. FryetteH. GartenH. H. FryetteH. HooverH. PhilippiH.I. Magounh1n1H5N1habit of movementhabitshabitual idiopathic epistaxisHaglund deformityhair lossHaitihall of famehallux valgushalo effectHaloperidolHamburghamstings stretchinghamstringhamstring flexibilityhamstring musclehamstring Muscleshamstring tendinopathyhamstring tightnesshamstringshamstrings injuryhandhand functionhand function diseasehand massagehand movementshand painhand strengthhand surgeryhandballhandednesshandicaphandicapped childrenhandlinghandover of practicehandshands-on approachhands-on medicinehaplorhinihappinesshaptichaptic feedbackhaptic perceptionhapticshard dental tissuehard meningesharm reductionharmonic techniqueharmonic therapyHashimoto diseasehauoraHawthorne effectheadhead and neck regionhead impulse testhead injurieshead injuryhead jointshead motionhead movementhead movementshead orthosishead painhead positionhead posturehead repositioninghead retraction reflexhead shapeheadacheheadache diagnosisheadache disordersheadache managementHeadache, Chronic Tension-Type, Osteopathic Treatmenthealinghealing processhealing processeshealing timeshealing watershealthhealth (well-being)health adjusted life expectancyhealth and sicknesshealth behaviorhealth behaviorshealth belief modelhealth carehealth care conceptshealth care costhealth care costshealth care deliveryhealth care educationhealth care facilitieshealth care outcome assessmenthealth care personnelhealth care professionalshealth care qualityhealth care quality lawhealth care reformhealth care spendinghealth care surveyshealth care systemhealth care utilizationhealth centershealth communicationhealth definitionhealth determinantshealth disparitiesHealth Educationhealth facility closurehealth facility environmenthealth fairshealth gaphealth informationhealth initiativehealth insurancehealth insurance reimbursementhealth knowledgehealth literacyhealth literaturehealth metaphorhealth occupationshealth occupations studentshealth personnelHealth Personnel/*educationhealth planning guidelineshealth policyhealth practicehealth practitionerhealth practitionershealth professionhealth professionshealth promotionhealth screeninghealth servicehealth serviceshealth services accessibilityhealth services evaluationhealth services for the agedhealth services misusehealth services needs and demandhealth services researchhealth statushealth status indicatorshealth surveyhealth surveyshealth systemhealth system sciencehealth technology assessmenthealth workforcehealth, structurehealth-care systemshealth-related quality of lifehealthcarehealthcare accesshealthcare costhealthcare costshealthcare deliveryhealthcare inequitieshealthcare initiativehealthcare needshealthcare planshealthcare providerhealthcare systemhealthcare workershealthy lifestylehealthy subjectshearinghearing disorderhearing disordershearing impairmentshearing losshearing troublesheartheart arrhythmiaheart attackheart coherence trainingheart diseaseheart diseasesheart failureheart mobilityheart motionheart palpitationheart positionheart rateheart rate recoveryheart rate variabilityheart rate variability testingheart surgeryheart transplantheart-focused palpationheart-rateheart-rate variabilityheartbeatHeartManheartrate variabilityheatheat applicationheavy drinkingheavy metalsheelheel liftheel lift therapyheel liftingheel liftsheel painheightheilhelical axis of motionhelicobacter infectionshelicobacter pylorihelixHellingerhelmet therapyhelp-seeking behaviourhelper syndromehelping behaviorHelsmoortelhematologic diseaseshematologyhematopoietic stem cell transplantationHemianopsiahemiazygos veinhemicolectomyhemicrania continuahemiparesishemipelvishemiplegiahemodialysishemodynamichemodynamic controlhemodynamicshemoglobinshemorrhagehepatic areahepatic pathologyhepatic veinshepatitis Bhepatitis chepatobiliary systemhepatosteatosisherbal medicinehermeneuticsherniahernia formationhernia incipienshernia surgeryherniatedherniated discherniated discsheroic medicineherpesherpes zoster ophthalmicusherpes zoster virusHesseheterogeneityheterotaxy syndromeheterotopic ossificationheuristicHFIHi Lohiatal herniahiccuphiccupshigh frequencyhigh performance athletshigh schoolhigh school enrichment programhigh school studentshigh velocity - low amplitude techniquehigh velocity low amplitudehigh velocity low amplitude manipulationhigh velocity low amplitude techniquehigh velocity low amplitude thrusthigh velocity thrust manipulationhigh-performance sportshigh-risk lesionhigh-tone pelvic floorhigh-velocity low-amplitudehigh-velocity low-amplitude techniquehigh-velocity thrusthigh-velocity, low-amplitudeHigher educationhindlimbhiphip arthroplastyhip dislocationhip dysplasiahip flexionhip fracturehip fractureship jointhip joints dysplasiahip mobilityhip osteoarthritiship painhip replacementhip rotationhippocampusHippocratic oathhippotherapyhipshirsutismHispanicHispanic Americanshistaminehistamine h1 antagonistshistiocytic necrotizing lymphadenitishistological examinationhistologyhistopathological evaluationhistorical articlehistorical modelshistorical osteopathic practiceshistorical osteopathic principleshistoriographyhistoryhistory bookshistory of medicinehistory of sciencehistory of the journalHistory, 19th Centuryhistory, 20th centuryHistory, 21st CenturyHIT-6HIVHIV infectionsHIV preventionHIV-associated lipodystrophy syndromeHIV-infectionHLVAhoarsenesshockeyHoffmann reflexholismholisticholistic approachholistic assessmentholistic efficacy modelholistic healthHolistic medicineholistic osteopathic treatment approachholistic treatmenthollow organsholoreductionismhome carehome exercisehomelesshomeless personshomeless populationhomelessnesshomeopathyhomeostasishomeostatic deviationhomepagehomes for the agedHondurashonorshook-upHOPE questionshormonal balancehormonal dysbalance from an osteopath’s viewhormonal regulatorshormone disorderhormone levelshormone replacement therapyhormone therapyhormonesHorner syndromehorsehorseback painhorseback ridinghospicehospice carehospitalhospital Administrationhospital carehospital chaplaincy servicehospital costshospital emergency servicehospital length of stayhospital medical staffhospital mortalityhospital patienthospital recordshospital staffhospital stayhospital unitshospitalistshospitalizationhospitalized patientshospitalsHospitals, Osteopathichot flasheshotel roomHPA axisHPDPHPG axisHPO-axisHPVhrvHTA-Report 124humanhuman beinghuman cellhuman cyberneticshuman influenzahuman papillomavirushuman papillomavirus vaccinehuman resourceshuman tissueshuman touchhuman-based medicinehuman-centered carehumanitarian aidhumanitieshumanityHumanshumeroscapular painhumeroscapular periarthritishumeroscapular periarthropathyhumeroscapular periarthrosis syndromehumerus fracturehumourHuntington’s diseasehurdle injuryHVLAHVLA ManipulationHVLA techniqueHVLA thrustHVLA-thrustHVLATHWShyaluronanhyaluronic acidhybrid formatshydrationhydraulic mechanismhydraulicshydrocephalushydrocortisonehydrodynamicshydrolysate milkhydrotherapyhydroxyindoleacetic acidhydroxymethylglutaryl-coa reductase inhibitorshygienehygromahyoidhyoid bonehyoid bone syndromehyoidal-laryngeal muscular tensionhyper-activityhyperactive disorderhyperactive immune systemhyperactivityhyperacusishyperammonemiahyperandrogenaemiahyperbaric oxygenhyperbilirubinemiahypercapniahypercholesterolemiahyperemesishyperglycemiahyperinflationhyperkyphosishyperlipidemiashypermobilitieshypermobilityhypermobility spectrum disorderhypermobility syndromehypermotilityhypernatremiahyperopiahyperostosishyperostosis frontalis internahyperpigmentationhypersensitivityhypersympathetic statehypertensionhypertensivehyperthyroidismhypertrophic osteopathyhypertrophic scarhyperventilationhypesthesiahypnosishypnotherapyhypnoticshypo-activityhypoalgesiahypocapniahypogalactiahypoglycemiahypogonadismhypomobile dysfunctionhypomobilitieshypomobilityhypopnoeahyposmiahypotensionhypothalamic-pituitary gonadal axishypothalamic-pituitary-adrenal axishypothalamic–pituitary–adrenal axishypothalamushypothalamus hypophysis adrenal systemhypothermiahypothyreosishypothyroidismhypoxiahypsiloid cartilagehypthermiahysterectomyhysteresishysteresis changesI-GERQ-R,I. J. RussellI. Korriatrogenic diseaseiatrogenic injuryiatromechanismiatrovitalismIBDIBSICAORICAOR 2008ICAOR 2010ICDICD-10ICD-11ICFICHDichemic compression techniqueICLBicosahedronICPideal muscle functionidentificationidentityidentity crisisidentity-defining characteristicsideomotionideomotorideomotor activityidiopathicidiopathic infant asymmetryidopathic scoliosisIFAO congressIGeL-Monitorikterus neonatorumileal neoplasmsileocecal resectionileusiliac crestiliac dysfunctioniliac spineiliohypogastric nerveiliohypogastric neuralgiailiolumbariliolumbar ligamentiliolumbar ligamentsiliopsoas muscleiliosacral jointiliosacral jointsiliotibial band friction syndromeiliotibial tract syndromeiliumillnessimageimage-guided spine interventionimageryimagingimbalanceimflammatory mediatorsimmersionimmigrant perceptionsimmobilizationimmuneimmune functionimmune responseimmune systemimmune thrombocytopenic purpuraimmunityimmunizationimmunization programsimmunoglobulinimmunoglobulin Aimmunoglobulin blood levelimmunoglobulin Gimmunoglobulin Mimmunoglobulinsimmunohistochemical examinationimmunologyimpact factorimpact of osteopathic treatment from the perspective of patientsimpaired respiratory functionimpingementimpingement syndromeimplantable loop recorderimplantationsimplicit biasimpotenceimpotence medicineimpulsein vitro fertilizationin vitro techniquesin-person instructionin-person learningin-vitro-fertilisationinattentional blindnessinborn errors of metabolisminborn genetic diseasesincidenceincisive boneinclinometerinclusioninclusivityincobotulinumtoxinaincomeincome taxincontinenceindcidenceindependenceindependent respiratory activityIndiaindigenousindigenous communitiesindigentindirect cranial techniquesindirect manipulationindirect osteopathic techniquesindirect techniqueindirect techniquesindivisibilityindolesinequalityinertiainexperienceinfanile esotropiainfantinfant asymmetryinfant careinfant colicinfant cryinginfant developmentinfant diseaseinfant feedinginfant incubatorsinfant mortalityinfant premature diseasesinfantile asymmetryinfantile cerebral palsyinfantile colicinfantile fibrosarcomainfantile idiopathic scoliosisinfantile obstructive apneainfantile postural asymmetryinfantile regulatory disordersinfantile swallowinginfantsinfectioninfection controlinfection managementinfectionsinfectious agentinfectious diseasesinferior alveolar nerveinferior hypogastric plexusinferior hypogastric plexus tilityinferior mesenteric arteryinfertilityinfinityinflammationinflammatory arthritisinflammatory back painInflammatory bowel diseaseinflammatory bowel diseasesinflammatory dermatosesinflammatory jointinflammatory mediatorsInfliximabinfluencainfluenca pandemiainfluence of SBSinfluenzainfluenza A vaccineinfluenza a virusinfluenza vaccinesinformationinformation disseminationinformation processingInformation Storage and Retrieval/methods/*standards/statistics & numerical datainformation technologyinformed consentinforminginfra-red radiationinfraredInfrared thermal camerainfrared thermographyinfraspinatusinfrastructureinguinal herniainguinal paininguinodyniainhalation administrationinhaled corticosteroidsinhibiting balance testinhibitioninhibition testinhibitory testinibitory testINIOSTINIOST Study Report 2019INIOST Study Report 2020INIOST Study Report 2021injectioninjection techniquesinjection therapyinjectionsinjuriesinjuryinjury pelvic diaphragmainjury preventioninjury riskinjury severity scoreinner childinner earinnermost experienceinnervationinnominate dysfunctioninnominate flaresinpatientinpatient outcomeinpatient rehabilitationinpatient settinginpatientsinsertional tendinosisinservice traininginsolesinsomniainspectioninspirationinstabilityinstability tests in childreninstructional videosinstrumental examination methodsinstrumentationinsufficiency fractureinsulainsulininsulin resistanceinsulin sensitivityinsuranceinsurance coverageintegral assay of the spine roentgenogramsintegral study of the spine roentgenogramsintegral theoryintegrated care conferencesintegrated care deliveryintegrated medicineintegrated neuromuscular inhibition techniqueintegrated neuromusculoskeletal releaseintegrationintegrative cardiologyintegrative careintegrative medicineintegrative physiologyintegrinsintegrityintelligenceintelligence testsintensity of painintensive careintensive care unitintensive care unitsinter examiner reliabilityinter rater reliabilityinter- and intra-examiner reliabilityinter- and intra-rater reliabilityinter-examiner reliabilityinter-group comparisoninter-incisor distanceinter-professional dialogueinter-rater reliabilityinter-rater-reliabilityinter-rectus distance (IRD)inter-researcher reliabilityinter-vertebral radiological motioninteractioninteraction of the body systemsintercellular spaceintercranial membraneintercristal lineinterdependenceinterdisciplinarityinterdisciplinary communicationinterdisciplinary cooperationinterdisciplinary dialogueinterdisciplinary teamworkinterdisciplinary treatmentinterdisciplinary workinterexaminer agreementinterexaminer reliabilityinterexaminer reliabiltyinterference field of teeth and jawboneinterferential therapyInterferon-gammainterinstitutional relationsinterleukin 8interleukin-1 inhibitorsInterleukin-10Interleukin-4interleukin-6interlinked disordersintermittent claudicationintermittent fastingintermittent hypoxiaintermusculare septuminternal and external validityinternal carotid arteryinternal consistencyinternal fracture fixationinternal injuriesinternal medicineinternal organsinternal sphincterinternal stillpointinternal treatmentinternational classification of diseasesInternational Classification of Functioninginternational cooperationinternational medical graduateinternational studentsinternationalityinternetinternet useinternistsinternshipinternship and residencyInternship and Residency/*organization & administrationinternship and residentsinterobserver reliabilityinteroceptioninteroceptive awarenessinteroceptive paradigminterosseous lesioninterosseous membraneinterpersonal relationsinterpersonal skillsinterpretationinterpretation of palpatorinterprofessionalinterprofessional attitudesinterprofessional careinterprofessional collaborationinterprofessional cooperationinterprofessional educationinterprofessional evaluationinterprofessional learninginterprofessional relationsinterprofessionalityinterrater reliabilityinterrater reliability studyinterrelationships eye-musculoskeletal systemintersectionalityintersensory conflictinterspinal neoarthrosisinterstitial cystitisinterstitial fluidinterstitial fluid pressureintertarsal angleintertester reliabilityintervals of treatmentinterventionintervention adherenceintervention studiesinterventional radiologyinterventional ultrasonographyintervertebral discintervertebral disc degenerationintervertebral disc displacementintervertebral dysfunctionintervertebral motioninterviewinterview partnerinterview selectioninterview seriesinterview studyinterviewsintestinalintestinal constipationintestinal diseaseintestinal dysbiosisintestinal obstructionintestinal passageintestinal passagepintestinal perforationintestinal permeabilityintestinesintima-media thicknessintimate partner violenceintolerance to drugsintra examiner reliabilityintra ocular pressureintra rater reliabilityintra- and inter-rater reliabilityintra- interrater reliability studyintra-abdominal pressureintra-cranial pressureintra-examiner reliabilityintra-observer reliabilityintra-rater reliabilityintra-rater-reliabilityintra-thoracal pressureintraabdominal pressureintracerebral networkingintracranialintracranial hypertensionintracranial pressureintracranial strainintractable myoclonusintractable painintractable singultusintradiscal pressureintraexaminer reliabilityintraligamentous injectionintramural vascular systemintramural vesselsintramuscular connective tissue stromaintramuscular injectionsintramuscular ketorolacintranasal administrationintraobserver reliabilityintraocular blood pressureintraocular hypertensionintraocular pressureintraoral manipulationintraoral vacuumintraosseous dysfunctionintraosseous lesionsintraosseous membraneintraosseous strainintraosseous treatmentintraosseous, strain, lesionintraosseus lesionsintrapartum periodintraprofessionalintrarater reliabilityintrarectal manipulationintratester reliabilityintrathoracal fascial releaseintraunterine devicesintrauterine deviceintrauterine pressureintravenous infusionsintraventricular hemorrhageintrinsic nervous systemintrinsic sleep disordersintrospectionintubationintuitionintuitive communicationintuitive decision-making strategyintuitive osteopathyintuitive reasoninginury abdominal diaphragmainversion spraininvoluntary cranial movementIowaIPEIrelandirritable bowelirritable bowel syndromirritable bowel syndromeirritable bowel syndrome severity scoreirritable colonirritation pointsIrvin KorrIsaacs syndromeischemiaischemic compressionischemic pressureischialgiaIsele-methodISG mobility testisolated calcaneofibular ligament injuriesisometricisometric contractionisometric manipulationisometric quadriceps muscle testingisometric strengthisometric strengthening exerciseITItalian register of osteopathsItalyITBFSitchingitch–scratch cycleitem response theoryIVFJ. G. MeislerJ. GilbeyJ. HelsmoortelJ. JealousJ. M. LittlejohnJ. MayerJ. McGovernJ. S. DenslowJ. StarkJ. TravellJ. UpledgerJ. WernhamJ. YamadaJ.J. PapassinJ.P. BarralJames JealousJapanjaundicejawjaw abnormalityjaw cystjaw movementsjaw necrosisjaw painJean-Pierre BarralJefferson Scale of EmpathyJefferson Scale of Physician Empathy-Health ProfessionaljejunoileumJenette “Nettie” Bollesjet lagjob applicationjob satisfactionJohn Martin LittlejohnJohn UpledgerJohn WernhamJohn WesleyJohnston’s functional methodsjointjoint cartilagejoint complex dysfunctionjoint crackingjoint diseasesjoint dislocationsjoint hypermobilityjoint instabilityjoint manipulationjoint mobilityjoint mobilizationjoint painjoint pathologyjoint range of motionjoint replacementjoint stiffnessjoint test validityjoint vibration analysisjointsJones techniquejournaljournal clubjournal impact factorjournal of osteopathic medicinejournalsjoyful discoursejudgmentjugular compressionjumpingjumping reachjurisdictionjurisprudencejury deliberationjuvenile growing painjuvenile idiopathic arthritisK. LewitK.L. ReschKaltenborn-Evjenth orthopedic manual therapyKansasKappa testkaratekeloidkendoKentuckyKenyaKerdo indexketogenic dietketorolac tromethaminekeyword searchkidneykidney infectionkidney mobilitykidney motilitykidney stonekidney stoneskidneyskikuchi fujimoto diseasekiller cellsKimmerle anomalykinematic chainkinematic consistencykinematicskinesio tapekinesiographykinesiologykinesiology tapekinesiophobiakinesiotapeskinesiotapingkinesthetic channelkinetic chainkinetic imbalancekineticskink footKirksvilleKirksville college of osteopathic medicineKISS syndromeKISS-syndromeKlippel-Feil syndromeKlumpke pulsykneeknee arthroplastyknee disorderknee extensionknee flexionknee injuriesknee injuryknee jointknee joint painknee kinematicknee ligamentsknee osteoarthritisknee painknee pain diagnosisknee replacementknee surgeryknee swellingknowledgeknowledge of nutritional issuesknowledge of osteopathyknowledge questionnaireknowledge retentionknowledge transferknuckle crackingKorean communitieskyphosiskyphotic anglel-dopaL. BurnsL. Hartmanlablaborlabor and deliverylabor durationlabor lawlabor managementlabor painlaboratorieslaboratorylaboratory medicinelaboratory testlaboratory valueslabourlabral tearlacerationslack of publicationlack-of-accordlacrimal duct obstructionlacrimal duct stenosislacrosselactatelactate clearancelactationlactation consultantlactation durationlactation quantitylactic acidlactiferous ductlactoseLake ConstanceLance-Adams syndromelandmark relocation errorlandmarkslanguagelanguage associated perception disorderslanguage barrierslanguage disorderlanguage proficiencieslap techniquelaparoscopic cholecystectomylaparoscopylaparotomylarge intestinelarge language modelsLarson syndromelaryngitislaryngoscopylarynxlaser treatmentLATCH assessment toollate pretermlate whiplash syndromelatency stagelatent muscle trigger pointlatent myofascial trigger pointlatent trigger pointslateral cutaneous nervelateral elbow tendinopathylateral epicondylalgialateral epicondylitislateral epicondylosislateral femoral cutaneous nervelateral fluctuationlateral medullary syndromelateral strainlateral symmetrylateral ventriclelateroflexionlatex hypersensitivityLatinoLatinxlavender essential oil inhalationlawlaw regulationlaxativelay menlay populationlaypersonLBPLDL cholesterolLDTlead exposureleadershipleaky gutleaky gut syndromelean managementlearned helplessnesslearner centered educationlearninglearning cycleslearning disabilitylearning disorderlearning efficiencylearning environmentlearning methodslearning processlearning strategylearning stylelearning technologylearning theorieslecturelecture serieslecturesleft bundle branch blocklegleg lengthleg length differenceleg length discrepancyleg length inequalityleg painlegal approachlegal expertiselegal expertslegal liabilitylegal proceedingslegal situationlegal statuslegastheniaLegg reduction maneuverLegge 11 Gennaio 2018 n.3Legg–Calvé–Perthes diseaselegislationlegitimacylegitimationlegsleiomyosarcomaleisurelength of childbirthlength of hospital staylesionlesion chainslesionistslesions to the peripherylesser occipital nervelesser omentumletterleukemialeukocyteleukocyte countleukocytesleukodermaleukotriene antagonistsleukotrieneslevator ani syndromelevator scapulaelevel of evidencelevels of anxiety and depressionLewy body dementiaLGBTLGBTQLGBTQ+liabilityliability and archiving obligationsLiaison on Committee Medical Educationlibidolibrarieslibrary serviceslibrary staflicensinglicensing examinationslicensing examslicensurelichen planus pigmentosus inversuslidocainelien mécanique ostéopathiqueLien Mechanik Osteopathylife and deathlife expectancylife forcelife qualitylife satisfactionlife stylelife support carelifelong learninglifestylelifestyle changeslifestyle medicinelift off techniquelifting techniquelig. craniale durae matris spinalislig. denticulatumlig. longitudinale posteriuslig. nuchaeligamentligamentous articular strainligamentous articular strain techniqueligamentous laxityligamentous tissueligamentsligamentum sterno-pericardium inferiorligamentum sternopericardium superiorligamentum stylohyoideusligamentum vertebropericardiacumligamentum vertebropericardiumligg. flavaligg. interspinalia durae matrislightlight touchlight touch therapylikelihood ratiolimb developmentlimb foldlimb girdlelimb girdle muscular dystrophylimb injurieslimb placodelimb spasticitylimb symmetrylimb-girdle-muscle-dystrophylimbic systemlimitationslimitations in mobilitylimplinea albalinear IgA bullous dermatosislinear modelslinkagelip swellinglipidsLipocalin-2liquid medialiquor cerebrospinalisliquorodynamicslisteninglistening testlistening testsliteratherapyliteratureliterature reviewliterature searchlitigationlittle brain on the heartlived bodylived experienceliverliver dysfunctionliver enzymesliver mobilityliver pathologyliver pumpliver pumping techniquelivingliving matrixliving matter organizationLMO finding methodloadingloan forgivenesslobalizationlobbyinglobectomylobus insularislocal heatlocal listeninglocal motionlocalized sclerodermalocation decisionlocked craniumlocked movement patterslocking techniquelocomotionlocomotor abilitylogical narrativelogistic modelslogopaedic treatmentlong COVIDlong COVID-19Long posterior sacroiliac ligamentlong term prospectslong tidelong-term effectslongissimus musclelongitudinallongitudinal outcomeslongitudinal studieslongitudinal studylooped suturelorazepamlordosislordotic angleloss of a childloss of childLouisianalovelow anorectal malformationlow backlow back injurylow back motionlow back painlow back painolow birth weightlow birth weight infantlow-back painlow-grade inflammationlow-lactose milklow-molecular-weight heparinlower abdominal painlower backlower back painlower cross syndromelower esophageal sphincterlower extremitieslower extremitylower extremity painlower leglower leg deformitylower limblower limb volumelower limbslower thoracic back painlower urinary tract symptomlower urinary tract symptomsLPTlubricationlumbagolumbal spinal stenosislumbarlumbar adjustmentslumbar arterieslumbar connective tissuelumbar degenerative disorderlumbar disc herniationlumbar fascialumbar herniated disklumbar hyper-lordosislumbar lordosislumbar mobilitylumbar nucleotomylumbar open laser microdiscectomylumbar osteochodrosislumbar radiculopathylumbar repositioninglumbar romlumbar sidebendinglumbar somatic dysfunctionlumbar spinal movementlumbar spinal stenosislumbar spinelumbar spine manipulationlumbar stabilizationlumbar surgerylumbar tender pointslumbar vertebralumbar vertebraelumbar vertebral levellumbar-thoracic junctionlumbo-pelviclumbo-pelvic complexlumbopelvic arealumbopelvic manipulationlumbopelvic painlumbopelvic rhythmlumbosacral mobilitylumbosacral painlumbosacral radiculoischemialumbosacral regionlumbosacral spinelumbosacral spring testlunglung capacitylung conditionslung fibrosislung functionlung neoplasmslung parenchymalung sarcoidosislung transplantlung volumelungslupuslupus erytematosuslupus erythematosusLUTSLuxembourglyme arthritislyme diseaselympathic pump techniquelympathic systemlymphlymph channel and brainlymph drainage therapylymph edemalymph flowlymph node excisionlymph systemlymphatic channellymphatic circulationlymphatic congestionlymphatic drainagelymphatic drainage techniqueslymphatic fluid flowlymphatic manipulationlymphatic manipulative pumplymphatic pumb techniquelymphatic pumplymphatic pump techniquelymphatic pump techniqueslymphatic pump treatmentlymphatic returnlymphatic stasislymphatic systemlymphatic techniqueslymphatic tissuelymphatic treatmentlymphatic vesselslymphatic, rib raisinglymphaticslymphedemalympho-fascia releaselymphocyte activationlymphocyte countlymphocyte subsetslymphoedemalymphoid tissuelymphomalysosomesm. adductor longusm. iliacusM. Locherm. piriformism. rectus capitis posterior minorM. WilsonM. WyvekensM?orimachine learningmacroelementsmacrophage inflammatory protein 1alphamacrophagesmacular degenerationmagnetic resonance angiographymagnetic resonance imagingmagnetic resonance imaging of the spinemagnetic stimulationmagneticsMaineMaitland mobilizationmajor clinical studymajor depressive disordermalabsorptionmaladjustmentmaldescensus testismalemale infertilitymale urogenital diseasesmalformationmalignancymalnourishmentmalocclusionmalpracticeMALSMALTmammarian glandmammary glandmammographyman in triuneman is triunemanaged caremanaged care programsmanagementmanagement of headachesmandiblemandibularmandibular condylemandibular torsionmanikinsmanipulationmanipulation therapymanipulation under anesthesiamanipulation, osteopathicmanipulationsmanipulative medicinemanipulative scar treatmentmanipulative techniquesmanipulative therapiesmanipulative therapymanometrymanual therapymanual dexteritymanual examinationmanual handlingmanual healingmanual health caremanual interventionmanual lymph drainagemanual manipulationmanual medicinemanual method of treatmentmanual palpationmanual practitionermanual pressuremanual skillsmanual techniquemanual techniquesmanual therapiemanual therapiesmanual therapistmanual therapymanual therapy educationmanual trainingmanual treatmentmanual visceral therapymanuscriptsmarathonmarketingmarketing of health servicesMARMmask mandateMassachusettsmassagemassage therapyMassaimassetermasseter musclemastectomyMaster of ScienceMaster of Science in osteopathymasterclassmasticationmasticatory musclemasticatory musclesmasticatory systemmastitismastoid bonemastopathymatchmatch criteriamatch ratematch ratesmatched-pair analysismatchingmateria medicamaterial medicinematernal health servicesmaternal morbiditymaternal painmaternal welfarematernity bluesmaternity leavemathematical conceptsmathematicsmatriculationsmatrix-rhythm-therapymattermaxillamaxillary nervemaxillary sinusmaxillofacial developmentmaxillofacial syndromesmaximal inspiratory pressuremaximum flow rateMBSRMcArdle diseaseMCAT preparationMcCune-Albright syndromeMcGill pain questionnaireMcKenzieMcKenzie methodMcManis treatment stoolmealmeaningmeaningful learningmeasurementmeasurement toolsmechanical dyspneamechanical force transmissionmechanical linkmechanical lymphatic drainagemechanical neck painmechanical nociceptive thresholdmechanical stressmechanical ventilationmechanismmechanism-of-injury approachmechano-biologymechano-transductionmechanoreceptormechanoreceptorsmechanoregulationmechanosensationmechanosensitivitymechanotransductionmeconiummeconium excretionMED scalemediamedia coveragemedial malleoli asymmetrymedial prefrontal cortexmedial rotation anglemedial tibial stress syndromemedianmedian arcuate ligament syndromemedian linemedian nervemedian nerve syndromemediane palatine suturemediastinummediastinum anteriormediation analysisMedicaidmedicalmedical and biological maintenance of sportsmedical assistancemedical bodymedical caremedical clarificationmedical college admission testmedical conferencemedical consultationmedical doctormedical economicsmedical educationmedical education curriculummedical education debtmedical errorsmedical ethicsmedical facultymedical feesmedical graduatesmedical guidelinesmedical historymedical history takingmedical humanitiesmedical humanities poetrymedical humanities programmesmedical illustrationmedical informaticsmedical informationmedical journalmedical knowledgemedical leadershipmedical legislationmedical licensingMedical Licensing Examinationmedical licensuremedical literaturemedical malpracticemedical managementmedical philosophymedical physiciansmedical physiologymedical practicemedical practice managementmedical prescriptionsmedical professionmedical professionalsmedical recordsmedical schoolmedical school admissionsmedical school applicantsmedical school graduatesmedical school shadowingmedical schoolsmedical simulatormedical societiesmedical societymedical staff privilegesmedical studentmedical student educationmedical student performancemedical student researchmedical studentsmedical trainingmedically underserved areamedically underserved areasmedically uninsuredmedicaremedicare datamedicationmedication nonadherencemedication reconciliationmedication therapy managementmedication-assisted treatmentmedicationsmedicinemedicine fellowshipmedicine in the artsmeditationMEDLINEMEDLINE/standards/statistics & numerical dataMeersseman-testmegacitymelancholic wholenessmelanomaMelicien Tettambelmembershipmembranesmemorymemory lossmemosmenMeniere’s diseasemeningeal lymphaticsmeningesmeningitismeningoencephalitismeniscal injurymeniscusmenopausal syndromemenopausemenopause symptomsmenorrheamensesmenstrual bleedingmenstrual cyclemenstrual painmenstruationmenstruation disturbancesmental developmentmental disordermental disordersmental examinationmental healingmental healthmental health disordermental illnessmental imagerymental organismmental stressmental taskmentasticsmentormentoringmentorsmentorshipmepyraminemeralgia parestheticmeralgia parestheticamergermeridiansmesenchymemesenteric duct lymphmesenteric liftmesenterymesodermmesothelial/ peritoneal wound healingMETMET modelmeta analysismeta reviewmeta-analysismeta-epidemiological studymeta-researchmetabolic changesmetabolic fieldmetabolic fieldsmetabolic healthmetabolic mapmetabolic regulationmetabolic syndromemetabolismmetacarpophalangeal jointmetacognitionmetaphormetaphor analysismetaphysicsmetareviewmetastasismetastatic abdominal cancermetastudiesmetaversemethodismmethodological qualitymethodological reviewmethodologymethodsmethyl-sulfonyl-methanemethylenetetrahydrofolate reductase genemethylprednisolonemetronidazoleMFI-20MFPSmfrMFT challenge discmiceMichaelis diamondMichiganmicro-traumatic lesionmicroaggressionsmicrobesmicrobial drug resistancemicrobiologymicrobiomemicrobiotamicroelementsmicrogliamicrogravity therapymicropolarizationmicroRNAmicrovacuolamicrovacuolar conceptmicrovibrationmicturitionmicturition problemsmicturition protocolmiddle earmiddle ear pathologiesMiddle Eastmiddle scalenemiddle schoolmiddle-aged malemidgutmidlinemidwiferymidwivesmigrainemigraine disordersmigraine headachemigraine headachesmild cognitive impairmentmild traumatic brain injurymilestonesmilestones of developmentmilitarymilitary facilitiesmilitary medicinemilitary personnelmilitary trainingmilitary traumamilk supplymimic musclesmindmind and bodymind-body interdependencemind-body relationsmind-body therapiesmind-body therapymind-body-spirit interactionsmindful eatingmindfulnessmindfulness based interventionsmindfulness-based stress reductionmind–body relationsmineralizationmineralsminimal lever-techniqueminimally invasive surgical proceduresministry of healthminorityminority groupsminority physiciansmirror neuronsmirror therapymiscarriagemisinformationmissionmission statementsMississippiMissouriMitchellMitchell-model,mitochondrial autophagymitochrondriamitophagymix method studymixed method studymixed methods studyMiyoshi 3mobile appsmobile clinicmobile learningmobile phonemobile units in a mobile systemmobilisationmobilitymobility and motilitymobility constrictionmobility limitationmobility of connective tissuemobility of jointsmobility of nervous processesmobility of pelvismobility of the heartmobility restrictionmobility testmobilizationmobitz type IImock codemock interviewmode of actionmode of deliverymodelmodel of mindmodelsmodern approachmodern healthcaremodicModified Back Beliefs Questionnairemodified oswestry disability questionnaireMoebius sequenceMöbius syndromemolar shimmolar teethmolding helmetsmongolian traditional medicinemonitoringmonitoring and correction of myofascial disordersmonoblock-patientmonochoriotic twinsmonocyte chemotactic protein 1monocytesmonointerventionismmonosymptomatic enuresismonotherapyMonro-Kellie doctrinemonthly feesMontrealMontreal Cognitive Assessmentmoodmood disordermood disordersMOPSEmoralemoralitymorbidityMorbihan syndromeMorel-Lavallee lesionmoro reflexmorphea profundamorphinemorphine therapymorphodynamicsmorphofunctionalmorphogenesismorphogenetic fieldmorphologymorphometric parameters of the skullmortalitymortality ratemothermother-child relationshipmothersmotilitymotility restrictionsmotionmotion analysismotion capture technologymotion palpationmotion sicknessmotion testingmotion testsmotivationmotivational interviewingmotoneuronsmotor Activitymotor controlmotor cortexmotor delaymotor developmentmotor dysfunctionmotor endplatemotor evoked potentialsmotor functionmotor learning theorymotor neuron diseasemotor rehabilitationmotor skillmotor skillsmotor symptomsmotor unitmotor vehicle accidentmotorcyclesmotoric functionsmotoricitymotorsportsmountain sicknessmouth breathingmouth neoplasmsmouth openingmouth opening widthmouvement généralmovementmovement analysismovement behaviormovement controlmovement developmentmovement disordermovement disordersmovement educationmovement systemmovement system disordermovement therapymovement-indexmoving directionsMRIMSmsc thesisMSTmucosamucosa associated lymphoid tissuemucosa associated lyphoid tissuemuculoskeletal conditionsMUE 49mueslimulit-treatment approachMulligan mobilisationMulligan mobilizationMulligan mobilization techniqueMulligan techniqueMulligan two leg rotation techniqueMulligan’s mobilizationmulticentric studymultidisciplinary approachmultidisciplinary caremultidisciplinary educationmultidisciplinary managementmultidisciplinary pain managementmultidisciplinary researchmultidisciplinary teammultifactorial processmultifidus musclemultifidus musclesmultifunctionalitymultigenerational studymultimediamultimodalmultimodal approachmultimodal bifocal Integrationmultimodal function foot beddingmultimodal pain therapymultimodal therapymultimodal treatmentmultimorbiditymultiple health caremultiple myelomamultiple regressionmultitaskingmusclemuscle activitymuscle atrophymuscle characteristicsmuscle contractilitymuscle contractionmuscle developmentmuscle electrical activitymuscle energy techniquemuscle energy techniquesmuscle fatiguemuscle flexibilitymuscle hypertonicitymuscle hypotoniamuscle imbalancemuscle impulse techniquemuscle isometric contractionmuscle lengthmuscle nerve activitymuscle pumpmuscle reflexmuscle relaxationmuscle rigiditymuscle spasmmuscle spasmsmuscle spasticitymuscle spindlesmuscle stiffnessmuscle strain injuriesmuscle strengthmuscle strengtheningmuscle stretching exercisemuscle stretching exercisesmuscle tearmuscle tendernessmuscle thicknessmuscle tissue stiffnessmuscle tonemuscle torticollismuscle-vibrationmusclesmuscular coordinationmuscular developmentmuscular diseasesmuscular dystrophymusculo-skeletal-systemmusculoskeletalmusculoskeletal anatomymusculoskeletal caremusculoskeletal complaintsmusculoskeletal conditionsmusculoskeletal diagnosismusculoskeletal diseasemusculoskeletal diseasesmusculoskeletal disordermusculoskeletal disordersmusculoskeletal dynamicsmusculoskeletal dysfunctionmusculoskeletal dysfunctionsmusculoskeletal examinationmusculoskeletal functionmusculoskeletal imbalancesmusculoskeletal injuriesmusculoskeletal injurymusculoskeletal interventionsmusculoskeletal manipulationmusculoskeletal manipulationsmusculoskeletal medicinemusculoskeletal modelmusculoskeletal painmusculoskeletal restrictionsmusculoskeletal sport injurymusculoskeletal stiffnessmusculoskeletal systemmusculoskeletal techniquesmusculoskeletal tensionmusculoskeletal testsmusculus iliopsoasmusculus massetermusculus multifidusmusculus psoasmusculus rectus capitis majormusculus sterno cleido mastoideusmusculus stylohyoideusMuseum of Osteopathic Medicinemusicmusic therapymusicianmusiciansmusicians’ medicinemyalgiamyalgic encephalomyelitismydriasismyelopathymyeloproliferative neoplasmMyers-Briggs type indicatormyfascial releasemyobacmyocardial infarctionmyocardial ischemiamyocardiummyodural bridgemyoduric bridgemyoelectricmyofacial chainsmyofacial releasemyofasciamyofascialmyofascial anchorage techniquemyofascial chainsmyofascial connectionsmyofascial dysfunctionmyofascial meridianmyofascial osteopathic therapymyofascial painmyofascial pain syndromemyofascial pain syndromesmyofascial reflex pointsmyofascial releasemyofascial release techniquemyofascial release therapymyofascial stiffnessmyofascial syndromemyofascial systemmyofascial techniquemyofascial techniquesmyofascial trigger pointmyofascial trigger pointsmyofascial unitmyofascial unwindingmyofibroblastmyofibroblastsmyofibrosismyofunctional therapymyokymiamyomamyopiamyotendinous connectionsmyotomesmyotonometer-tensoalgimetermyotonometrymythsmytonometryN. Mithanailsnaivetynamesnanospacersnaprapathynarcotic analgesicnarcotic pain medicationnarcoticsnarrationnarrativenarrative medicinenarrative medicine programmesnarrative reviewnarrow palateNASnasal associated lymphoid tissuenasal cavitynasal congestionnasal obstructionnasomaxillary regionnasopharyngitisNational Ambulatory Medical Care SurveyNational Health Interview Survey 2007national health programsnational health serviceNational Institutes of Healthnational institutes of health (U.S.)national licensing examinationsnational practitioner data bankNational Residency Match Programnational resident matching programnational socialismnational surveyNative AmericanNative American studentsNative Americansnatural birthnatural carenatural childbirthnatural killer cellsnatural medicinenatural philosophynaturenaturopathynauseanausea and vomitingNE-O modelneckneck disability indexneck dissectionneck injuriesneck kinematicsneck motionneck musclesneck musculatureneck painneck sprainneck stabilityneck stiffnessnecrobiosis lipoidicaneedle biopsyneedlesneeds assessmentnegentropynegligenceNelson-Dennyneonatalneonatal abstinence syndromeneonatal asphyxianeonatal hyperbilirubinemianeonatal intensive care unitneonatal outcomesneonatal reflexesneonatal reflexologyneonateneonatesneonatologyneonatology intensive care unitneoplasmsNepalnephrolithiasisnephroptosisnervenerve activitynerve compressionnerve compression syndromenerve compression syndromesnerve conductionnerve diseasenerve endingsnerve entrapment syndromenerve fibersnerve growthnerve mobilisationnerve palpationnerve rootsnerve stimulationnerve-related painnervesnervous diseasenervous systemnervus vagusnetballNetherlandsnetworkingnetworksneumuscular therapyneuracneural canalneural circuitryneural crestneural crest cellneural crest cellsneural disorderneural inhibitionneural manipulationneural mobilizationneural reflexesneural tissue provocationneural tubeneuralgianeuro-ocular releaseneuro-otologic disordersneuro-otological causesneuro-otological disordersneuroaestheticneuroanatomyneurocardiogenic syncopeneurocardiologyneuroceptionneurocirculatory asthenianeurocognitionneurocognitive disordersneurocognitive modelneurocraniumneurodegenerationneurodegenerative conditionneurodegenerative diseaseneurodevelopmental disorderneurodynamic disorderneurodynamic testneurodynamicsneuroendocrine-immune complexneurofibromatosis type 1neurogenerative diseaseneurogenerative disorderneurogenic bowel dysfunctionneurogenic urinary bladderneurohormonal axisneuroimagingneuroimmune systemneuroinflammationneurokinesiologyneurolinguistic programmingneurologic diseaseneurologic disordersneurologic examinationneurologic gait disordersneurological diseaseneurological disorderneurological disordersneurological integrationneurological reflexesneurologyneurolymphatic drainageneurolymphatic reflex pointsneuromuscularneuromuscular diseaseneuromuscular diseasesneuromuscular junctionneuromuscular latencyneuromuscular rehabilitationneuromuscular spinal manipulationneuromuscular systemneuromuscular techniqueneuromuscular trainingneuromusculoskeletalneuromusculoskeletal disordersneuromusculoskeletal medicineneuromusular homeostasisneuromyofascial webneuronal cellsneuronal plasticityneuronsneuropadneuropathicneuropathic painneuropathic pain syndromesneuropathologyneuropathophysiologyneuropathyneurophysiologicalneurophysiologyneurophysiology of pain questionnaireneuroplasticityneuroprotectionneuropsychiatric disorderneuropsychiatryneuropsychological indicatorsneuropsychological testsneuropsychologyneuroregulationneuroregulative body-orientated therapyneurorehabilitationneuroscienceneuroscience educationneurosonographyneurosurgeryneurosurgical residencyneurotologyneurotomesneurotransmissionneurotransmitterneurovascular complicationsneurovascular diseaseneurovascular syndromeneurovasculatureneurovegetative systemneutralneutral zoneneutralityneutrophilsnevus spilusnevus unius lateralisnew coronavirus infectionNew EnglandNew England AcademyNew England College of Osteopathic MedicineNew JerseyNew Mexiconew modelsNew YorkNew York CityNew York City/epidemiologyNew Zealandnewbornnewborn carenewborn coxitisnewborn infantnewborn infantsnewborn usual carenewbornsnewsletterNFLNFTNHSNICE clinical guidelinesNicoNiel-Asher techniquenight carenight painnight sweatsnihilismnipplesnitric oxidenitric oxide synthaseNMTnocebonocebo effectnociceptionnociceptorsnociplastic painnoctural enuresisnocturnal enuresisnoisenomenclaturenon invasive procedurenon specific low back painnon-allergic asthmatic patientsnon-allergic rhinitisnon-binarynon-blinded trialsnon-compliancenon-drug methods of treatmentnon-drug therapynon-equilibrium stabilitynon-Hodgkin lymphomanon-invasive ventilation weaningnon-manual therapynon-medical practitionernon-medical practitioners actnon-narcotic analgesicsnon-operative carenon-operative managementnon-pharmaceutical therapiesnon-pharmacologicalnon-pharmacological interventionsnon-pharmacological pain reliefnon-specific back painnon-specific chronic low back painnon-specific chronic neck painnon-specific effectsnon-specific LBPnon-specific neck painnon-steroidal anti-inflammatory agentsnon-synostotic postural plagiocephalynon-tropical spruenondietary supplementsnonhumannoninvasive brain stimulationnoninvasive positive airway pressurenonparametric statisticsnonpenetrating woundsnonpharmacologicalnonpharmacological therapiesnonpublicationnonspecificnonspecific chronic neck painnonspecific low back painnonspecific neck painnonsynostotic plagiocephalusnonsynostotic plagiocephalynontrauma conditionsnontraumatic amputationnonunion rib fracturesnonverbalnormalityNorth AmericaNorth CarolinaNorthup lectureNorthup memorial lectureNorwaynosenose bridgenosebleedingnosocomial infectionnot-knowingnotalgia parestheticanotenotesnotion of mannotochordnovel lymphatic counterstainnovice osteopathNPQNRMPNRSNSLBPNuad Borannuclear incidentnuclear magnetic resonance imagingnulliparanumbernumeric rating scalenumerical datanurse midwivesnurse practitionernurse practitionersnurse-patient relationsnurserynursesnursingnursing educationnursing homesnursing schoolsnursing studentsnutraceutical augmentationnutrional derangementsnutritionnutrition knowledgenutritional assessmentnystagmusobesityobesity stigmaobituaryobjective postural assessmentobjectivismobservationobservational gait analysisobservational studyobserver variationobsessive-compulsive disordersobstaclesobstetic populationobstetric deliveryobstetric laborobstetric labor complicationsobstetric surgeryobstetrical forcepsobstetricianobstetricsobstetrics and gynecology departmentobstipationobstretical managementobstructed defecationobstructiveobstructive lung diseaseobstructive sleep apneaobstructive sleep apnea syndromobstructive sleep apnoea syndromeobstructive sleep apnoea syndrome (OSA)obturator arteryoccipital boneoccipital compressionoccipital lobeoccipital neuralgiaoccipital verticaloccipital-atlantal decompressionoccipital-atlantooccipital-mastoid thrust techniqueoccipito-atlantal decompressionoccipito-mastoid structure normalizationoccipitoatlantal decompressionoccipitoatlantal jointoccipitoatlantal structuresoccipitoatlantoaxial joint complexoccipitomastoid sutureoccipito–atlantal jointocciputocciput atlas axis complexocciput-atlas-axis manipulationocclusal disordersocclusal planeocclusal reconstructionocclusal splintocclusal splint therapyocclusionocclusion anomaliesocclusive kappaoccupationoccupational diseasesoccupational disordersoccupational dysphoniaoccupational healthoccupational health servicesoccupational injuriesoccupational lawoccupational medicineoccupational overloadoccupational profileoccupational therapyOCTQocular accommodationocular dischargeocular hypertensionocular injuryocular motoricocular painocular pursuitoculomotor nerveoculomotoricsodds ratioodontoidOEGOoesophageal atresiaoesophageal hiatusoesophagogastric junctionoesophagusoffice visitsOhioOIAOklahomaold ageolder adultsolfactory dysfunctionolympic athleteOMDOMMomm fellowsOMM inclusionOMTOMT Spanish fluonchocerciasisoncologic-related complaintsoncologyone health initiativeone-sided tilt testonenessonline anatomyonline databasesonline instructiononline learningonline lecturesonline researchonline reviewonline videoonline-surveyonset of laborOntarioonychomycosisonyxopen carpal tunnel releaseopen chest surgeryopen disclosureopen heart surgeryopen systemsopen-angle glaucomaOPERAoperating marginoperative deliveryoperculumophtalmalogic disordersophtalmalogistsophthalmicophthalmic conditionsophthalmic vein dilationophthalmologyopiateopiate addictsopiod pain medicationopiodsopioidopioid abuseopioid crisisopioid overdoseopioid receptorsopioid usageopioid useopioid use disorderopioid-related disordersopioidsopportunitiesopsteopathyoptic gliomaoptic nerve sheathopticsoptimal sleeping positionOPTION-12 instrumentoptoelectronic plethysmographyoral ?uidoral antibioticsoral aversionoral cavityoral diagnosisoral feedingoral functional disordersoral healthoral hygieneoral stageoral submucous fibrosisorbitorbitaorbitopathyORC-NZOregonorgan donationorgan of perceptionorgan positionorgan systemsorgan-space infectionorganizationorganizational affiliationorganizational cultureorganizational modelsorganizational objectivesorganizational policyorganizationsorganogenesisorgansorientationorienting reactionoriginorigin of osteopathyORIONorofacial dyskinesiaorofacial painorphanageorthodontic bracesorthodontic interventionorthodontic toolsorthodontic treatmentorthodonticsorthodontistorthognathic surgeryorthognathic surgical proceduresorthopaedic surgeryorthopaedicsorthopedic in-training examinationorthopedic insolesorthopedic interventionorthopedic manipulationorthopedic proceduresorthopedic surgeryorthopedic testsorthopedic treatmentorthopedicsorthoptistorthosisorthostatic intoleranceorthosympathetic stimulationorthotic tapeorthoticsos coccygisos ethmoidaleos hyoidos naviculareos occipitaleos sphenoidaleos temporaleos trigonumOSAOSCEoscillating energy manual therapyoscillationoscillatory processesoscillatory releaseOSDossa coxaeossiclesossificationossification of the synchondrosis sphenooccipitalisosteitis pubisosteoarthritisosteoarthrosisosteoathy clinicosteocalcinosteochondritis dissecansosteochondrosisOsteoevidenceosteogenesisosteoidosteokompassosteomaosteomyelitisosteonecrosisosteopathosteopathicosteopathic abdominal manual interventionosteopathic approachosteopathic articlesosteopathic assessmentosteopathic awarenessosteopathic beingosteopathic careosteopathic caseosteopathic clinicosteopathic clinical decision makingosteopathic clinical educationosteopathic clinical reasoningosteopathic collegesosteopathic complaintsosteopathic conceptosteopathic conceptsosteopathic concernsosteopathic conferenceosteopathic consultationosteopathic continuous certificationosteopathic cranial manipulationosteopathic cranial manipulative treatmentosteopathic curriculumosteopathic databaseosteopathic decision-makingosteopathic diagnosisosteopathic diagnosticosteopathic diagnosticsosteopathic diaphragmatic rapid testosteopathic diaphragmsosteopathic distinctivenessosteopathic dysfunctionosteopathic dysfunctionsosteopathic dysfunktionosteopathic educationosteopathic efficacyosteopathic emergency medicineosteopathic emergency physiciansosteopathic emergency techniqueosteopathic evaluationosteopathic examosteopathic examinationosteopathic family physiciansosteopathic findingsosteopathic general surgery programosteopathic glossaryosteopathic healthcareosteopathic heritageosteopathic historyosteopathic hospitalsosteopathic identityosteopathic informationosteopathic institutionsosteopathic international allianceosteopathic interventionosteopathic journalosteopathic lesionosteopathic lesion,osteopathic libraryosteopathic liver decongestion techniqueosteopathic lymph drainageosteopathic lymphatic techniquesosteopathic manipulationosteopathic manipulation treatmentosteopathic manipulative medicineOsteopathic manipulative medicine (OMM)osteopathic manipulative medicine curriculumosteopathic manipulative techniquesosteopathic manipulative therapyosteopathic manipulative treatmentosteopathic manipulative treatment (omt)osteopathic manual practitionerosteopathic manual therapyosteopathic manual treatmentosteopathic medical conference and expositionosteopathic medical educationosteopathic medical licensingosteopathic medical professionosteopathic medical schoolosteopathic medical schoolsosteopathic medical studentosteopathic medical studentsosteopathic medicineosteopathic medicineosteopathic medicine studentsosteopathic methodsosteopathic modelosteopathic modelsosteopathic neuromusculoskeletal medicineosteopathic officeosteopathic organizationosteopathic palpationosteopathic palpatory testosteopathic patientsosteopathic perception nursesosteopathic philosophyosteopathic philosophy and manipulation enhancement programosteopathic physiansosteopathic physical examosteopathic physicianosteopathic physiciansosteopathic physiotherapistosteopathic postural assessmentosteopathic practiceosteopathic practicesosteopathic practionerosteopathic principlesosteopathic principles and practiceosteopathic principles and practicesosteopathic private practicesosteopathic proceduresosteopathic professionosteopathic recognitionosteopathic recognition trackosteopathic researchosteopathic research infrastrucureOsteopathic Research Innovation Networkosteopathic residentsosteopathic rhythmic resitive duction therapyosteopathic sacral testsosteopathic sanatoriumosteopathic schoolosteopathic schoolsosteopathic scienceosteopathic self-treatmentosteopathic societiesosteopathic societyosteopathic specialistsosteopathic spinal manipulationosteopathic statusosteopathic structural clinical examosteopathic structural examosteopathic structural examinationosteopathic studentsosteopathic studiesosteopathic surgeryosteopathic teacherosteopathic teachingosteopathic techniquesosteopathic terminologyosteopathic testosteopathic testsosteopathic theoriesosteopathic therapyosteopathic traditionosteopathic trainingosteopathic training programsosteopathic treatmentosteopathic treatment for childrenosteopathic treatment modalitiesosteopathic treatment techniqueOSTEOPATHIC TRIALosteopathic trinityosteopathic universityosteopathic vagus nerve stimulation periaqueductal greyosteopathic valuesosteopathic visceral manipulationOsteopathieosteopathsosteopathyosteopathy clinical teaching questionnaireosteopathy consultationosteopathy educationosteopathy in the cranial fieldosteopathy in the district of Bregenzosteopathy physiciansOsteopathy Research Connect-New Zealandosteopathy studentsosteopatic manipulative treatmentosteoporosisosteosarcomaOsteothekosteotomyOSTLIBostmed.dr(r)oswestry disability indexotalgiaotitis mediaotitis media with effusionotoconiaotolaryngologyotorhinolaryngologic diseasesotorhinolaryngologyoutcome and process assessmentoutcome assessmentoutcome measureoutcome measuresoutcomesoutpatientoutpatient clinicoutpatientsovarian cancerovarian veinoveractive bladderoverarching-approach to healthcareoverbiteoverconfidenceoverdose preventionoverstatementsovertrainingoveruse injuryoveruse syndromeoverview of literatureown healing mechanismsoxidative stressoximetryoxygenoxygen consumptionoxygen inhalation therapyoxygen saturationoxygen therapyoxygen uptakeoxyphilic adenomaoxytocinoxytocin systemp-value fallacyP. J. LamersdorfP. KimberlyP. MisslinP. RidderP. SchwindP. TozziP. WikusPacific peoplepad testpaediatricpaediatric gastroenterologypaediatric hospitalspaediatric residency programpaediatricsPaget-Schroetter syndromepainpain and organ therapypain assessmentpain beliefspain catastrophisingpain clinicspain conditionspain controlpain degreepain durationpain impactpain inhibitory systemspain intensitypain levelspain managementpain measurementpain neurophysiologypain neuroscience educationpain perceptionpain pressure thresholdpain pressure thresholdspain preventionpain processingpain provocation testspain reliefpain research registrypain scalepain scalespain sciencepain scorepain syndromepain syndrome of minor pelvispain therapiespain thresholdpainDETECT questionnairepainful bladder syndromepainkillerspaintingspalatal disjunctionpalatine bonepalatine tonsilspaleontologypalliative carepalliative therapypalm healingPalmerpalmitic acidspalpationpalpation skillspalpatory diagnosispalpatory examinationpalpatory findingspalpatory testpalpatory testspalpebral fissure widthpamphletspancreaspancreatic diseasespancreatic stimulationpandemicpandemicspangolinpanic attackpanic attackspanic disorderpanic disorderspapillomavirus infectionspapillomavirus vaccinesparadigmsparaesophageal herniaparafunctionparallel accreditationparalympicsparalytic ileusparanasal sinusesparaplegiaparasomniaparaspinalparaspinal inhibitionparaspinal musclesparasympatheticparasympathetic effectparasympathetic nervous systemparasympathetic systemparasympathic activationparathyroid glandsparavaginal defectspareidoliaparent-child relationsparental leaveparentingparentsparents of minor patientsparesthesiaparietal peritoneumparietal pleuraParkinsonParkinson diseaseParkinson's syndromeParkinsons diseaseParkinson’s diseaseparotid glandparotitisparoxetinepart-time workpartial anomalous pulmonary venous returnpartial reimbursementpartial total lesionpartial visual impairmentparticle repositioningpartient-reported outcomesparturitionpass ratespassive mobilitypassive mobilizationpassive motionpassive motion palpationpassive motion testpassive regional motion inputpassive stretchingpastoral carepatellapatella compression syndromepatellar tendinopathypatellofemoral dysfunctionpatellofemoral pain syndrompatellofemoral pain syndromepatellofemoral syndromepaternity leavepathoanatomical factorspathogenesispathogenesis of painpathological cryingpathologypathophysiologypatientpatient acceptancepatient acceptance of health carepatient adherencepatient advocacypatient attitudepatient carepatient care planningPatient Care Teampatient compliancepatient datapatient decision makingpatient dischargepatient dropoutspatient educationpatient encounterpatient expectationpatient expectationspatient experiencepatient harmpatient historypatient informationpatient interactionpatient interviewpatient labspatient managementpatient outcomepatient outcome assessmentpatient outcomespatient perceptionpatient perception measurepatient positioningpatient preferencepatient preferencespatient profilepatient protection and affordable care actpatient questionairepatient referralspatient rehabilitation advicepatient relationshippatient report outcome measurepatient reported outcomepatient reported outcome assessmentpatient reported outcome measurespatient reported outcomespatient reportspatient retentionpatient rightspatient roundspatient safetypatient satisfactionpatient selectionpatient simulationpatient subgroupspatient surveyspatient viewpatient visitpatient-centered carepatient-centered medical homepatient-centerednesspatient-practitioner dyadpatient-reported outcomespatientspatients communicationpatients educationpatients expectationpatients interviewingpatients needpatients of elderly and senile agepatients perceptionpatients perspectivepatterns of movementPaul ChauffourPCOSPCSpeak expiratory flowpeak expiratory flow ratepectalgic syndromepectoralis minorpectoralis musclespectus excavatumpedagogical diagnosispedagogypedal pumppedal pump techniquepediatricpediatric bone fracturepediatric conditionspediatric headachepediatric hospitalspediatric oncologistpediatric oncologypediatric osteopathypediatric patientspediatric residency programpediatric surgerypediatric workforcepediatricianspediatricspee physical examinationpeerpeer physical examinationpeer reviewpeer-reviewed journalspegpeliability estimationpellagrapelvicpelvic adhesionspelvic anatomypelvic asymmetrypelvic bonespelvic compression testpelvic diagnosispelvic diaphragm dysfunctionpelvic disorderspelvic examinationspelvic floorpelvic floor assessmentpelvic floor disorderpelvic floor dysfunctionpelvic floor muscle trainingpelvic floor musclespelvic floor releasepelvic floor trainingpelvic girdlepelvic girdle painpelvic landmarkspelvic malalignmentpelvic obliquitypelvic organpelvic organ prolapsepelvic painpelvic pain syndromepelvic regionpelvic rotationpelvic torsionpelvic upslippelvic-thyroid cyclepelvicthyroid-adrenal syndromepelvispelvis in balancepelvis spatial orientationsPEMFPennsylvaniapens planuspentosan sulfuric polyesterPEPTpeptic ulcerpeptic ulcer diseaseperceived weightperceptionperception channelsperception disorderperception of motionperception processperceptionsperceptual biasperceptual inferenceperennial allergic rhinitisperfect medicineperformanceperformance assessmentperformance biasperformance evaluationperformance increaseperforming arts medicineperfusionperiarthritisperiarthritis humeroscapularisperiarthritis of the shoulderperiarthropathia humeroscapularispericardiumperichondritisperihepatitisperimenopauseperinatal careperinatal damage of the nervous systemperinatal factorsperinatal lesionsperinatal outcomesperiodicalsperiodontitisperiodontiumperipheral arterial diseaseperipheral artery diseaseperipheral nerveperipheral nerve hyperexcitabilityperipheral nervesperipheral nervous systemperipheral nervous system diseasesperipheral neuropathyperipheral skin blood flowperipheral vascular diseaseperipheral vascular diseasesperipheral vestibular vertigoperipheral visionperitoneal adhesionperitoneal adhesionsPeritoneumperivascular tissueperiventricular leukomalaciaperoneal nerveperoneal nerve paresthesiaperoneus brevisPerrin techniquePerrin-techniquepersistent painperson-centeredperson-centered careperson-centered languagepersonal accomplishmentpersonal financingpersonal satisfactionpersonalitypersonality analysispersonality developmentpersonality testspersonnel selectionpersonnel staffing and schedulingpertussisPeruPeruvian culturepes anserine bursitispes planovalgusPFPSpharmacologic treatmentpharmacological therapypharmacologypharmacology programpharmacotherapypharmacypharmacy educationpharynxphase shiftPhD thesisphenobarbitalphenodynamic osteopathyphenomenologicalphenomenological anthropologyphenomenological studyphenomenologyphenomenology of consciousness inventoryPhiladelphia College of Osteopathic MedicinephilatelyphiliosophyPhilip E. Greenmanphilosophical phenomenologyphilosophyphilosophy of osteopathyphonoticsphosphatidylinositol 3-kinasephotographyphototherapyphrenic nervephrenologyphthalazinesphylogeneticphysical activityphysical assessmentphysical changesphysical contactphysical effectphysical examinationphysical exertionphysical fitnessphysical functionphysical healthphysical lawsphysical medicinephysical stimulationphysical symptomsphysical therapies treatmentphysical therapistsphysical therapyphysical therapy modalitiesphysical therapy specialtyphysical therapy techniquesphysicalityphysicianphysician assistantsphysician empathyphysician executivesphysician impairmentphysician incentive plansphysician posturephysician recommendationphysician specialtyphysician-patient relationsphysician-patient-relationsphysiciansphysicians practice patternsphysician–patient communicationphysicsphysiobalneotherapyphysiologic parametersphysiologicalphysiological adaptationphysiological changesphysiological effectphysiological functionphysiological measurementsphysiological prioritiesphysiological reactionphysiological responsephysiological responsesphysiological sexual dysfunctionphysiological stressphysiologyphysiology of agingphysiopathologyphysiotherapeutic treatmentphysiotherapistphysiotherapistsphysiotherapyphysiotherapy educationphytotherapyPIC syndromepickleballpicture of anatomypiercingsPierre Robin syndromepiezoelectricitypilot projectpilot projectspilot studiespilot studypilot trialpimary care providerspineal glandpipeline programspiperidinesPIRpiriformis musclepiriformis muscle stretchingpiriformis muscle syndromepiriformis syndromePischingerpitchingPitt-Hopkins syndromepituitary glandpitypityriasis lichenoides chronicaplaceboplacebo controlplacebo effectplacebo responseplacebosplacement torticollisplagiarismplagiocephalieplagiocephalometric toolplagiocephalusplagiocephalyplagiocephaly nonsynostoticplagyocephalyplant extractsplantar fasciaplantar fasciitisplantar heel painplantar heel spurplantar pressureplantar pressuresplasmatic ammoniaplastic surgeryplasticityplatelet aggregation inhibitorsplatelet-rich plasmaplatelet-rich plasma injectionsplatformsplatonic solidplatysmaplaying-related musculoskeletal disorderspleomorphic dermal sarcomaplethysmographypleura domepleura parietalispleural cavitiesplica band syndromeplural medical systemsplurality of truthPMPSPMSPNEpneumatisationpneumonectomypneumoniapneumonia infectionpneumothoraxPNFPOCUSpodcastpodcastspodiatric medicinepodiatrypoetrypoint of balancepoint of entrypoints of referencepolicypolicy makingpolitical action committeepoliticsPolitics of public healthcare systemspolyarthralgiapolycystic ovarian syndromepolycystic ovary syndromepolycystic ovary syndrome (PCOS)polycythemia verapolymerspolymodal channelpolyostotic fibrous dysplasiapolysomnographic recordingspolysomnographypolysynaptic reflex excitabilitypolyunsaturated alkamidespolyvagal theorypolyvagal-theorypompagespoor methodologypopulation dynamicspopulation healthpopulation surveillanceport-wine stainportal veinportfolioPortugalportuguese osteopathspositionposition assisted combination techniqueposition reactionspositional lesionpositional plagiocephalypositional release techniquepositional release therapypositioningpositive environmental experiencepost COVIDpost COVID-19post fascial treatmentpost herpetic neuralgiapost isometric relaxationpost isometric relaxation techniquepost mastectomy painpost menopausalpost micturitionpost operative painpost partumpost surgery painpost traumatic stress disorderpost-concussion symptomspost-concussion syndromepost-concussive syndromepost-covidpost-covid syndromepost-graduate educationpost-graduate trainingpost-hospital treatmentpost-intensive care syndromepost-isometric relaxationpost-mastectomy pain syndromepost-menopausal womenpost-menopausepost-operativepost-operative carepost-operative disabilitypost-operative follow-up carepost-operative ileuspost-puncture syndromepost-sternotomy painpost-stroke periarthropathypost-surgicalpost-surgical carepost-surgical rehabilitationpost-traumaticpost-traumatic coccygodyniapost-traumatic contracturespost-traumatic headachepost-traumatic neck injurypost-traumatic pain syndromepost-traumatic stress disorderpost-truthpost-urological statuspost-vacpostcardspostcholecystectomy syndromepostconcussion symptomspostconcussion syndromepostconcussive symptomsposterposter awardposter presentationposteriorposterior bodyposterior cingulate cortexposterior cortical atrophyposterior cruciate ligamentposterior longitudinal ligamentposterior rib dysfunctionposterior rib tenderpointsposterior static chainposterior staticspostero-anteriorposterspostgraduate educationpostgraduate trainingpostherpetic neuralgiapostisometric relaxationpostmastectomy lymphedemapostmenopausal osteoporosispostmenopausepostnatal adjustment disorderpostnatal carepostnatal emotional disorderpostnatal/-partal depressionpostnatal/-partal dysphoriapostoperativepostoperative adhesionspostoperative carepostoperative complicationpostoperative complicationspostoperative hypoparathyroidismpostoperative ileuspostoperative painpostoperative periodpostpartal problemspostpartumpostpartum painpostpartum periodpostpuncture complaintspostsugical painpostsurgical painpostthoracotomypostthoracotomy painposttraumatic headacheposttraumatic spinal cord lesionposttraumatic stress disorderpostural and dentoarthrogen athiologypostural asymmetrypostural balancepostural conceptpostural controlpostural diseasepostural imbalancepostural neck painpostural orthostatic tachycardia syndromepostural plagiocephalypostural positionpostural reactionspostural stabilitypostural strategypostural systempostureposture diagnosispostvasectomy pain syndromepotencyPOTSpovertypowerpower dynamicspower transmissionpowerliftingpptpractical componentpractical nomenclaturepracticepractice administrationpractice characteristicspractice guidelinepractice guidelinespractice locationpractice managementpractice patternspractice questionspractice rightspractice standardspractice theorypractice-based learningpractice-based researchpractice-based research networkpracticespractitionersPrader-Willi syndromeprae- and postganglionic centerspraevertebral gangliapragmatic randomized controlled trialspragmatismpranayamapratice-based research networkPratiques en santeprayerpre-exposure prophylaxispre-illnesspre-medical studentspre-menopausal womenpre-operative carepre-operative spinal conditionspre-surgerypre-tensionpre-term deliveryprebornpreceptorshipprecision medicineprecision-based exercisepreclinicalpreclinical curriculumpreclinical trainingpreclinical yearpreconsciousnesspredictive codingpredictive factorspredictive modelpredictive processingpredictive valuepredictive value of testspredictor-studypredictors of successpredoctoral teachning fellowship programpreference signalingpreferencespregnancypregnancy complicationspregnancy outcomepregnancy ratepregnancy related low back painpregnancy related painpregnancy related pelvic girdle painpregnancy related pelvic painpregnant uteruspregnant womenprejudicepremanipulative screeningprematriculationprematurepremature birthpremature childpremature infantpremature infantspremature newbornpremature obstetric laborprematuritypremedicalpremedical educationpremedical rural enrichmentpremedical shadowingpremedical studentspremenopausepremenpausal womenpremenstrual dysphoric disorderpremenstrual syndrompremenstrual syndromeprenatal alcohol exposureprenatal careprenatal psychologyprenatal substance exposurepreoperative carepreoperative preparationpreparationpreparationspreparatory coursepreparednesspreparedness for practicepresbyopiapreschool childprescriptionprescription exercisepresencepresentationpreserved ejection fraction exacerbationspressor algometrypressurepressure feedbackpressure hierarchypressure pain sensitivitypressure pain thresholdpressure pain thresholdspressure regulationpressure sensorspressure strengthpressure thresholdpressure-pain thresholdpressure/adverse effectspretermpreterm infantpreterm infantspreterm laborpreterm newbornspretest posttest designprevalencepreventionprevention of overworkprevention strategiespreventivepreventive cardiologypreventive carepreventive medicinepreventive workPribadi-Upleger’s signPriener abduktions testprimary and secondary sourcesprimary biliary cholangitisprimary biliary cirrhosisprimary careprimary care choiceprimary care clinical preceptorsprimary care physiciansprimary care servicesprimary coxarthrosisprimary dysmenorrheaprimary dysmenorrhoeaprimary epiploic appendagitis (pea)primary familial brain calcificationprimary familial brain calcification ogaprimary headacheprimary headache disordersprimary headachesprimary health careprimary hyperparathyroidismprimary immunodeficiencyprimary lateral sclerosisprimary lesionprimary leverprimary medical careprimary nocturnal enuresisprimary open-angle glaucomaprimary preventionprimary respirationprimary respiratory mechanismprimatesprincipleprinciple of correctionprinciplesprinciples of lifeprinciples of osteopathyprioritiesprisonprivate collegesprivate equityprivate health insurersprivate officeprivate practiceprivate sectorPRMprobabilityprobiotic agentproblem-based learningproblemsPROCareproceduresprocess approachprocessesprocessus styloideusproductivityprofesional ethicsprofessionprofessionalprofessional artistryprofessional associationsprofessional autonomyprofessional burnoutprofessional competenceprofessional developmentprofessional educationprofessional ethicsprofessional experienceprofessional identificationprofessional identityprofessional imageprofessional knowledgeprofessional languageprofessional misconductprofessional musiciansprofessional policyprofessional politicsprofessional practiceprofessional practice locationprofessional profileprofessional registrationprofessional relationshipprofessional review organizationsprofessional roleprofessional self-conceptionprofessional staff committeesprofessional statusprofessional valuesprofessional websitesprofessional-patient relationsprofessionalisationprofessionalismprofessionalizationprofessional–patient relationsprofessionsprofileprogesteroneprognosisprognostic trialsprogram developmentprogram evaluationprogramsprogressive infantile scoliosisprogressive massive fibrosisprogressive muscle relaxationprojectsprolactinprolapseprolapsed intervertebral discprolonged laborprolotherapyPROMPROMOTE studypromotionPROMsprone positionpronounsproof of conceptprophylaxisproportionalityproprietary health facilitiesproprioceptionproprioceptive coherenceproprioceptive neuromuscular facilitationproprioceptive neuromuscular facilitation stretchingproprioceptive systemprosopalgiaprosopographical studyprospective studiesprostaglandinsprostateprostate cancerprostate disordersprostate manipulationprostatic hyperplasiaprostatitisprosthetic joint infectionprotease inhibitorsprotective devicesprotein expressionprotein hydrolysateprotein kinase cprotocolproviderprovider educationprovocation testproximity operatorsPRTprurigo nodularisprurituspseudo sciaticapseudoradicular painpseudosciencepsoas major musclepsoas musclepsoas musclespsoas syndromepsoriasis vulgarispsoriatic arthritispsychepsychiatric disorderpsychiatric disorderspsychiatric status rating scalespsychiatristspsychiatrypsycho analysispsycho emotional traumapsychoemotional statepsychoemotional traumapsychogenic adipsiapsychologic disorderpsychologic disorderspsychologicalpsychological adaptationpsychological aspectspsychological characteristicspsychological effectspsychological factorspsychological fieldpsychological functionpsychological interventionpsychological modelspsychological sexual dysfunctionpsychological stresspsychological testspsychological treatmentpsychologistspsychologypsychometric propertiespsychometricspsychomotor developmentpsychomotor performancepsychomotor skillspsychomotricitypsychoneuroimmunologypsychophysical integrationpsychophysicspsychophysiologic disorderspsychosispsychosocialpsychosocial aspectspsychosocial factorspsychosocial growthpsychosocial interventionpsychosocial predictorspsychosocial working conditionspsychosomaticpsychosomatic diseasepsychosomatic disorderspsychosomatic osteopathypsychosomaticspsychotherapypsychotic disorderPterionpterygoid musclepterygopalatinepterygopalatine ganglionPTSDPTSD symptomspubertypuberty disorderpubic articulation discrepancypubic regionpubic symphysispubic symphysis joint shearspublic awarenesspublic healthpublic health carepublic health insurancepublic interestpublic opinionpublic perceptionpublic relationspublic sectorpublic service loan forgiveness programpublic speakingpublicationpublication processpublicationspublishingpudendal nervepudendal nerve entrapment syndromepudendal neuralgiapuerperal disorderspuerperiumpulmonary arterial hypertensionpulmonary arterypulmonary coccidioidomycosispulmonary diseasepulmonary diseasespulmonary edemapulmonary fibrosispulmonary functionpulmonary function testpulmonary mechanicspulmonary responsepulmonary symptomspulmonary tumorspulsepulse at restpulse oximeterpulse ratepulse-ratepulse-respiratory quotientpulsed electromagnetic field therapypump techniquespupilPVPSQ angleq-testQEEGqi gongqigongQLQ-C30quackeryquadratus lumborumquadrilateral spacequalitative data analysisqualitative interview studyqualitative researchqualitative research studiesqualitative studiesqualitative studyqualityquality assurancequality controlquality improvementquality of carequality of health carequality of healthcarequality of lifequality of reportsquality of servicesquality of sleepquality-managementquantitative monitoringquantitative researchquantitative sensory testingquantitative studyquantum physicsquarksQuebecqueckenstedt maneuverQueenslandquestionnairequestionnaire designquestionnaire developmentquestionnaire HAMquestionnaire self-reportquestionnairesquestionsR. BeckerR. C. FulfordR. EngelR. MolinariR. SchleipR. SienerR. van BuskirkR. VirchowR. Zegarra-ParodiR.P. Leeraceracial discriminationracial disparityracial inequityracing athletesracismradial head somatic dysfunctionradial nerveradiating leg painradiation exposureradiation fibrosisradiation oncologyradicular painradiculopathyradilogical diagnosisradioallergosorbent testradiographyradiography of the spineradiologic incidentradiological changesradiological examinationsradiologistsradiologyradon bathsRamsay Hunt syndromerandom blood sugarrandomised controlled trialrandomizationrandomized clinical pilot studyrandomized clinical trialrandomized control trialrandomized controlled clinicalrandomized controlled studyrandomized controlled trialrandomized controlled trial (topic)randomized controlled trialsrandomized controlled trials as topicrandomized placebo controlled trialrange of motionrankingRANTESraperapid diagnosis of adequate muscle effortrashrasterstereographyratrate of reactionratsRaynaud syndromerctre-findingsre-orientation processre?exotherapyreactionreaction timereactive anxietyreactive arthritisreactive oxidative speciesreactive oxygen speciesreading and spelling disabilityreading comprehensionreading disordersreading skillsreadmissionreadmission ratereal patient encounterreal-time ultrasoundreasoned actionreasoning processrecall biasreceding gumsreceptorsrecertificationreciprocal tension membranerecognitionrecoilrecoil techniquerecommendation letterreconstructive surgical proceduresrecordkeepingrecordsrecoveryrecovery of functionrecovery timerectal bleedingrectal polyprectus capitis posterior majorrectus capitis posterior minorrectus femorisrecurrencerecurrent acute otitisrecurrent cystitisrecurrent injuriesrecurrent low back painrecurrent musculoskeletal injuriesrecurrent otitis mediared flagsred reflex testred-reflexreduced ejection fractionreduced morbidityreduction of cranial dysfunctionsreductionismreference standardreference valuesreferralreferral and consultationreferralsreferred muscle painreferred painreflectionreflective practicereflective praxisreflective thinkingreflective writingreflexreflex receptive fieldsreflex sympathetic dystrophyreflex therapyreflexesreflexologyreflexotherapyrefluxrefractive disorderrefugeesrefundregenerationRegensburg Insomnia Scaleregio inguinalis dextraregion of residenceregional anatomyregional blood flowregression analysisregulationregulation disordersregulation of the autonomic nervous systemregulatorsregurgitationrehabilitationrehabilitation advicerehabilitation outcomereimbursementreimbursement incentivereimbursement practiceReiters syndromerelationshiprelative search interestrelative value scalesrelax responserelaxationrelaxation splintrelaxation techniquesreleaserelease maximumrelease of fight reactionrelease-techniquereliabilityreliability of resultsrelief workreligionremediationremembering colleaguesremissionremote consultationremote learningremote monitoringremote teachingremote workrenal artery obstructionrenal dysfunctionrenal fasciarenal fluid lossrenal hypertensionrenal impairmentrenal mobilityreoxygenationrepayment programrepayment programsrepeated injuriesrepetitive strain injuryreplicability crisisreportreportingreporting adverse eventsreporting guidelinesreports of patientsreposition errorrepresentationrepresentational inequityrepresentativesreprintreprint 1947reprint 1961reprint 1964reproducibilityreproducibility crisisreproducibility of resultsreproducibility of testsreproductibility of resultsreproductive healthresearchresearch appraisalresearch competencyresearch designresearch experienceresearch fundingresearch institutesresearch interestresearch methodsresearch networkresearch participationresearch personnelresearch prioritiesresearch productivityresearch protocolresearch qualityresearch questionresearch self-efficacyresearch subjectsresearch supportresearch topicsresearch wasteresearchersreserve capacityresidence characteristicsresidencyresidency and internshipresidency applicationresidency choiceresidency curriculumresidency programresidency programsresidency selectionresidency trainingresidentresident educationresidentsresidual painresidual volumeresilienceresistance trainingresolution 42resonanceresonant cell assembliesresource useresourcesrespirationrespiration raterespiratorrespiratoryrespiratory capabilitiesrespiratory circulatory modelrespiratory conditionsrespiratory depressionrespiratory diseaserespiratory diseasesrespiratory disordersrespiratory distressrespiratory dysfunctionrespiratory failurerespiratory functionrespiratory function testsrespiratory infectionrespiratory infectionsrespiratory insufficiencyrespiratory mechanicsrespiratory motionrespiratory muscle fatiguerespiratory muscle strengthrespiratory muscle trainingrespiratory musclesrespiratory physiological phenomenarespiratory pressurerespiratory raterespiratory systemrespiratory tractrespiratory tract diseasesrespiratory tract infectionsrespiratory volumerespiratory-circulatory modelresponses to treatmentresponsibilityrest painrest pulseresting activityresting breathingresting muscle tonerestless leg disorderrestless leg syndromerestless legs syndromerestlessnessrestorative justicerestorative medicinerestricted motionrestricted movementrestriction of elasticityrestriction of movementrestrictionsresultsretained colonretentioretentionretention ratesreticular rhythmreticuloendothelial systemretinal nerve fiber layer thicknessretinoblastomaretinoscopyretrainingretrospective analysisretrospective cohort studyretrospective studiesretrospective studyretrovesical pouchreturn to workreviewreview literaturerevision materialsreward deficiency syndromerewarding systemrhabdomyolysisrheologyrheumatic diseasesrheumatismrheumatoid arthritisrhinitisrhinoconjunctivitisrhinosinusitisrhodopsinrhomboidrhythmrhythmic movementrhythmic oscillationrhythmicityrhythmsribrib cagerib disordersrib dysfunctionrib dysfunctionsrib fracturerib mechanicsrib painrib raisingrib raising techniquerib releaserib somatic dysfunctionrib-vertebral jointsribcageribsright hepatic arteryright to dierigidityriskrisk assessmentrisk factorrisk factorsrisk managementrisk of biasrisk of intubationrisk predictionrisk-takingrisksrisser castriver of lifeRL1-803rlq painRLSRobert FulfordroboticsROIrole playrolfingrolfing methodroll-glidingRollin BeckerRomaniaroot canalroot canal procedureroot of the mesenteryroot treatmentrootsrosacearotationrotation of the cervical spinerotation strengthrotator cuffrotator cuff intervalrotator cuff reconstructionroundsroutine examinationroutine findingsroutine physical therapyrowingrs-fMRIrugbyrule of the arteryrule of threerunnerrunnersrunners kneerunningrunning gaitrunning sportsruptureruralrural and urban scholars pathways programrural arearural healthrural health carerural health care systemrural health servicesrural healthcarerural hospitalsrural medicinerural populationRussiarussianrussian massageRussian Osteopathic JournalS. CastagnaS. FieldingS. OsborneS. Typaldossacral basesacral base levelingsacral base unlevelingsacral bony landmarkssacral canalsacral dura matersacral dysfunctionsacral flexion testsacral fracturesacral insufficiency fracturesacral listeningsacral mobilizationssacral motionsacral plexussacral sagsacral shearsacralization LVsacro-cranial osteopathysacro-iliacsacro-iliac jointsacro-iliac joint dyfunctionsacro-iliac joint painsacro-iliac painsacro-iliac regionsacro-lumbar jointsacrococcygeal articulationsacrococcygeal regionsacrococcygeal symphysissacroiliacsacroiliac dysfunctionsacroiliac imagingsacroiliac jointsacroiliac joint ankylosissacroiliac joint assessmentsacroiliac joint blockadesacroiliac joint disordersacroiliac joint dysfunctionsacroiliac joint fixationsacroiliac joint fusionsacroiliac joint painsacroiliac joint shearssacroiliac painsacroiliac regionsacroiliitissacrospinal ligamentssacrotuberous ligamentsacrotuberous ligamentssacrumsacrum positionsafeguardingsafetysafety managementsafety testsafteysagittal balancesagittal planesalessales taxsalivasalivary cortisolsalivary cortisol scoresalutogenesissamplingsanatorium resort treatmentSAPSsarcomasarcopeniaSARS-2Sars-Cov-2SARS-CoV2satisfactionsatisfaction with lifesaving of costsSBSSBS lesion patternsSBS monitoringSBS strain patternsScalene entrapment syndromescalesscandalsscapularscapular syndromescapulothoracic gliding rhythmscapulothoracic mechanicsscarscar tissuescar treatmentscarletscarlet feverscarsscent dogsschedulingschematic model of the spineschismschizophreniaScholar 12scholarshipscholarshipsschool admission criteriaschool comparisonschool selectionschoolssciatic nervesciatic nerve entrapmentsciatic neuritissciatic neuropathysciatic painsciaticasciencescientific basisscientific journalscientific methodscientific proofscientific publicationscientific researchscientific workscientific writingscientometric analysisSCIWORAsclerosing solutionssclerotomesclerotomesscoliosisscope of practicescoping reviewscoring rubricscoring systemScott Memorial Lecturescreamingscreaming babyscreen timescreeningscreening compliancescreening toolscript concordance testscrotal painscrotumsealsearch enginesearch for truthsearch trendsseasicknessseasonal allergicseatbelt signseated flexion testsecond posterior sacral segmentsecondary headache disorderssecondary infertilitysecondary leversecondary lymphatic oedemasecondhand smokesectio caesareasedativessedentary workersseeking handssegmental controlsegmental dysfunctionsegmental examinationsegmental innervationsegmental motion testsegmental motor controlseizuresselectionselective estrogen receptor modulatorsselective injections of pharmaceuticalsself administrationself assessmentself careself efficacyself payingself perceptionself regulationself reportself-acknowledged limitationsself-assessmentself-careself-destructionself-determinationself-directed learningself-directed practiceself-discoveryself-efficacyself-exercisesself-healingself-healing powerself-helpself-help approachesself-help techniquesself-imageself-interestself-knowledge/-awarenessself-management strategiesself-measurementself-mobilizationself-organisationself-perceived perceptionself-perceptionself-recoveryself-recovery processesself-reflectionself-regulated learningself-regulationself-similarityself-trainingself-treatmentselfesteemselforganizationselfregulationsemantic datasemanticssemi structured interviewsemilunarseminarsence of touchsensationsensesense of touchsense-makingsensingsensitivitysensitivity and specificitysensitizationsensomotoric trainingsensorsensorimotorsensorimotor developmentsensorimotor functionsensorimotor systemsensorimotor trainingsensorineural hearing losssensory illusionsensory integrationsensory integration syndromesensory nervesensory perceptionsensory thresholdssentinel surveillancesepsisseptic pulmonary embolisequencingserenoaseriousserious adverse eventsserotoninserotonin receptor agonistsserotonin uptake inhibitorsserratus anteriorserum zinc concentrationservice deliveryservice developmentservice learningservice-learningsevere acute respiratory syndromeseverity of illness indexsex characteristicssex distributionsex factorssexual abusesexual actsexual assaultsexual behaviorsexual educationsexual harassmentsexual identitysexual minoritiessexual orientationsexual violencesexualitySF-36shadowingshamsham controlsham control interventionsham interventionssham proceduresham therapysham treatmentshamanismshameshared decision makingsharing informationsharp painShawneeshear forcesshear wave elastographysheepshiftshift methodshift workshift workershift workflow productionshiftingshifting fulcrumshin splintshinglesshockshock wave therapyshoeshoe insertshoesshort assessment of patient satisfactionshort hamstring syndromeshort leg syndromeshort lever techniqueshort-form Headache Impact Test (HIT-6)short-latency somatosensory evoked potentialsshort-lever techniqueshortness of breathshouldershoulder capsulitisshoulder dislocationshoulder dislocationsshoulder dysfunctionshoulder exercisesshoulder girdleshoulder girdle structuresshoulder hand syndromeshoulder impingement syndromeshoulder injuriesshoulder jointshoulder joint dysfunctionshoulder joint painshoulder manipulationshoulder mobilityshoulder outlet impingementshoulder painshoulder pain and disabilityshoulder postureshoulder treatmentshoulder-arm painshoulder-arm-syndromesick leavesickle cell diseaseside effectside effectsside-bendingside-effectsidebendingSIDSsighsighing dyspnoeasigmoid colonsign languagesignal transductionsignalingsignificancesignificant detectorSIJ mobilitysilent inflammationsimilaritiessimplicitysimulated learningsimulated patientsimulationsimulation equipmentsimulation technologiessimulation trainingsimulation-based encountersSinding-Larsen–Johansson syndromesine-osteosingersingingsingle accreditationsingle accreditation systemsingle leg balancesingle system research designsingle-blind methodsingultussinussinus lactiferussinus painsinus pressuresinus surgerysinusitissirvaSister Mary Joseph nodulesittingsitting flexion testsituation analysissitus ambiguussitus inversusSjögren’s Syndromeskatersskeletalskeletal muscleskiersskiingskillskill gapsskills transferskinskin biopsyskin blood flowskin blood flow indexskin burning sensationskin cancerskin changesskin conductanceskin diseaseskin diseasesskin disorderskin fragilityskin lesionsskin microcirculationskin neoplasmsskin rashskin temperatureskin testsskin tonesskin ulcerskinconductivityskullskull baseskull deflectionskull deformitiesskull zonessleepsleep apneasleep apnea syndromessleep bruxismsleep deprivationsleep disordersleep disorderssleep disturbancesleep disturbancessleep initiation and maintenance disorderssleep qualitysleep wake disorderssleep-wake rhythmsleepingsleeping disorderssleeping positionsliding herniasliding systemsling exercises trainingslipped capital femoral epiphysisslipping rib syndromeslow fluctuations inside cranial cavityslow thrust techniqueslow vital capacitySLRslump testslumsslurringsmall bowel obstructionsmall businesssmall intestinesmallpoxsmartphonesmartphone usesmellsmokerssmokingsmoking cessationsmoking preventionsmooth muscleSMTsnapping hip syndromesneezingSOAP notessoccersoccer playersoccer playerssocial acceptancesocial aspectssocial backgroundsocial behaviorsocial bonds and competencysocial capitalsocial changesocial competencesocial deprivationsocial determinants of healthsocial developmentsocial engagement systemsocial factorssocial historysocial identificationsocial interactionsocial isolationsocial justicesocial mediasocial missionsocial networksocial perceptionsocial responsibilitysocial securitysocial supportsocial valuessocial workersocializationsociocultural health assumptionssociodemographic factorssocioeconomic factorssocioeconomic statussociopoliticssocket-switched connectionsoft (Gilmore’s) groinsoft skillssoft tissuesoft tissue manipulationsoft tissue massagesoft tissue mobilizationsoft tissue painsoft tissue sarcomasoft tissue techniquesoft tissue techniquessoft tissuessoftballsoftwaresolar keratosissolar plexussoldierssolesoleus t reflexsolitary pleural fibrous tumorsomaticsomatic complaintssomatic dysfunctionsomatic dysfunctionssomatic experiencingsomatic markersomatic memorysomatic pelvic dysfunctionsomatic psychesomatic symptom disordersomatic symptomssomatic tinnitussomatic-emotional dysfunctionsomatic-energetic-psychic dysfunction patternssomatisationsomato-visceral reflexsomatoemotional releasesomatoform autonomic dysfunctionsomatoform disorderssomatoform dysfunctionsomatoform dysfunctionssomatosensory evoked potentialssomatosympathetic innervationsomatovisceral reflexsomatovisceral responsesomatovisceral sensory systemsomitessomnolencesonoelastographysonographysoping reviewsopranosore throatsoulsoundsound wavesSouth AfricaSouth AmericaSouth Tyrolspacespace travelspace-timespaced retrieval practiceSpainSpanishSpanish flu pandemicSpanish influenzaspasmspasmodic torticollisspastic hemiparesisspastic paresisspasticityspatial dimensionspatial learningspeakingspecial issuespecial needs childrenspecializationspecialty boardspecialty boardsspecialty choicespecialty trainingspecific adjustmentspecific effectsspecific laryngeal manipulationspecificityspeckle trackingspectroscopyspeechspeech acousticsspeech delayspeech developmentspeech development disordersspeech disorderspeech disordersspeech impairmentspeech therapyspeed of blood flowspelling disordersspencer techniqueSpencher techniquespermatozoaspheno-basilar synchondrosisspheno-occipital junctionspheno-occipital synchondrosisspheno-occipital synostosissphenobasilar symphysissphenobasilar synchondrosissphenobasilar synchondrosis lesionssphenobasilar synostosissphenobasilarissphenoidsphenoid bonesphenoid sinussphenooccipital synchondrosissphenopalatinesphenopalatine gangliasphenopalatine ganglionsphenopalatine ganglion blocksphygmic diagnosticssphygmomanometersphygmomanometryspinspina bifidaspina bifida occultaspinalspinal accessory nervespinal anesthesiaspinal asymmetryspinal biomechanicsspinal canal stenosisspinal columnspinal column heightspinal complaintsspinal cordspinal cord compressionspinal cord diseasesspinal cord injuriesspinal cord injuryspinal cord injury without radiographic abnormalityspinal cord lesionspinal cord-peritoneum anglespinal curvaturespinal diseasesspinal diskspinal disk herniationspinal duraspinal extension programspinal facilitationspinal flexibilityspinal fusionspinal imagingspinal impairmentspinal injectionspinal injuriesspinal joint assessmentspinal lesionspinal ligamentsspinal manipulationspinal manipulationsspinal manipulative therapyspinal manual therapyspinal mechanicsspinal mobilityspinal mobilizationspinal motionspinal mousespinal musclesspinal nervesspinal painspinal rootsspinal segments D12 – L2spinal sonographyspinal stabilisationspinal stenosisspinal structurespinal trigeminal nucleusspinale facilitationspindle-cell neoplasmspinespine findingsspine immobilityspine mobilityspine shape parametersspine tango conservative registry data collectionSpine Tango Conservative registry data collection toolspinelinerspinous processspiralspiritspiritual dimensionspiritual dimension in healthcarespiritual therapiesspiritualityspirometerspirometric parametersspirometryspironolactonesplanchnicsplanchnic circulationspleensplenic cystsplenic pump techniquesplenic pump techniquessplenic rupturesplintssplit skinSPO2spondylarthritisspondylodiscitisspondylolisthesisspondylosisspondylosis facetspontaneous abortionspontaneous fracturesspontaneous releasesportsport climbingsport medicinesport psychologysportssports injuriessports injurysports medicinespotted fever rickettsiosissprains and strainssprintsprintingSQOR-V questionnainnairesquatting jump testsquintsquint anglesreeningSSDstabilitystabilizationstabilization exercisesstabilization phasestabilographystabilometric platformstabilometrystaffstance phasestand-alone coursestandard carestandard EN ISO 9001:2000standard medical carestandard pulmonary rehabilitationstandardisationstandardisation of osteopathic curriculastandardised data collectionstandardizationstandardized data collectionstandardized patientstandardized patientsstandardized testingstandardsstandards in education of osteopathsstanding flexion teststanding forward flexion teststanding-flexion-teststarting positionstate governmentstate medical licensingstate of anxietystatementstates of activitystaticstatic baropodometrystatic stretchingstatic touchstatic touch interventionstatin associated muscle symptomsstatinsstatistical datastatistical data interpretationstatistical significancestatisticsstatodynamic stereotypestatusstatus hierarchystatus post abortusstatutory health insurancestatutory health insurance companiesstellate ganglionSTEMstem cellsSTEM fieldsstenosisstentssteopathyStep 1stereoidssterilitysterilizationsternal bracesternal brace maneuversternal manipulationsternal painsternal recoil techniquesternochondroplastysternoclavicular jointsternocleidomastoidsternotomysternumsteroid injectionsteroidsstiff and painful shoulderstiff person syndromeStiff-person syndromestiffnessstigmastigmatising patientsstill pointStill techniqueStill techniquesStill-Hildreth Sanatoriumstillnessstillpointstimulantsstimulating palatal platesstomachstomach ulcerstomathognathic systemstomatognathic systemstoolstoragestrabismStrachan-modelstraight back syndromestraight leg raise teststraight leg raising teststraightened cervical-thoracic junctionstrainstrain and counterstrainstrain counter strainstrain counterstrainstrain counterstrain techniquestrain elastographystrain reliefstrain shorteningstrain transmissionstrain-counterstrain techniquestrain/counterstrain techniquestrainsstrain–counterstrainstrategiesstrategystreet medicinestrenghtening factorsstrengthstrength trainingstrengthening exercisesstreptococcus pneumoniaestressstress disordersstress fracturestress incontinencestress managementstress reductionstress responsestress urinary incontinencestretch receptor organsstretch reflexstretch techniquestretching exercisesstriae distensaestridorstrokestroke complicationsstroke rehabilitationstroke survivorstructural approachstructural asymmetrystructural examinationstructural hierarchystructural integritystructural modelstructural osteopathystructural pelvic functionstructurestructure and functionstructure-functional relationshipstructured learningstructured reflective praxisstruggling learnersstudent athletesstudent attitudesstudent debtstudent diagnostic skillsstudent engagementstudent loansstudent osteopathy clinicstudent policystudent research projectsstudent satisfactionstudent selectionstudent trainingstudent-led clinicstudentsstudents-as-teachersstudiesstudy designstudy designsstudy protocolstudy qualitystudy reportstudy sizestudy skillsstudy typesStyriasubacromial bursasubacromial impingementsubacromial impingement syndromesubacromial syndromesubacutesubacute painsubarachnoid hemorrhagesubarachnoid spacesubchondral bonesubclavian arterysubclavian steal syndromesubcutaneous hemorrhagesubjective cognitive declinesubjective perceptionsubjective theories of illnesssubjective well-beingsubjectivitysubluxationsubluxing ribsubmission processsuboccipitalsuboccipital inhibitionsuboccipital musclesuboccipital muscle inhibitionsuboccipital musclessuboccipital nervesuboccipital regionsuboccipital releasesuboccipital release techniquesuboccipital strainsuboccipital venous plexussubocciptal decompressionsubsidizationsubstance abusesubstance-related disorderssubstitutionsubtalar jointsuckingsucking behaviorsucking difficultiessucking dysfunctionsuckling dysfunctionsuckling intolerancesudden cardiac deathsudden infant death syndromeSudeck syndromeSufismsugarsuicideSummer Olympicssunbathingsunscreening agentssunshinesuperficial posterior muscle bandsuperficial posterior sacrococcygeal ligamentsuperior cervical ganglionsuperior mesenteric arterysuperior parietalsuperoxide anion radicalssupervised exercisesupervisionsupination sprain traumasupination traumasupine positionsupine walking testsupplementalsupplementssupport toolssupportive caresuppressionsuppurative thyroiditissupraaortic arteriesupraaortic arterysupracondylar humeral fracturessupraorbital nervesupraspinal controlsupraspinato-acrominal sulcussupraspinatussupraspinatus musclesupraspinatus tendonsurfacesurface electromyographysurface scanning laser displacement metersurfingsurgeonssurgerysurgical caresurgical complicationssurgical educationsurgical managementsurgical outcomessurgical reconstructionsurgical specialistssurgical specialtiessurgical therapysurgical trainingsurrender of practicesurveysurvey designsurveyssurvival ratesustained air pressureSutherlandSutherland Cranial CollegeSutherland techniquesutural closuresutural movementsuturesuture normalizationsuture restrictionsuture structuresuturesswallowingswallowing disorderswallowing disordersswallowing dysfunctionswaySwedenSwedenborgswellingswimmerswimmers shoulderswimmingswimming exerciseswiss ballSwitzerlandswollen earsymmetrysympatheticsympathetic activitysympathetic dystrophysympathetic markerssympathetic nervous systemsympathetic systemsympathetic tonesympathetic trunksympathetic/parasympathetic imbalancesympathic activitysymphyseal disruptionsymphysiopathysymphysis pubissymphysis pubis dysfunctionsymphysitissymposiumsymptomsymptom scoresymptomatologysymptomssynchondrosis in the cranial basesynchondrosis sphenobasilarissynchondrosis sphenooccipitalissynchronismsynchronizationsynovial cystsynovial fluidsynovial jointsynovitissynthesis inhibitorssynthesis of automatism and voluntary actionssyringomyeliasystemsystem analysissystematic biasessystematic reviewsystematic reviewssystemic and systematic approachsystemic lupus erythematosussystemic medicinesystemic sclerodermasystemic sclerosissystems theorysystolic arterial pressuresystolic blood pressuresystolic interarm differencet-cellT-lymphocytesT. A. BowenT. DowlingT. J. RuddyT. LiemT/C ratioT4 syndrometable trainer-to-student ratiotactiletactile haptic perceptiontactile mirroringTafler testtai chitailbonetalocrural jointtalustalus mobilizationtalus testTaoismtapingTAPPtargeted pressuretarsal jointtarsal jointstaste and smelltaste of balancetattoostau proteinstaxane-induced peripheral neurotoxicitytaxesTBATBITBI careTCMteachersteachingteaching assistantteaching assistantsteaching clinicteaching effectivenessteaching evaluationteaching hospitalteaching hospitalsteaching materialsteaching practiceteaching psychomotor skillsteaching techniquesteam climateteam-based learningteamUP Short-FormteamUP-SFteamworktechnical requirementstechnique selectiontechniquestechnologytechnology-enhanced active learningteenagerteethteeth grindingteleconsultingtelehealthtelehealth 2.0telehealth educationtelehealth settingtelemanagementtelemedicinetelemetrytelephonetelerehabilitationtelescopic bridgeworktelogen effluviumtemperamenttemperaturetemperature changetemperature regulationtemporaltemporal bonetemporal codingtemporal medicinetemporalis muscletemporo mandibular dysfunctiontemporo mandibular jointtemporomandibulartemporomandibular disordertemporomandibular disorderstemporomandibular dysfunctiontemporomandibular jointtemporomandibular joint (TMJ)temporomandibular joint arthrosistemporomandibular joint disordertemporomandibular joint disorderstemporomandibular joint dysfunctiontemporomandibular joint dysfunction syndrometemporomandibular joint pain dysfunction syndrometemporomandibular joint positiontemporomandibular systemtender pointtender pointstendinitistendinopathytendontendon healingtendon injuriestendon rupturetendonitistendonstendovaginitistenetstennistennis elbowtenotomyTENStensegritytensegrity modeltensiontension headachetension type headachetension-type headachetension-type headachestensional patterntenso-compressive forcesTEPteres major tearterm infantterm neonatesterminal careterminally illterminologyTerminology as Topictermsternary Structuresterrorismtesttest by pressure or tractiontest preptest scoretest scorestest validitytest-retest reliabilitytesticular paintesting procedurestestosteronetestosterone replacementteststetrahedrontetrahelixtetraparesistetraplegiaTexasTexas College of Osteopathic Medicinetext necktext neck syndrometextbooksTGF-?Thai foot reflex zone massagethe ability to lovethe osteopathic beingthe rule of the arterythe time thereafterthegosistheologytheoretical approachtheoretical basistheoretical concepttheoretical foundationstheoretical frameworktheoretical modeltheoretical modelstheory of complex systemstheory of mindtherapeutictherapeutic alliancetherapeutic approachtherapeutic cooperationtherapeutic effectstherapeutic exercisetherapeutic inertiatherapeutic interactionstherapeutic modalitiestherapeutic modelstherapeutic processtherapeutic relationshiptherapeutic Thai massagetherapeutic touchtherapeuticstherapist patient contacttherapist-patient relationshiptherapist-patient-relationshiptherapytherapy combinationsthermal imagingthermal profilethermal, skin temperaturethermodiagnosisthermographythermometrythesisthicknessthighthink-pair-sharethinkingthinking dispositionsthinking fingersthird molarthird occipital nervthird trimesterthird trimester pregnancythird ventriclethixotropythocacolumbar dysfunctionThomas L. NorthupThomas Northup lectureThomas testthoracic diaphragmthoracic diaphragm dysfunctionthoracic ductthoracic duct lymphthoracic inletthoracic lymphatic pump techniquethoracic manipulationthoracic mobilitythoracic outletthoracic outlet dyndromethoracic outlet syndromethoracic painthoracic paraspinal musclesthoracic paraspinal structuresthoracic pumpthoracic pump techniquethoracic pump techniquesthoracic spinal manipulationthoracic spinethoracic spinosus processesthoracic vertebrathoracic vertebraethoracic viscerathoracic wallthoracoabdominal mobilitythoracolumbar fasciathoracolumbar junctionthoracolumbar manipulationthoracoscopythoracotomythoraxthorax organsthorax regionthree diaphragms techniquethree months colicthree-dimensional imagingthree-dimensional printingthroatthrombolytic therapythrowingthrustthrust directionthrust forcethrust kick techniquethrust techniquethrust techniquesthumbthumb suckingthymusthyroidthyroid eye diseasethyroid glandthyroid hormone levelthyroid neoplasmsthyroid pathologythyroiditisthyrotoxicosistibiatibia translationtibial nervetibialis anterior syndrometibiofibular jointtibiofibular movementtibiofibularjointtick-borne diseasesticklingticksticstideTietze syndromeTiffeneau indexTikToktilt-table testtimetime durationstime factorstime managementtinnitustirednesstissuetissue adhesionstissue alterationtissue changestissue connectionstissue developmenttissue flexibilitytissue flossingtissue mechanicstissue memorytissue qualitiestissue resiliencetissue tendernesstissue tension testtissue texturetissue texture changeTLDTMDTMJTMJ dysfunctiontnf-?tnf-?tnf-?tnf-?TNF-atobaccotobacco use disordertocolysistoe walkingtolerabilitytoll-like receptor 4tonetonguetongue positiontongue tietonic immobility responsetonometry oculartonsillitistool developmenttoolstooth displacementtooth extractiontooth grindingtooth losstoothachetopographic tensoalgometrytorn muscle fibertornadoestorsion abnormalitytorticollistortureTOStotal body adjustmenttotal hip arthroplastytotal hip replacementtotal joint replacementtotal knee arthroplastytotal knee replacementtotal lesiontotal quality managementtouchtouch perceptiontracheatracheal intubationtracheo-oesophageal fistulatrack and fieldtractiontraditiontraditionaltraditional Chinese medicinetraditional classical osteopathytraditional medicinetraditional osteopathic medicinetraditional osteopathytraditional Thai massagetraffic accidenttraffic accidentstraineestrainingtraining deliverytraining hourstraining moduletraining programmstraining programstraining requirementstraining supporttrans identitytranscranial direct current stimulationtranscranial Doppler ultrasonographytranscranial magnetic stimulationtranscriptiontranscutaneous electrical nerve stimulationtransdisciplinarytransferencetransformation phasestransformative care continuumtransgendertransgender personstransient ischemic attacktransient ischemic attackstransient osteoporosis hiptransient synovitistransitiontransitional zonetranslationtransparencytransrectal manipulationtransurethral resectiontransvaginal ultrasonographytransversal restrictiontransverse abdoministransverse carpal ligamenttransverse perineal musclestransverse processtransverse process fracturetransversus abdoministransversus thoracistrapezial cavitytrapeziustrapezius muscletrapezius painTraube-Hering-Mayer oscillationTraube-Hering-Mayer oscillationstraumatrauma centerstrauma informed caretrauma of birthtrauma therapytrauma-induced somatic dysfunctiontrauma-informed caretraumatictraumatic brain injurytraumatic neuromatraumatic psychoemotional expierencestraumatic superior innominate sheartraumatic tattootraumatically induced lesiontraumatized patientstravelTravell trigger pointstravelogtreating chairtreatmenttreatment choicetreatment contracttreatment costtreatment credibilitytreatment effecttreatment experiencetreatment indicationtreatment indicationstreatment interactiontreatment intervaltreatment intervalstreatment interventiontreatment mechanismstreatment modeltreatment of the femurtreatment outcometreatment procedurestreatment processtreatment protocoltreatment refusaltreatment settingtreatment strategytreatment studytreatment successtreatment techniquestremortremor dystoniaTrendelenburg signtrendstriagetrial designtrial discontinuationtrial methodologytrial qualitytrialstriamcinolone acetonidetriathletestrichoepitheliomatrichotillomaniatrigeminal activationtrigeminal nervetrigeminal neuralgiatrigger pointtrigger point techniquestrigger point therapytrigger pointstriggerband techniquetriggerbandstriggerstrimesters of pregnancytrinitytrismustrisomy 21triunetriune mantriune osteopathytroponin itroubles musculo-squelettiquestrumpettruncationtruncus coeliacustrunk imbalancetrunk morphologytrunk muscletrunk muscle strengthtrunk stabilizationtrunk torsiontrusttrustworthinesstruthtruth disclosuretryptaminestryptophantuba auditiva techniquetumid lupustumortumor necrosis factortumor necrosis factor-alphatumorigenesistunnel syndrometurbttutoringtwin pregnancytwinstwitchingtympanic cavitytympanic effusiontympanometertype 2 diabetestype 2 diabetes mellitustype of techniquestypes of statics of the spineTyremanU.S. physiciansUKUK BEAM trialulcerative colitisulcersulnar nerveultrasonic therapyultrasonographyultrasoundultrasound educationultrasound imagingultrasound shear wave elastographyultrasound therapyultrasound transducerultrasound useumbilical bloodumbilical cord prolapseumbilical herniaumbilical stageuncertaintyunconscious knowledgeunconscious perceptionunconscious processesunconsciousnessundergraduateundergraduate educationundergraduate medical educationunderrepresented minorityunderrepresented populationunderservedunderserved areaunderserved areasunderserved communitiesunderserved communityunderstanding of natureundifferentiated connective tissue dysplasiaunexplained subfertilityunfair competitionunilateral cross-biteunilateral migraineunilateral retroorbital cephalalgiaunilateral sacrum-counter-shear techniqueUnitecUnited KingdomUnited StatesUnited States Medical Licensing examinationUnited States Osteopathic Medical Regulatory SummitUnited States soldiersunityunity of beinguniversityuniversity outpatient departmentsunremitting symptomsunsettled behaviorunsettled infantsunspecific back painunstable anginaunusual presentationupgrade rateUpledger 10-step protocolupper abdominal painupper airway stabilizationupper ankle mobilityupper backupper back painupper cervical regionupper cervical spineupper crossed syndromeupper extremitiesupper extremityupper gastrointestinal endoscopyupper jawupper limbupper limb blood flowupper limb strengthupper limbsupper oesophageal sphincterupper respiratory infectionupper spineupper trapeziusupper trapezius muscleupper trapezius trigger pointsupper-limb-tension-testupslipped innominateurbanurban healthurban healthcareurban lifeurban populationurethraurgeurge incontinenceurinaryurinary bladderurinary bladder neoplasmsurinary hesitancyurinary incontinenceurinary retentionurinary stonesurinary systemurinary tract diseaseurinary tract dysfunctionurinary tract infectionurinary tract infectionsurinary tract symptomurinary urgencyurinationurination disordersurodynamic parametersurodynamicsurogenital dysfunctionurogenital stage or phallic stageurogenital systemurogenital tracturolithiasisurologic systemurologyurticariaUSAusmleUSMLE scoresusmle step 2USSRuterineuterine bleedinguterine cervical neoplasmsuterine cervix dilatationuterine contractionsuterine descentuterine fibroidsuterine hemorrhageuterine mobilityuterine myomauterine prolapseuterusuterus descendusUTIutilizationutilization of resourcesV. BenedettoV. Frymannvaccinationvaccination advicevaccination complicationsvaccination decisionvaccinationsvaccinevaccine hesitancyvaccine uptakevaccinesvacinationvacuumvagal irritationvagal mechanisms of actionvaginavaginal treatmentvaginitisvagus activityvagus dysfunctionvagus nervevalidationvalidation studiesvalidityvalidity of testsvalley fevervalue added taxvaluesvancomycinvapingvaping preventionvariabilityvariability modelvariablesvariantsvariationvaricocelevaricose veinsvarus forefootVASvascular abnormalityvascular accessvascular and nerval mobilisationvascular diseasesvascular patencyvascular pathologyvascular surgical proceduresvascular systemvascular system injuriesvascularization of the spinevasculogenesisvasculopathiesvasculopathyvasectomyvasoconstrictionvasoconstrictor agentsvasodilatationvasomotor symptomsVBIvegetative nervous systemvegetative pelvic innervationvegetative resonance testveinsvelocityvelocity vectorvelopharyngofacial musculaturevena femoralisvenereal diseasevenolymphatic pump mechanismvenomotionvenopathyvenousvenous decongestionvenous drainagevenous insufficiencyvenous refill timevenous sinus drainagevenous sinus techniquevenous stasis ulcersvenous systemvenous thrombosisvenous vertebral plexusventilationventilatorverbal delayverificationVermontvertebravertebra fracturevertebra structurevertebra twistingvertebraevertebrae fracturevertebral arteryvertebral artery dissectionvertebral artery syndromevertebral canalvertebral columnvertebral manipulationvertebral mobilityvertebral rotationvertebral segmentsvertebral veinvertebrobasilar insufficiencyvertebropericardial ligamentsvertical dimensionvertical posturevertigovery elderlyvesico-ureteral refluxvestibular disordervestibular disordersvestibular dizzinessvestibular neuritisvestibular rehabilitation therapyvestibular schwannomavestibular systemvestibulevestibulo-ocular reflexvestibulocochlear nervevestibuloocular reflexveteransveterans healthveterans health administrationveterinary medicineVGEFvibrating viscoelastometryvibrationvictoria universityvideo analysisvideo displayvideo educationvideo intubationvideo learningvideo podcastvideo-assisted thoracic surgeryvideo-based learningvideographyvideosViennaVienna school of osteopathyVietnamVietnamese medicinevincristineViola Frymannviolenceviral infectionvirtual anatomyvirtual conference registrationvirtual haptic backvirtual learningvirtual practical examinationvirtual realityvisceravisceralvisceral adhesionsvisceral afferent nervevisceral afferent neuronsvisceral afferentsvisceral diseasevisceral disordersvisceral dysfunctionvisceral examinationvisceral fasciavisceral manipulationvisceral manipulation (VM)visceral manipulation,visceral mobilisation exercisevisceral mobilityvisceral mobilizationvisceral motilityvisceral movementvisceral osteopathic techniquevisceral osteopathic treatmentvisceral osteopathyvisceral painvisceral referred painvisceral releasevisceral structurevisceral surgeryvisceral systemvisceral techniquesvisceral tension testvisceral testvisceral testsvisceral vesselsviscerally associated shoulder painviscero-somatic inputviscero-somatic reflexviscero-somatic reflexesviscerocraniumvisceroletic-conceptviscerosomaticviscerosomatic reflexviscerotomesviscoelastic propertiesviscoelastic substanceviscosity of tissuevisibilityvisionvision disordersvision lossvision testsvisitsvisual acuityvisual analog scalevisual analogue scalevisual assessmentvisual channelvisual color impulse therapyvisual cuesvisual disordervisual fatiguevisual fieldVisual field defectvisual field lossesvisual fieldsvisual function deficitsvisual healthvisual impairmentvisual memoryvisual perception disordervisualizationvital capacityvital signsvitalismvitalityvitamin Dvitaminsvocal compassvocal dysfunctionvocal function exercisesvocalizationvocationVODvoicevoice changevoice disordervoice disordersvoice qualityvoice therapyvoidingvoiding dysfunctionVojtaVojta therapyVojta-therapyvolcano boardingvolleyballvolumevolunteeringvolunteersvomitingvoodoo flossingvulvar discomfortvulvitisvulvodyniaW. F. StrachanW. G. SutherlandW. L. JohnstonW. OslerW. SutherlandW.G. SutherlandWAIMHwait timesWaleswalkingwalking distancewantingwarwarfarewarfarinwarm upwartswaterwater polowater-electrolyte balancewave frequencywave phenomenaweakness hip abductorswear and tearwearableswebsite reviewweightweight changeweight gainweight lossweight reductionweightliftingWeinviertelwell-beingwellnessWest VirginiaWestern healthcareWexner Scorewhiplashwhiplash associated disorderwhiplash injurieswhiplash injurywhite noiseWHOwhole body-vibrationwhole person approachwholenessWholistic medicinewhooping coughwidespread painWilliam Sutherlandwindsurfingwithdrawalwithholding treatmentWOHOwomanwomenwomen’s healthwordingworkwork disabilitywork engagementwork environmentwork experiencework from homework schedule tolerancework-integrated learningwork-life-balancework-related injurieswork-related musculoskeletal injuriesworkersworkers’ compensationworkforceworkforce surveyworkforce surveysworking conditionsworking groupworkloadworkplaceworkplace learningworkshopWorld Health OrganizationWorld Osteopathic Health Organisationworld war Iworld war IIwound carewound healingwoundswounds and injuriesWPO-OsteoWright Adson TesWright-Giemsa stainwristwrist injurieswrist injurywrist jointwritingWriting/standardsWSOX-ray analysisx-ray computed tomographyX-ray examinationX-ray examination of the entire spineX-ray of the spinex-raysyogayoga respiratory trainingyoga therapyyoung adultyoung adultsyoung infantsyoung womenyouth communitiesZ. Comeauxzenzero?crossingZIMMTzinczinc deficiencyZink modelZink screenZink testZink’s fascial diagnostic patternszonesZoom™zygapophyseal jointzygapophyseal jointszygomazygomatic trauma
Quick search
Search metatopic
Search section
Filter language
Filter country
Filter study type
Filter type of work
Filter publication date
start (YYYY) or (YYYY/MM)
end (YYYY) or (YYYY/MM)
   

1655 results (please see below)  Sort:    
1

Incorporation of virtual reality into medical physiology
Benmerzouga, I., Oviawe, E.
Advances in Physiology Education, 2026/03
Free full text

2

Different letters, same results: a comparison of milestones among US allopathic and osteopathic residents
Langhan, M. L., Ngo, T. L., Yamazaki, K., Nesiama, J.A. O., Pence, L., Hogan, S. O.
Journal of Osteopathic Medicine, 2026/02
Free full text

3

Evaluating Laparoscopic Simulation Training for Preclinical Osteopathic Medical Students
Muchard, R. D., Jacobsen, N. D., Sypula, T., Longley, S., Hurrinus, N., Barefield, N. S., Patel, P. G.
Cureus, 2026/02
Free full text

4

Bridging the gaps: a holistic approach to strengthening the pediatric medical and surgical workforce
Okoro-Ajuzie, A., Grewal, R. S., Dhillon, M. K., Sees, J. P.
Journal of Osteopathic Medicine, 2026/02
Free full text

5

Impact of the Council of State Neurosurgical Societies (CSNS) Fellowship on the Development of Neurosurgical Careers: A Retrospective Study
Rawson, C., Tenhoeve, S., Oladipo, O., Carter, A., Bauer, S., Lucke-Wold, B., Benzil, D., Adogwa, O., Sharma, A., Karsy, M.
Cureus, 2026/02
Free full text

6

Challenging hierarchies and fostering collaboration: a critical discourse analysis of interprofessional education in healthcare training
Zorda, E. M., Sargent, M. A., Gose, C. E., Becker, M. T., Garber, S. S., DePrimo, A., Batteson, T.
Journal of Osteopathic Medicine, 2026/02
Free full text

7

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2026/01

8

Chronic pain outcomes among patients treated by osteopathic vs. allopathic physicians: a 36-month follow-up study
Licciardone, J. C., Lewis, H., Dahl, K., Adams, B., Aryal, S.
Journal of Osteopathic Medicine, 2026/01
Free full text

9

Effects of the allopathic and osteopathic graduate medical education merger on U.S. specialty training: a review
Ibrahim, S., Abdelhady, M., Venckus, J., North, C., Bohler, F.
Medical Education Online, 2026/01
Free full text

10

Race, ethnicity, and gender discrepancies between allopathic and osteopathic otolaryngology trainees from 2015 to 2023
Minutello, K. M., Nicks, S. L., Gillette, B. T., Hasan, S., Shermetaro, C. B.
Journal of Osteopathic Medicine, 2026/01
Free full text

11

Osteopathic manipulative medicine among injured emergency department patients: a nationwide study
Harris, H., DiStefano, A., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

12

Effect of COMLEX-USA Level 1 pass/fail score reporting on student stress, test preparation, and performance
Jin, R., Sandella, J. M., Gross, G. A., Dawley, M., Boulet, J., Mao, X., Wang, Y.
Journal of Osteopathic Medicine, 2026/01
Free full text

13

Allopathic resident prevalence in orthopedic residency programs formerly accredited by the American Osteopathic Association during single accreditation
Murray, J. B., Balazs, G. C., Speicher, M. R., Olsen, A. A.
Journal of Osteopathic Medicine, 2026/01
Free full text

14

Development, implementation, and evaluation of interprofessional events on climate change in health professions curricula
Ly, K., Cariddi, A., Cote, M., Hall, K.
Frontiers in Medicine, 2026/01
Free full text

15

Graduate Degree Holders in the U.S. Residency Match: Trends and Outcomes (2016-2024)
Barron, D. W., Yu, H., Pendse, R. S., Barzee, B. M., Rappaport, D. E.
Journal of Medical Education and Curricular Development, 2026/01
Free full text

16

A.T. Stills „Finding health …“ – Ad fontes!
Dippon, M.
DO - Deutsche Zeitschrift für Osteopathie, 2026/01

17

Interactive module’s effectiveness on empathy and attitudes of healthcare students
Linomaz, J., Chee, D., Wardian, J., Beverly, E., Thomas, S.
Journal of Osteopathic Medicine, 2025/12
Free full text

18

Effects of the COVID-19 Pandemic on the Practice of Osteopathic Manipulative Medicine: A Survey Study
Luebbering, C. J., Johnson, J. C., AminiRad-Hall, S., Kelley-Franklin, G., Degenhardt, B. F.
International Journal of Osteopathic Medicine, 2025/12

19

Analysis of hepatitis B immunity in vaccinated medical students
Gentile, N., Aghera, C., Smith, H., Mazzoleni, S., Redden, D., Tjiattas-Saleski, L.
Journal of Osteopathic Medicine, 2025/12
Free full text

20

Associations in fetal outcomes from cesarean sections with maternal comorbidities: a cross-sectional study of the Pregnancy Risk Assessment Monitoring System
Enmeier, M., Stephenson, E., Prince, J., Markey, C., Phung, B., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text

21

A Cross-Sectional Study of Biopsychosocial Factors Associated with Utilization of Osteopathic Manipulative Treatment Among US Adults
Agostini, K., Manzaro, A., Helms, M., Bringhurst, M., Gish, E., Motyka, T.
Journal of Osteopathic Medicine, 2025/12

22

Is Research Fun? A Survey of Osteopathic Medical Students
Amendolara, A., Homan, M., Thorpe, L., Payne, A., Stacey, S. K., Small, C.
Journal of Osteopathic Medicine, 2025/12


24

Analyzing Medical Student Knowledge Regarding Nutrition
Barros, M., Weir, S.B., Bennett, A.
Journal of Osteopathic Medicine, 2025/12

25

Physician and Resident Physician knowledge of childhood obesity management guidelines
Chaar, S., Chaaban, A., Bitar, R., Hill Guseman, E.
Journal of Osteopathic Medicine, 2025/12



28

Enhancing Transitional Support for First-Year Medical Students: An Osteopathic, Student-Centered Perspective
Hartman, T., Pookkattu, M., Dearden, S., Venkataraman, V.
Journal of Osteopathic Medicine, 2025/12

29

Bridging Communication Gaps: Exploring Medical Students’ Understanding and Experiences in Caring for Patients with Hearing Impairments and Language Barriers
Kim, A., Nolin, J. R., Bracy, H., Berko, H., Mazzorana, A., Leiber, K., Hernandez, E.
Journal of Osteopathic Medicine, 2025/12

30


31

Evaluating Student Mental Health Resource Utilization and Self-Perceived Mental Health
Muppala, M. S., Sanapala, C., Shields, E., Kemp, E., Goldsteen, R., Tano, S., Grewal, P.
Journal of Osteopathic Medicine, 2025/12

32

Bridging the Gap: A Tri-campus Survey on Student Confidence in Applying OMT in Neurological Conditions
Nallanukala, G. S., Noto-Bell, L., Nallanukala, V.
Journal of Osteopathic Medicine, 2025/12

33

Perceptions of Health with Attention to Specific Bodily Systems Among Refugees in Erie, PA
Pashollari, F., Shinder, P., Kisiel, N., Butala, H., Hobbs, B., Thielman, N.
Journal of Osteopathic Medicine, 2025/12


35

Pushing into the Barrier: Investigating the Use of OMM Among 3rd and 4th Year Medical Students
Pirzadeh, N., Dona, C. G., Valencia, R., Anche, G., Liang, W. M., Chen, D., Para, R., Volokitin, M.
Journal of Osteopathic Medicine, 2025/12


37

Zink’s Fascial Patterns Among First- and Second-Year Medical Students
Rutt, G., Graham, M., Boesler, D.
Journal of Osteopathic Medicine, 2025/12

38

D.O. Podcast Increases Pre-Medical Student Knowledge and Attitudes Toward Osteopathic Medicine
Sullivan, V. E., D'Amelio, M. P., Storch, I. M., van Rooyen, D. R., Storch, N. C., Callaway, C. A., Pierce-Talsma, S. L., Hauler, J. J.
Journal of Osteopathic Medicine, 2025/12

39

Osteopathic Medical Education and Treatment: Changes in Perspective Through the Lens of Standardized Patients
Thompson, T. R., Craun, W. D., Strickland Creech, T., Parks, J. M., Nolin, J. R.
Journal of Osteopathic Medicine, 2025/12


41

Perceptions of Campus Climate and Inclusivity Among LGBTQIA+ Osteopathic Medical Students: A Cross-Sectional Study
Varin, P., Temucin, S., Reese, A., Florescu, N., Grace, C., Bettiker, R., Sonneville, K., Fiscus, V., Tanaka, L.A.
Journal of Osteopathic Medicine, 2025/12

42

Factors Affecting Medical Student Participation in Student Evaluations of Teaching: A Retrospective Study
Walker, R., Tucker, S., Smith, M. L.
Journal of Osteopathic Medicine, 2025/12

43

Geographical distribution and match trends of osteopathic residents in otolaryngology residency programs: a cross-sectional analysis
Reardon, L., Stucki, B., Akella, D., Carr, M. M.
Journal of Osteopathic Medicine, 2025/12
Free full text


45

NextGenDO: A Pre-medical Outreach Program to Promote Early Exposure to Osteopathic Medicine
Quezada, K. A., Gjunkshi, L., Persaud, N. A., Hasty, R.
Cureus, 2025/12
Free full text

46

Associations of comorbidities, opioid use, and intimate partner violence, with urinary tract infections in pregnancy: implications for prevention and screening
Donatucci, K., Pathak, S., McPherson, K., Price, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/12
Free full text

47

A Retrospective Comparative Analysis of MD and DO Applicants' Acceptance to Plastic Surgery Residency
Yacoub, S. G., Guyler, M., Zak, A., Marlar, R., Obeid, R., Leavitt, W. III., Bernard, S., Isakov, R., Rampazzo, A., Gharb, B. B.
Annals of Plastic Surgery, 2025/12

48

Prolotherapy in the Academy: A Mixed Methods Survey Study
Dubey, J., Jones, N. R., Evered, J. A., Grob, R., Andrie, J., Rabago, D.
Journal of Integrative and Complementary Medicine, 2025/12
Free full text

49

Complementary health approach engagement of people with migraines in a nationally representative sample
Bond, A. D., Agostini, K., Motyka, T. M., Cappola, J. D., DiCristo, J. D., Heims, A. D.
Postgraduate Medicine, 2025/12

50

De-stress pain management: Assessing pain management care amongst primary care providers
Browder, B. H., Reynolds, C., Agnello, R.
Postgraduate Medicine, 2025/12

51

Osteopathic Acceptance in General Surgery Residency: A Five-Year Review of Resident Outcomes
Baule, S. M., Nguyen, J., Mehdiyar, D., Panlilio, M. A., Flume, H., Hanna, A., Cordero, A., Shepherd, J., Johnson, R., Sees, J. P.
Cureus, 2025/12
Free full text

52

Evaluating Research Preparedness and Skill Gaps Among Osteopathic Medical Students Pursuing Surgical Specialties
Beerman, S. A., Stucki, B., Wong, R., Alexander, V. S., Vogel, A., Heard, M. A., Wallen, T. J.
Cureus, 2025/12
Free full text

53

Enhancing the Awareness of Osteopathic Learning Opportunities Through a Newsletter
Eilerman, A., Benton, A., Shneker, N., Abdo, M., Mar, D., Faherty, M., Reynolds, R.
The AAO Journal, 2025/12

54

The State of Osteopathic Physicians in Orthopaedic Training and Academic Practice
Cohn, R. M., Bitterman, A. D.
Journal of the American Academy of Orthopaedic Surgeons, 2025/12

55

Medical Student Perspectives on Abortion Education in US Osteopathic Medical School Curricula
Steffes, R., Thakur, P., Cox, S., Adams, C., Creamer, B. A., Dennis, J. F.
Perspectives on Sex and Reproductive Health, 2025/12

56

Geographical distribution of osteopathic urology residents and match trends in the United States
Wong, R., Eke, B., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/11
Free full text

57

Clerkship Rotations Are a Key Driver of Family Medicine Choice: Insights from the 2024 National Resident Survey
Barr, W., Peterson, L. E., Fleischer, S., Bazemore, A.
Journal of the American Board of Family Medicine, 2025/11
Free full text



60

Emergency department wait times in concordance with blood alcohol content and subsequent alcohol use disorder
Hayes, S., Mach, K., Briggs, J., Hartwell, M.
Journal of Osteopathic Medicine, 2025/11
Free full text

61

A quantitative analysis comparing pre-clinical volunteering hours with third-year medical students' preceptor evaluations
Ranta, E. K., Ranta, J. C., Redden, D., Stoner, A. M.
Journal of Osteopathic Medicine, 2025/11
Free full text

62

Scholar 12 longitudinal outcomes: osteopathic research development application to facilitate scholarly activity during the pandemic and beyond
Rowane, M. J., Thomas, K. A., Smith, T. M., Terrel, M. A., Rowane, M. P., Hostoffer, R. W.
Journal of Osteopathic Medicine, 2025/11
Free full text

63

Osteopathic Medicine Applicants in Urology: Evolving Pathways and Persistent Gaps After the Merger
Toumazos, K., Svendsen, C., Spencer, K. A., Cranford, W., McLouth, C., Buchanan, A. F.
Urology Practice, 2025/11



66

Assessing eating disorder education in U.S. medical schools: a qualitative content analysis of lecture slides
Laboe, A. A., Pictor, L. E., Gavuji, M., Temucin, S., Kreynin, A., Sheil, E., Jourdan, B., Schaumberg, K., Davis, H., Harrop, E. N.
Eating and Weight Disorders, 2025/11
Free full text

67

Assessing fundamental clinical skills of osteopathic medical students
Boulet, J. R., Sandella, J. M., Gimpel, J., LaBaere, R.
Journal of Osteopathic Medicine, 2025/10
Free full text

68

Affirmative Action Repeal and Racial and Ethnic Diversity in US Medical School Admissions
Florescu, N., Lin, A., Temucin, S., Rae, L.
JAMA Network Open, 2025/10
Free full text


70

From Simulation to Surgery: Gauging Surgical Interest in Osteopathic Medical Students Through Cadaveric Simulation: A Pilot Study
Paladichuk, S., Chase, T., Downs, A., Heck, C., Cortner, M., Cornwell, H., Shang, T., Brennan, Z., Walser, R. F., Kerber, K., Wallen, T.
Journal of Medical Education and Curricular Development, 2025/10
Free full text

71

Enhancing Embryology Education Through Virtual Reality: A Pilot Study
Quiñones-Rodríguez, J., Rice, R., Mayer, W., Marchelli, G., Bouchoukian, M., Davis, P.
Anatomical Record, 2025/10

72

The undernourished curriculum: What happened to nutritional education in the medical curriculum?
Milosavljevic, K., Meng, J., Sahoo, V., Trac, K., Lopez, J. H., Kaur, S., Raghunathan, A., Ali, K.
Frontiers in Nutrition, 2025/10

73

Incorporating the Certified Professional in Patient Safety credential into undergraduate medical curriculum: assessment and lessons learned
Gelinas, L., Hassan, A. K., Lieto, J., Yurvati, A. H.
Journal of Osteopathic Medicine, 2025/10
Free full text

74

Predicting COMLEX-USA Level 2-CE using medical school performance and use for student advising
Wang, S., Basehore, P.
Journal of Osteopathic Medicine, 2025/10
Free full text


76

Feed, Read, and Grow: An Observational Study on the Impact of Educational Videos About Pediatric Anxiety
Acors, E. L., Renner, B., Worrill, S., Bhagtani, H., Jaimes Ocazionez, S. N., Magalhaes, E. P.
Cureus, 2025/10
Free full text

77

Moving to learn: Enhancing anatomy education through physical activity and video-based instruction
Schaefer, M., Bradley, L., Geske, N., Girma, N., Gjidoda, L.
Anatomical Sciences Education, 2025/10
Free full text


79

Preceptor-Ranked Competencies in Osteopathic Medical Students: A Comparison of General Surgery and Surgical Subspecialties
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Garg, R., Thacker, R. R., Roach, S. L.
Cureus, 2025/10
Free full text


81

Top 100 cited articles in osteopathic medical education: A bibliometric analysis
Bright, H. S. IV., Robinson, K., Fitterling, L., Kelley, S., Wang, M. Y.F., Lipke, L.
Medical Reference Services Quarterly, 2025/10

82

Corrigendum to: The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T.H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

83

A proven template for providing streamlined, scalable, cost-effective clinical research opportunities in osteopathic medical schools
Greek, J. N., Greek, A. P., Hopper, M., Arnce, R.
Journal of Osteopathic Medicine, 2025/09
Free full text

84

Technology use and satisfaction among colleges/schools of osteopathic medical education
Linsenmeyer, M., Ridpath, L.
Journal of Osteopathic Medicine, 2025/09
Free full text

85

Why don't more physicians use osteopathic manipulative medicine? A cross-sectional study of utilization and referral barriers
Stacey, S. K., Furlano, A., Genewick, J., Westfall, E., Gordon, B., Toor, J.
Journal of Osteopathic Medicine, 2025/09
Free full text

86

Medical student perceptions of psychiatric conditions and the impact of stigmatizing language
Monahan, Z., Stevens, V., Hartwell, M., Ford, A. I.
Journal of Osteopathic Medicine, 2025/09
Free full text

87

Why is identification with osteopathy decreasing in medical students?
Kauffman, Z. S., Harper, T., Augustyniak, R. A., Ruff, C.
Journal of Osteopathic Medicine, 2025/09
Free full text

88

The epidemiology of osteopathic diagnoses and treatments in United States emergency departments from 2018 to 2021
Distefano, A., Harris, H., Bowers, K. M., Nikolla, D. A.
Journal of Osteopathic Medicine, 2025/09
Free full text

89

A Retrospective Analysis of Osteopathic Manipulative Treatment Techniques Used by 3rd and 4th Year Medical Students
Bowman, H. R., Schwartz, B. D., Payton, M. E., LaFontano, C. M.
International Journal of Osteopathic Medicine, 2025/09

90

Abstracts From the Third Annual Research Day Hosted by the Michigan State University College of Osteopathic Medicine, Novi, Michigan, May 13, 2025
Akenami, F. O., Ismail, R., Obando Solano, C. P., Amalfitano, A.
Spartan Medical Research Journal, 2025/09
Free full text


92

A Pediatrician’s Newest Tool: Osteopathic Manipulative Treatment in the Inpatient Setting
Khanafer, R., Holub-Ward, R., Wong, M., Hart, C., Pitman-Hunt, C.
Spartan Medical Research Journal, 2025/09


94

Dermatology match disparities: analyzing osteopathic vs. allopathic student outcomes post-ACGME/AOA single accreditation system (2020-2024)
Wan, L., Bawa, K., Park, A., Kadri, H., Cusick, A., Trotter, S. C.
Journal of Osteopathic Medicine, 2025/09

95

Use of a community care coordination team to reduce emergency department utilization and hospital readmissions for the highest utilizers
Shipman, S., Painter, K., Epperson, L. C., Smith, K.
Journal of Osteopathic Medicine, 2025/09
Free full text

96

Understanding the Ranking and Matching Behaviors During the 2023 and 2024 General Surgery Match Cycles: A Program Signaling Approach
Pakdaman, S., LaFemina, J., Byrd, K. S., Dunleavy, D. M., Balestrieri, S. G., Jurich, D. P., Dowden, A. J., Lamb, D. L.
Journal of Surgical Education, 2025/09

97

A novel simulation enhanced education for osteopathic manipulation of hospitalized patients
Eilerman, A. P., Libonate, G., Pothen, S., Rudie, M., Zardoost, S., Donaldson, B., Gable, B.
Journal of Osteopathic Medicine, 2025/09
Free full text

98

DO (under) representation in US guideline development: an investigation of guideline authors from 2021-2023
Amendolara, A. B., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, A. M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2025/09
Free full text


100

The Need for Telehealth Education in the Medical School Curriculum
Carney, M., Thornton, M. E., Avancha, K., Nolin, J. R., Alexander, J.
Cureus, 2025/08
Free full text



103

Comparative cross-sectional analysis of asthma outcomes and sinus surgery utilization in Appalachian and non-Appalachian counties of Ohio
Borgemenke, S., Osap, R., Bogunovich, K., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/08
Free full text

104

The hospitalist’s paradox: on pay, perception, and the true value of a healer in the valley of the sun
MacDonald, G. P.
Journal of Osteopathic Medicine, 2025/08
Free full text

105

Bridging the gap: associations of provider enrollment in OKCAPMAP with social deprivation, child abuse, and barriers to access in the state of Oklahoma, USA
Hartwell, M., Haas, R., Miller, A., Brent, C., Wickliffe, O., Deshpande, S., Coffey, S.
Journal of Osteopathic Medicine, 2025/08
Free full text

106

Understanding COMLEX-USA Level-1 as a Pass/Fail examination: impact and opportunities
Gerhardson, A., Efurd, M., Sexton, P., Sefcik, D.
Journal of Osteopathic Medicine, 2025/08
Free full text

107

Effectiveness of Different Teaching Modalities in Human Gross Anatomy Education
Mooney, A., Thompson, N. E., Hoffmann, S.
Clinical Anatomy, 2025/07

108

Private equity in healthcare: implications and policy recommendations
Jestin, M.
Journal of Osteopathic Medicine, 2025/07
Free full text

109

Impact of a clinician-directed educational program on communicating with patients regarding gun violence at two community urban healthcare centers
Langenau, E., Kaminsky, A. M., Roberts, M. B.
Journal of Osteopathic Medicine, 2025/07
Free full text

110

The impact of a summer research internship program on research engagement of osteopathic medical students
Bishayee, A., Wallace, M. A., Bobak, A. K., Sasher, T. L., Alvarez, L. A., Flink, T. S.
Journal of Osteopathic Medicine, 2025/07
Free full text

111

Exploring the Characteristics and Competencies of Successful Osteopathic Medical Students on General Surgery Clerkship
Muchard, R. D., Donnelly, T. J., Arnold, C. S., Thacker, R. R., Roach, S. L.
Cureus, 2025/07
Free full text

112

A Pilot Study of Orthopedic Applicants Regarding Sub-internship Number, Cost, and Preferences
Schultz, M. J., Riebesell, S., Lutz, R. W., McCahon, J., Suarez, J. D., Purtill, J., Daniel, J.
Cureus, 2025/07
Free full text

113

Predicting First-Semester Performance of First-Year Medical Students in a Changing Landscape
Walker, M., George, A., Mohsin, S., Nichani, R., Garg, R., Chosie, K., Kennedy, C.
Cureus, 2025/07

114

Enabling Exploration: Examining the Availability and Adequacy of Conference Funding for Medical Students
Allison, S. G., Soltani, H., Chwa, E. S., Shuaibi, D. W., Allison, K. R., Gosain, A. K.
Plastic and Reconstructive Surgery-Global Open, 2025/07
Free full text

115

Academic Entitlement in Osteopathic Medical Students
Brown, S., Rodgers, A., Fastring, D.
Cureus, 2025/07
Free full text

116

The effectiveness of training student physicians in culturally sensitive patient care using an interprofessional culturally competent curriculum
Aminpour, A., Gelvin, M., Smurzynski, A., Gardner, F., Gardere, J.
Journal of Osteopathic Medicine, 2025/07
Free full text

117

Building Community With Community: Collaborative Reflections on the Rural and Urban Community Orienting Experience (RUCOE)
Casapulla, S., Kropf, K., Kalout, S., Lingerak, S.
Teaching and Learning in Medicine, 2025/07

118

A survey of sexual harassment and assault in osteopathic medical schools
Chiriboga, K., Zeller, M., LaPlante, M., Prasad, C.
BMC Medical Education, 2025/07
Free full text

119

A cross-sectional analysis of pathology exposure across COCA-accredited osteopathic medical schools: Gaps and opportunities in pathology undergraduate medical education
Preston, P., Herman, M., Berry, A., Robinson, M., Schukow, C. P., Kowalski, P.
Academic Pathology, 2025/07
Free full text

120

Pioneering the future: incorporating lifestyle medicine tools in osteopathic medical education
Bansal, S., Shubrook, J. H.
Journal of Osteopathic Medicine, 2025/07
Free full text


122

Research gaps in the correlation of anxiety and depression prevalence in former college athletes: a systematic review
Reese, M. L., Eggleston, B. A., Smith, A. M., Young, A. J., Mazur, A., Hartwell, M.
Journal of Osteopathic Medicine, 2025/06
Free full text



125

Improving vascular access knowledge and assessment skill of hemodialysis staff
Smith, K., Ayars, C.
Journal of Osteopathic Medicine, 2025/06
Free full text

126

Increasing Student Confidence, Diagnosis, and Utilization of OMT: Has COVID-19 Struck Again?
Magnus, J. E., Heinking, K. P., Henderson, K. H.
The AAO Journal, 2025/06



129

Gender Sensitivity in Osteopathy: The Challenge of Diagnosing Pubic Symphysis Somatic Dysfunctions
Velasquez, L., Walker-Elders, A., Feygin, H., Hahn, D., Lee, D., Volokitin, M.
The AAO Journal, 2025/06



132

How to Prepare for the Comprehensive Osteopathic Medical Licensing Examination of the USA Level 2-Cognitive Evaluation (COMLEX-USA Level 2-CE)
Kadavakollu, S., George, A., Atluri, V., Gregory, P.
International Journal of Osteopathic Medicine, 2025/06

133

Trends in osteopathic medical education: a scoping review
Hoskins, K., Montgomery, M., Griffith, A., Pollard, H., Orr-Roderick, D., Schmick, D., Strausman, J., Wade, S., Robertson, M., DeArmond, M.
Journal of Osteopathic Medicine, 2025/06
Free full text


135

A Retrospective Multicenter Analysis of Osteopathic Manipulation in Academic and Community Settings
Stacey, S. K., Harmelink, B., Gordon, B., Toor, J., Furlano, A., Genewick, J., Westfall, E.
Cureus, 2025/05
Free full text



138

Effects of the Strong Hearts program at two years post program completion
Murphy, B. E., Card, P. D., Ramirez-Kelly, L., Wensley, B., Heidel, R. E.
Journal of Osteopathic Medicine, 2025/05
Free full text

139

Recent and future trends in osteopathic orthopedic surgery residency match rates following the transition to a single accreditation system
Turnow, M., Nemani, M. G., Gupta, N., Hartman, H., Manes, T., Williamson, T., Gianakos, A.
Journal of Osteopathic Medicine, 2025/05
Free full text

140

Stressbusters: a pilot study investigating the effects of OMT on stress management in medical students
Valencia, R., Anche, G., Do Rego Barros, G., Arostegui, V., Sutaria, H., McAllister, E., Banihashem, M., Volokitin, M.
Journal of Osteopathic Medicine, 2025/05
Free full text

141

International medical graduate orthopaedic residents show higher research productivity than United States graduate peers before and during residency
MacLeod, J. S., Jacome, F., Mansour, H., Lee, M. S., Akwuole, F., Cho, S., Lee, J., Lema, O., Chopra, A., Bakaes, Y., Painter, S., Baker, H., Mejia, A.
International Orthopaedics, 2025/05

142

Efforts in Undergraduate Medical Education to Improve Socioeconomic Status Diversity
Velasquez, D. E., Shrestha, A., Matias, W. R.
Academic Medicine, 2025/05
Free full text

143

Residency Program Characteristics Associated With Osteopathic Resident Representation
Nikolla, D. A., Sachdeva, V., Distefano, A., Bryan, A., Mudrakola, V., Milliron, M. L., Bowers, K. M.
Cureus, 2025/04
Free full text

144

“Transition to Clinical Years“ Podcast Series: A Pilot Project to Support Rising Third-Year Students
Price, K. W., Bhagtani, H., Abraham-Hardee, S., Yeager, D., Anandakrishnan, R.
Cureus, 2025/04
Free full text

145

Does Malpractice Risk Deter Medical Students From Pursuing Obstetrics and Gynecology?
Thai, A., Huynh, K., Pickering, T., Maron, A., Wang, L., Stohl, H.
Cureus, 2025/04
Free full text

146

An Expert Consensus of Acceptable Scholarly Activities in Emergency Medicine Residency Training Programs
Garg, N., Totten, V. Y., Greenberg, M. R., Wilkerson, G., Finnell, J. T., Lau, W. B., Miner, J. R., d'Etienne, J. P., Brenner, J. D., Kumar, P., Camargo, C. A.
The Journal of Emergency Medicine, 2025/04

147

A cross-sectional study of newly established medical schools in the United States: student body diversity remains an unmet challenge
Oyoun Alsoud, L., West, K., Sorrell, S., Andolsek, K. M., Al Hageh, C., Ibrahim, H.
Medical Education Online, 2025/04
Free full text

148

Modeling the importance of physician training in practice location for Ohio otolaryngologists
Borgemenke, S., Newsom, D., Scheatzle, P., Durstock, N., Beverly, E. A.
Journal of Osteopathic Medicine, 2025/04
Free full text

149

Effectiveness of a program director for osteopathic medical education to support osteopathic recognition at a training site with multiple programs
Eilerman, A., Porter, C., Faherty, M., Zmuda, E.
Journal of Osteopathic Medicine, 2025/04
Free full text

150

An Investigation of Second-Year Medical Students' Use of Outside Resources at Two Institutions
Berry, A., Campbell, A., Li, D., Bay, C., Ikonne, U.
Medical Science Educator, 2025/04
Free full text

151

Lecture Capture, Transcripts, and Captioning in US Colleges of Osteopathic Medicine: Descriptive Cross-Sectional Survey
Khong, P., Holmes, D., Masoudian, B., Lund, G. C., Garwood, S.
Medical Science Educator, 2025/04
Free full text

152

A comprehensive review of clinical experiences and extracurricular activities for US premedical students applying to osteopathic medical schools
Kadavakollu, S., Dang, T., Bains, J., Ham-Ying, J., Boyanovsky, B., Qureshi, M., Graneto, J., Richards, S.
Journal of Osteopathic Medicine, 2025/04
Free full text

153

A breakdown of how diagnostic radiology residency became increasingly competitive for US doctors of osteopathic medicine (DOs) and international medical graduates (IMGs)
Divan, S., Elsingergy, H. M., Musa, A., Elsingergy, M. M., Berryhill, B., Altinok, G.
Current Problems in Diagnostic Radiology, 2025/04


155

Somatic Dysfunctions in the Modeling of Occlusal and Extraocclusal Disorders
Makichyan, T., Gusakova, E., Khabadze, Z., Rylsky, A.
Georgian Medical News, 2025/04
Free full text

156

The assessment of point-of-care ultrasound (POCUS) in residency: the benefits of a four-year longitudinally integrated curriculum
Le, D. Q., Scarpulla, M., Lam, H., Kern, J., Vroegop, S., Yaeger, J., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2025/03
Free full text

157

Prevalence of pelvic examinations on anesthetized patients without informed consent
Cutting, R., Reddy, V., Polam, S., Neiman, N., Manna, D.
Journal of Osteopathic Medicine, 2025/03
Free full text

158

Impact of osteopathic manipulative medicine training during graduate medical education and its integration into clinical practice
Kramer, J. L., Trombetti, K., De Asis, K., Mai, V., Swing, E.
Journal of Osteopathic Medicine, 2025/03
Free full text

159

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of osteopathic medicine, 2025/03
Free full text

160

Changes in Matches into Surgical Residencies and Fellowships Following the ACGME Merger
Soliman, S. S., Andrews, G., Emara, S., Watkins-Granville, N., Podwójniak, A., Hasan, I., Stuti, J., Brotman, A.
Journal of Surgical Education, 2025/03
Free full text

161

Determinants of Complementary and Integrative Health Approaches: A Cross-Sectional Study Using the All of Us Research Program
Anderson, B. R., Herman, P. M., Whedon, J. M., Bradley, R.
Journal of Integrative and Complementary Medicine, 2025/03


163

Increase in the Number of Medical Schools in the United States and Its Potential Adverse Ramifications for Urology Residency Applicants
Donato, U. M., Ebedes, D. M., Nelwan, D., Imam, A., Patel, T.
Cureus, 2025/03
Free full text


165

Addressing confounding factors in the match disparities between DO and MD seniors
Bohler, F.
Journal of Osteopathic Medicine, 2025/03
Free full text


167

Assigning Commercial Off-The-Shelf (COTS)-Based Board-Style Pharmacology Practice Questions to Medical Students
Ghayur, M. N., Ghayur, A.
The Journal of Pharmacology and Experimental Therapeutics, 2025/03

168

503 A Closer Look at Pathology Education in Osteopathic Medical Schools: Data from 2021 to 2024
Preston, P., Herman, M., Berry, A., Robinson, M., Kowalski, P.
Laboratory Investigation, 2025/03

169

American Osteopathic History Tour 2024: eine Reise zu den Ursprüngen der Osteopathie
Wittchow, R.
DO - Deutsche Zeitschrift für Osteopathie, 2025/03

170



172

Alcohol consumption among older adults in the United States amidst the COVID-19 pandemic: an analysis of the 2017–2021 Behavioral Risk Factor Surveillance System
Haight, M., Smith, P., Bray, N., Nolan, D., Hartwell, M.
Journal of Osteopathic Medicine, 2025/02
Free full text

173

Protecting the profession: lessons from the recent physician scandals
Kelso, R. A., Schmidt, D., McLay, C.
Journal of Osteopathic Medicine, 2025/02
Free full text

174

Determining the effects of social media engagement on surgery residents within the American College of Osteopathic Surgeons
Alexander, V. S., Eke, B., Xu, A., Wong, R., Greek, A., Ernst, M., Roberts, H., Ariwodo, O., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Journal of Osteopathic Medicine, 2025/02
Free full text



177

Current Use and Effects of Osteopathic Manipulative Treatment (OMT) in the Military: A Scoping Review
Lumley, H., Omonullaeva, N., Dainty, P., Paquette, J., Stensland, J., Reindel, K.
Cureus, 2025/02
Free full text

178

Generative Artificial Intelligence in Medical Education—Policies and Training at US Osteopathic Medical Schools: Descriptive Cross-Sectional Survey
Ichikawa, T., Olsen, E., Vinod, A., Glenn, N., Hanna, K., Lund, G. C., Pierce-Talsma, S.
JMIR Medical Education, 2025/02
Free full text

179

Pursuing Osteopathic Recognition: A National Survey on US Program Director Perspectives
Dong, T., Shapiro, M., Soh, M., Merkebu, J., Cervero, R., McClain, R., Durning, S. J.
Journal of Graduate Medical Education, 2025/02
Free full text

180

Development and Implementation of the “Exercise is Medicine“ Elective at an Osteopathic Medical School
Mitchell, C., DeMartino, S., Ivers, L., Brown, A., Maccabee, E., Griffith, B., Pankey, C. L.
Medical Science Educator, 2025/02
Free full text

181

Student correlates with interprofessional attitudes within undergraduate medical education
Foushee, J. A., Everhart, K. M., Stoner, A. M., Tjiattas-Saleski, L., Redden, D.
BMC Medical Education, 2025/01
Free full text

182

Educating our colleagues and hospital administrators regarding osteopathic medicine
Soliman, S. B.
Journal of Osteopathic Medicine, 2025/01
Free full text

183

Foot and ankle fellowship-trained osteopathic orthopaedic surgeons: a review, analysis, and understanding of current trends
Henry, J. P., Partan, M. J., Chen, K. M., Cohn, R. M., Bitterman, A. D.
Journal of Osteopathic Medicine, 2025/01
Free full text

184

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text

185

Uncovering gaps in management of vasomotor symptoms: findings from a national need assessment
Hubka, T. A., Crim, A., Koh, J. Y., Larrison, C., McKeithen, T., Fleming, M., Caruso, J., Prud&rsquo, homme, M.
Journal of Osteopathic Medicine, 2025/01
Free full text


187

Why do physicians practice osteopathic manipulative treatment (OMT)? A survey study
Lease, S. M., Figueroa Casanova, J. S.
Journal of Osteopathic Medicine, 2025/01
Free full text

188

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text

189

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01

190

Self-perceived preparedness for practice among graduating physical medicine & rehabilitation residents
Wasserman, N. A., Huang, L. Y., Molinares, D. M., Tiu, T.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text


192

Efficacy of an Abdominal Surgery Simulator in Didactic Medical Training: A Randomized Controlled Trial
Fincher, S. E., Koniuk, V. M., Benavidez, M. S., Benefield, M. C., Drew, D. L., Hasan, D. M., Minner, N., Prakash, T. C., Parks, M. J., Lindsey, T.
Cureus, 2025/01
Free full text


194

Interprofessional Collaboration in Action: Evaluating Pharmacy and Medical Student Perceptions Through Care for the Underserved
Davison, B. M., Ward, A., Meyer, A., Aldeeb, S., Babalola, F.
American Journal of Health-System Pharmacy, 2025/01


196

Resident Perceptions of Migraine Management and Interventions to Improve Care
Malone, L. I., Kelley, K.
American Journal of Health-System Pharmacy, 2025/01

197

The predictive validity of MCAT scores and undergraduate GPA for COMLEX-USA licensure exam performance of students enrolled in osteopathic medical schools
Royal, K. D., Meyer, C., Guercio, E., Speicher, M., Flamini, J., Sandella, J. M., Tsai, T. H., Searcy, C. A.
Journal of Osteopathic Medicine, 2025/01
Free full text

198

Medical schools producing the most physical medicine and rehabilitation residents: An analysis of matriculating residents from 2017 to 2021
Shannon, D. T., Chase, P. M., Frei, B. W., Anesi, T., Yang, A. J.
PM&R: The Journal of Injury, Function and Rehabilitation, 2025/01
Free full text


200

Predictors of a positive attitude towards rural practice in female osteopathic medical students
Kahl, D. E., Roessger, K. M.
Journal of Osteopathic Medicine, 2024/12
Free full text

201

The rise of advanced practice provider independence bills: a misguided attempt to address the physician shortage
Bohler, F., Peters, G., Aggarwal, N., Harvey, K., Bohler, J. D.
Journal of Osteopathic Medicine, 2024/12
Free full text

202

A call to include intersectionality on board examinations
Dozier, D. R., Rodríguez, J. E.
Journal of Osteopathic Medicine, 2024/12
Free full text

203

Preference signaling in orthopaedic surgery: applicant perspectives and opinions
Howard, C., Martinez, V. H., Hughes, G., Zaheer, A., Allen, C., Hanson, C., Norris, B., Checketts, J. X.
Journal of Osteopathic Medicine, 2024/12
Free full text

204

Assessing osteoporosis screening compliance in total joint surgery: a retrospective chart review
Shepard, S., Bartholomew, A., Houserman, D., Bamberger, H. B., Manocchio, A. G.
Journal of Osteopathic Medicine, 2024/12
Free full text

205

Making the Cut: A Six-Year “Bone-afide“ Membership Trend From Student to Surgeon
Nemani, M. G., Barham, E., Sees, J. P.
Cureus, 2024/12
Free full text

206

Evaluating perspectives, knowledge and behaviors of osteopathic medicine in a United States osteopathic medical school: A study in employee education and changes in understanding
Glaser, K., Roberts, J., Coleman, M. K., Payton, M., Wilke, S., Linton, M., Waller, J.
International Journal of Osteopathic Medicine, 2024/12

207

Underrepresentation of Osteopathic Physicians in the Development of Medical Guidelines
Amendolara, A., Salazar, S., Nguyen, T., Fife, P., Harris, B., Rivera, M., Madrid, K., Gray, Y., Stacey, S.
Journal of Osteopathic Medicine, 2024/12

208

Student perception of Case Based Learning at a medical school in New York before and during the COVID-19 pandemic
Bhurtyal, K. K., Kung-Lau, S., Pino, M. A.
Journal of Osteopathic Medicine, 2024/12

209

Osteopathic Medical Doctors into Plastic Surgery: Pathways and Demographics
Datario, A. V.
Journal of Osteopathic Medicine, 2024/12

210

Institutional Funding of Medical Students for Research Conferences: Is There a Benefit for the NRMP?
Dennis, J. F., Khan, H., Papatheofanis, C., Agollari, K., Marino, R., Schumann, T., Woolhiser, E.
Journal of Osteopathic Medicine, 2024/12

211

Effectiveness of Prematriculation Programs for Student Success in Medical School
Frontz, A., Sheridan, L., Davidson, K., Gundler, C.
Journal of Osteopathic Medicine, 2024/12

212

Outreach Education led by Osteopathic Medical Students on Substance Use Prevention for Sustainable Health Literacy in Underserved Youth Communities
Garg, E., Gogineni, K., Mahimkar, S., Jambunathan, V., Jamal, L., Nazaroff, C., Restini, C.
Journal of Osteopathic Medicine, 2024/12


214

Heart Rate Variability (HRV) and Physiologic Parameters as Measures of Stress in Medical Students
Guccione, A. J., Nahmias, A., Morgan, D. P., Chin, C. Y., Di Caro, F. J., Cirrone, M. D., Chadha, J., Bressler, K., Chan, T., Donoghue, J., DiRusso, S.
Journal of Osteopathic Medicine, 2024/12


216

Building Disability Competency in Osteopathic Medical Students in Rural Ohio Pilot Study
Hughes, A., Barrett, J., Dillman, O.
Journal of Osteopathic Medicine, 2024/12


218

Trends and Outcomes in Residency Matches: Assessing the Post-Merger Landscape for DO and MD Graduates
Jerman, H., Yebernetsky, K. E., Wilson, S.M. T., Rosmarin, S., Divito, C. B.
Journal of Osteopathic Medicine, 2024/12

219

Exploring the Impact of Musculoskeletal Conducting Injuries in Choral Music Educators: An Osteopathic Survey Analysis
Li, S., Wehner, B., Sullivan, R., McNickle, C.
Journal of Osteopathic Medicine, 2024/12



222


223

Osteopathic Medical Student Experiences with Assessing Red-Reflex in Different Skin Tones
Shah, P., Curran, S.
Journal of Osteopathic Medicine, 2024/12

224

Evaluation of the Use of 3D Printed Spinal Models to Educate and Assess Osteopathic Medical Students
Valdés, D., Zarandy, J., Sherrington, M., Cohen, M., Matechak, J.
Journal of Osteopathic Medicine, 2024/12

225

Third-year medical students' perceptions of confidence and readiness to perform EFAST after training
Rocic, P., Garrison, R., Stitle, K., Reynolds, A., Andrews-Dickert, R.
BMC Medical Education, 2024/12
Free full text


227

Regarding “Issues of informed consent for non-specialists conducting colorectal cancer screenings”
Ali, S., Mowery, R., Hoff, R. T.
Journal of Osteopathic Medicine, 2024/11
Free full text

228


229

Concerns of osteopathic medical students during the COVID-19 pandemic
Hanna, O., Vinyard, C. J., Casapulla, S.
Journal of Osteopathic Medicine, 2024/11
Free full text

230

Unpacking ABSITE Performance: Evaluating International vs Domestic Medical Graduates and DO vs MD Trainees in a Joint Residency Program
Rahimpour, A., Baxter, J. D., Fox, D. W. N., Morrison, M., Denning, D. A., Ray, P. D., Barry, R.
Journal of the American College of Surgeons, 2024/11

231

Feasibility of a cinematic-virtual reality training program about opioid use disorder for osteopathic medical students: a single-arm pre–post study
Rehl, D., Mangapora, M., Love, M., Love, C., Shaw, K., McCarthy, J., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/11
Free full text


233

Osteopathic Research in Family Medicine
Stacey, S. K., Seidenberg, P. H.
Journal of the American Board of Family Medicine, 2024/11
Free full text

234

Students with prior anatomy experience start out stronger in medical school gross anatomy
Louro, M. D., Meegan, G., Rudin, L. R., Granatosky, M. C., Thompson, N. E.
Anatomical Sciences Education, 2024/10

235

Associations of clinical personnel characteristics and telemedicine practices
Phillips, G., Millhollon, R., Elenwo, C., Ford, A. I., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/10
Free full text

236

Response to “Fostering a research culture in osteopathic medical education”
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2024/10
Free full text

237

Fostering a research culture in osteopathic medical education
Kadavakollu, S., Dang, T., Richards, S.
Journal of Osteopathic Medicine, 2024/10
Free full text

238

Assessing nutrition literacy and nutrition counseling proficiency following an interdisciplinary culinary medicine elective
Kirby, A. N., DeBellis, J., Wolter, K., Mount, G., Wang, C.H., Bishop, J., Barkhouse, J., Wirth, K., Nguyen, N., Cacciatore, C., Kraus, K.
Journal of Osteopathic Medicine, 2024/10
Free full text

239

Improving learning experience through implementing standardized team-based learning process in undergraduate medical education
Andrews-Dickert, R., Nagaraj, R., Zhan, L., Knittig, L., Zhao, Y.
BMC Medical Education, 2024/10
Free full text


241

The Transformative Care Continuum: implementing an accelerated pathway that addresses the new roles of the family medicine physician
Chrisman-Khawam, L., Snyder, S., Tyler, C., Harley, D., Davidson, E., Anthes, L., Casapulla, S.
Medical Education Online, 2024/10
Free full text

242

Geographical Distribution and Trends Analysis of Osteopathic General Surgery Residents
Ernst, M. D., Alexander, V. S., Wong, R., Berg, N., Roberts, H., Vogel, A. D., Burns, J. B., Conrad-Schnetz, K.
Cureus, 2024/10
Free full text

243

The Effect of an Anatomy Prep Course on OMS-1 Student's Performance During the Fall Semester
Prasad, D. M., Inman, A. M., Blanc, P. K., Gaunt, J. A., Guzik, H. M., Peterson, J. L.
Clinical Anatomy, 2024/10


245

Evaluating the Impact of Direct, Direct Video, and Indirect Video Laryngoscopy Training on the Proficiency of Medical Students in Performing Direct Laryngoscopy: A High-Fidelity Manikin-Based Assessment
Moriarty, S. E., Perera, I. R., Sabbagh, M., Yeckley, M., Carpio, P., Hoodfar, A., LePera, A., Anandakrishnan, R., Daniels, T., Martin, R., Looney, J., Gittings, K., Edwards, W., Rawlins, F.
Cureus, 2024/10
Free full text

246

Limb spasticity and telemedicine consultation for reconstructive surgery: patient perspectives of surgical assessment
Bardwell, A., Crowe, C. S., Rhee, P. C.
Journal of Osteopathic Medicine, 2024/09
Free full text

247

Food insecurity and childhood outcomes: a cross-sectional analysis of 2016–2020 National Survey of Children’s Health data
Elenwo, C., Fisch, C., Hendrix-Dicken, A., Coffey, S., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/09
Free full text


249

Advancing nutrition knowledge, skills, and attitudes in medical education and training: key themes and recommendations from the 2023 Summit
Hitchell, K. S., Holton, L., Surdyk, P. M., Combes, J. R.
The American Journal of Clinical Nutrition, 2024/09
Free full text

250

Integrating nutrition and culinary medicine into preclinical medical training
Johnston, E. A., Torres, M., Goldgraben, S., Burns, C. M.
BMC Medical Education, 2024/09
Free full text


252

Geographical Distribution of Osteopathic Neurosurgery Residents
Ariwodo, O., Greek, A., Wong, R., Alexander, V. S., Vogel, A. D., Burns, B., Conrad-Schnetz, K.
Cureus, 2024/09
Free full text

253

Response to “Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection“
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2024/09
Free full text

254

Decreasing the Anxiety and Shame of Medical Students Not Placing into a Residency Using an Innovative Fifth-Year Educational Intervention
Ferrill, H. P., Brooks, A.
Journal of Medical Education and Curricular Development, 2024/09
Free full text

255

An osteopathic orientation to interprofessional education
Martinez, E. S., Redding, D.
Journal of Osteopathic Medicine, 2024/09
Free full text

256

Osteopathic manipulative treatment for the allopathic resident elective: comments on survey selection
Copenhaver, W. K.
Journal of Osteopathic Medicine, 2024/09
Free full text

257

Trends in Utilization and Cost of Nonpharmacological Pain Therapies in the United States Under Medicare Part B, 2000-2022
Whedon, J., Zakhary, G.
Journal of Integrative and Complementary Medicine, 2024/09

258

Association and disparities of food insecurity and exposure to violence: analysis of the National Survey of Children’s Health
Bloom, M., McCoy, C., Hendrix-Dicken, A. D., Elenwo, C., Baxter, M. A., Coffey, S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/08
Free full text

259

The establishment of conscientious monopolies in rural communities
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/08
Free full text

260

Changes in the Affective Empathy of Osteopathic Students: a Longitudinal Study
Newton, B. W., Vaskalis, Z. T.
Medical Science Educator, 2024/08

261

The WELLMESS Project (Move Well, Eat Well, Sleep Well, Stress Well)
Machireddy, D. R., Reid, C. G., Hollingsworth, J. C., Redden, D.
Cureus, 2024/08
Free full text

262

On-site peer mentorship’s effect on personal and professional development, stress reduction, and ease of transition into the medical education system
Whitfield, S., Hazard, C., Haynes, B., Coffey, T., Lynch, L., Davis, S.
Journal of Osteopathic Medicine, 2024/08


264

Common outpatient diagnoses and associated treatments logged by osteopathic medical students within a geriatric population
Coulson, H. C., Brown, M., Burke, K., Griffith, E., Shadiack, V., Garner, H. R., Foushee, J. A.
Journal of Osteopathic Medicine, 2024/08
Free full text

265

Students Matriculating into Integrated Plastic Surgery: Are all Medical Schools Equal?
Yau, A., Lentskevich, M. A., Reddy, N. K., Gutowski, K. S., Yau, I., Gosain, A. K.
The Journal of Craniofacial Surgery, 2024/08


267

The hindrance of matching into neurosurgery from doctors of osteopathic-medicine perspective
Kashif, M., Muthana, A., Al-Qudah, A. M., Hoz, S. S.
Surgical Neurology International, 2024/07
Free full text

268

Medical malpractice liability in large language model artificial intelligence: legal review and policy recommendations
Shumway, D. O., Hartman, H. J.
Journal of Osteopathic Medicine, 2024/07
Free full text

269

Interest in Cardiothoracic Surgery Among the American College of Osteopathic Surgeons’ Medical Students
Vogel, A. D., Wynn, A. B., Richards, M. C., Sindoni, M., Brennan, Z., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2024/07

270

A survey of current specialty palliative care education in the United States
Dahlin, C., Wright, P. M.
Annals of Palliative Medicine, 2024/07
Free full text

271

A validity study of COMLEX-USA Level 3 with the new test design
Mao, X., Boulet, J. R., Sandella, J. M., Oliverio, M. F., Smith, L.
Journal of Osteopathic Medicine, 2024/06
Free full text

272

Implementation and mixed-methods evaluation of “Walk with a Doc” program at Stony Brook
Landman, U. N., Naeem, Z., Chen, I. L., Naeem, A., Jaber, R.
Journal of Osteopathic Medicine, 2024/06
Free full text

273

Comorbidities associated with symptoms of subjective cognitive decline in individuals aged 45–64
Monahan, Z., Heath, J., Santos, A. D., Ford, A., Hartwell, M.
Journal of Osteopathic Medicine, 2024/06
Free full text

274

Clinician Educator Milestones: Assessing and Improving Educators' Skills
Mahan, J. D., Kaczmarczyk, J. M., Miller Juve, A. K., Cymet, T., Shah, B. J., Daniel, R., Edgar, L.
Academic Medicine, 2024/06
Free full text

275

Somatic Dysfunction and Behavior Correlates in Medical Students
LaFontano, C. M., Huzij, T., Garlock, M., Speth, M., Ko, K., Crouch, N., McDaniel, R., McEchron, M.
The AAO Journal, 2024/06


277

Counterstrain Point Frequency and Treatment in Osteopathic Medical Students
Arnold, C., Quackenbush, D., Fahim, A., Quackenbush, G., Navarro, A., Edwards, C.
The AAO Journal, 2024/06

278

Exploring the Evolution of the Mind-Body Connection as First-Year Osteopathic Medical Students Learn about Common Osteopathic Dysfunctions
Krauss, A., Normil, N., Mosley, B., George, S., Volokitin, M., Milani, S., Henshaw, M.
The AAO Journal, 2024/06


280

The Impact of Peer-to-Peer Review-Preview Sessions on Student Confidence and Interest in OMT
Lakhian, K., Tilton, N., Milunovich, L., Lord, K., Rau, D.
The AAO Journal, 2024/06

281

OMT in the 21st century: current use of technologies in manual therapy education and opportunities for innovation
Pietrantoni, D., Krzykwa, E., Broussard, D., Fredrickson, T., Waters, H., Mehra, R.
The AAO Journal, 2024/06

282

Learning Mindsets and Well-Being and Ill-Being Among Osteopathic Medical Students
Tibbetts, Y., Himmelberger, Z. M., Barron, K. E., Speicher, M. R., Hulleman, C. S.
JAMA Network Open, 2024/06
Free full text

283

Stressbusters: Investigating the Effects of OMT on Stress Management in Medical Students
Valencia, R., do Rego Barros, G., Anche, G., Arostegui, V., Sutaria, H., McAllister, E., Volokitin, M., Banihashem, M.
The AAO Journal, 2024/06


285

Associations of social determinants of health and childhood obesity: a cross-sectional analysis of the 2021 National Survey of Children’s Health
Batioja, K., Elenwo, C., Hendrix-Dicken, A., Ali, L., Wetherill, M. S., Hartwell, M.
Journal of Osteopathic Medicine, 2024/05
Free full text

286

Research integrity and academic medicine: the pressure to publish and research misconduct
Kearney, M., Downing, M., Gignac, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text


288

Perception of opioids among medical students: unveiling the complexities and implications
Borgemenke, S., Durstock, N., DeShetler, L., Matus, C., Beverly, E. A.
Journal of Osteopathic Medicine, 2024/05
Free full text

289

Diversity in osteopathic medical school admissions and the COMPASS program: an update
Dady, N., Toplan, S., Gardere, J., Moore, R., Agandi, L., Ulysse, U. F., Aminpour, A., Gelvin, M., Akinsanya, J., Steier, K.
Journal of Osteopathic Medicine, 2024/05
Free full text

290

The Tensegrity Curriculum: A Comprehensive Curricular Structure Supporting Cultural Humility in Undergraduate Medical Education
Jones, A. C., Bertsch, K. N., Williams, D., Channell, M. K.
Advances in Medical Education and Practice, 2024/05
Free full text


292

Building Interprofessional Competencies Through a Collaborative Prescribing Activity With Osteopathic, Pharmacy, and Physician Assistant Students
Vernon, V., Skinner, B. W., Devine, P. S., Fauquher, L., Young, E.
MedEdPORTAL, 2024/05
Free full text


294

Doctors of Osteopathic Medicine as Plastic Surgery Residents: Demographics, Credentials, and Pathways to Residency
Raborn, L. N., Elmorsi, R., Smith, B. T., Asaad, M., Kelley, R., Egro, F. M.
Journal of Surgical Education, 2024/04

295

Telehealth in opioid use disorder treatment: policy considerations for expanding access to care
Niyibizi, A., Haveric, A., Irio, G.
Journal of Osteopathic Medicine, 2024/04
Free full text

296

The impact of emergency medicine residents on clinical productivity
Pallaci, M., Jouriles, N., dos Santos, A., Miller, J., Gothard, M. D., Seaberg, D. C.
Journal of Osteopathic Medicine, 2024/04
Free full text

297

The Academic Medicine and Leadership Track for Medical Students
Glaser, K., McEchron, M., Jensen, C., Park, D.
Medical Science Educator, 2024/04
Free full text

298

The Impact of Financial Education on Stress Among Orthopaedic Surgeons
Higginbotham, D. O., Nham, F. H., Cavazos, D. R., Chen, C., Stoker, S. K.
Cureus, 2024/04
Free full text

299

Effect of COVID-19 Curriculum Changes on Medical Student Exam Performance: A Case Series
Ho, J., Levy, J., Afshari, N., Patel, D., Andersen, S., Simanton, E., Linton, M.
Cureus, 2024/04
Free full text

300

Where are the Black men in osteopathic medical schools?
Megafu, M. N.
Journal of Osteopathic Medicine, 2024/04
Free full text

301

DO seniors and IMGs have lower match probabilities than MD seniors after adjusting for specialty choice and USMLE Step 1 score
Nikolla, D. A., Bowers, K. M., Smith, B., Elsayed, C. L., Daniels, A., Sandoval, T., Hitchman, K. J., Asar, I., Kolacz, D. C., Mudrakola, V.
Journal of Osteopathic Medicine, 2024/04
Free full text

302

The 7 Elements Communication Rating Form for Teaching and Assessing Medical Communication Competency
Wise, C. M., Lovett, G. D., Swarm, G. M., Nazar, A.
Cureus, 2024/04
Free full text

303

Exploring the effectiveness of virtual and in-person instruction in culinary medicine: a survey-based study
Glickman, O., Kakaty-Monzo, J., Roberts, M., Daghigh, F.
BMC Medical Education, 2024/03
Free full text

304

Combating Modern DO Stigmatization
Cooney, A., Vega, L., Goodwin, B. J., Adams, J., Mangrola, F., Price, L. M., Powell, L.
International Journal of Osteopathic Medicine, 2024/03

305

Arctic Medicine
Katrine, B.
The AAO Journal, 2024/03
Free full text

306

The impact of osteopathic recognition on multiple medical specialty residencies in a university-based setting
Nohomovich, B., Tito, E., Baker, J., Gomes, T.
Journal of Osteopathic Medicine, 2024/03
Free full text

307

Teaching ultrasound in osteopathic medical schools
Slyvka, Y., Gwilym, J. L.
Journal of Osteopathic Medicine, 2024/03
Free full text

308

A pilot study to assess medical students' perception of their osteopathic manipulative therapy (OMT) education
Leavitt, N. J., Sundman, R. S., Mazzi, J. R., Spaan, J. M., Kisby, G. E.
International Journal of Osteopathic Medicine, 2024/03

309

Expansion of osteopathic medicine practitioner education on substance use disorders
Petrides, J., Jha, S., Kowalski, A., Hosein, S., Collins, P. B., Coren, J.
Journal of Osteopathic Medicine, 2024/03
Free full text

310

Medical Students' Knowledge, Attitudes Toward, and Identification of Adverse Childhood Experiences and Trauma-Informed Care
Piszczor, R., Barry, C., Gundacker, C., Wallace, C., Shibuya, J., Perle, J.
The Permanente Journal, 2024/03
Free full text

311

Academic Degree Bias Among Speaking and Leadership Roles at the American Academy of Orthopaedic Surgeons Annual Meetings, 2016-2021
Bartlett, L., Daley, A., Kazimierczak, A., Klein, B., Humbyrd, C., Bitterman, A., Cohn, R.
Cureus, 2024/03
Free full text

312

Cross-Sectional Analysis of the Effect of Physical Activity, Nutrition, and Lifestyle Factors on Medical Students' Academic Achievement
Neuman, J., Ina, E. A., Huq, S. O., Blanca, A., Petrosky, S. N.
Cureus, 2024/03
Free full text

313

The Effects of Single Accreditation and Pass/Fail Licensing Exams on Osteopathic Medical Students Applying to Surgical Residency Programs
Panchal, O., Pereira, K., Brennan, Z., Young, G., Casey, T., Paluri, S. N., Burns, B., Gudakunst, C., Conrad-Schnetz, K.
Journal of Surgical Education, 2024/03

314

Prevalence and quality of medical Spanish education in US osteopathic medical schools: a national survey
Dey, K., Romero Arocha, S., Park, Y. S., Ortega, P.
Journal of Osteopathic Medicine, 2024/02
Free full text

315

Osteopathic Medical Schools Produce an Increasing Proportion of Family Medicine Residents
Pristell, C., Byun, H., Huffstetler, A.
American Family Physician, 2024/02
Free full text

316

The Prevalence and Distribution of Osteopathic Chief Residents in Emergency Medicine
Wandro, E., Rammaha, S., McGurk, K.
Cureus, 2024/02
Free full text

317

A randomised trial evaluating dietary and osteopathic techniques on quality of life and modulation of the inflammatory state in patients under antiestrogenic hormonal treatment after breast surgery
Ferraris, C., Listorti, C., Vernieri, C., Capri, G., Bianchi, G., Fucà, G., Ligorio, F., Martelli, G., Pilotta, F., Osio, C., Maugeri, I., Venturelli, E., Borreani, C., Alfieri, S., Folli, S., Miceli, A.
European Journal of Surgical Oncology, 2024/02

318

Identified strategies to mitigate medical student mental health and burnout symptoms
Ozan, K. G., McGough, J. E. G., Gabel, J., Snow, M., Michel, N., Cooper, L., Robinson, K.
Journal of Osteopathic Medicine, 2024/02
Free full text

319

Social determinants of health in patients with arthritis: a cross-sectional analysis of the 2017 Behavioral Risk Factor Surveillance System
Webb, J., Emmert, R., Reddy, A., Sajjadi, N. B., Greiner, B., Bray, N., Hartwell, M.
Journal of Osteopathic Medicine, 2024/02
Free full text

320

An assessment of surgery core rotation quality at osteopathic medical schools
Casey, T., Brennan, Z., Pereira, K., Young, G., Paluri, S. N., Gudakunst, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

321

The clinical anatomy fellowship: A participants' perspective
Thiel, G. E., Murtha, C. M., Dennis, J. F., Hopper, M.
Anatomical Sciences Education, 2024/02

322

Analysis of Variation in the Origin of the Obturator Artery in Midwestern American Donor Bodies
Diemer, C., Schubert, B., Funk, S., Markand, S.
Cureus, 2024/02
Free full text

323

Family planning competency following medical school Ob/Gyn clerkships at faith-based and secular sites
Feltman, R. N., Lewis, S. R., Thompson, N. E.
Scientific Reports, 2024/02
Free full text

324

Evaluating attitudes among healthcare graduate students following interprofessional education on opioid use disorder
Karagiannis, C., Liang, J., Pierre, S. S., Brody, C., Kinnevey, C.
Journal of Osteopathic Medicine, 2024/02
Free full text

325

Issues of informed consent for non-specialists conducting colorectal cancer screenings
Bohler, F., Garden, A.
Journal of Osteopathic Medicine, 2024/01
Free full text

326

Retrospective analysis of robotic unicompartmental and total knee arthroplasties: patient demographics and outcomes
Kendrick, A. M., Carter, J. M., Gregg, N., MacNeill, S. C., Gittins, M. E.
Journal of Osteopathic Medicine, 2024/01
Free full text

327

Association between steroid use and concussions among high school athletes: a cross-sectional analysis of the Youth Risk Behavior Surveillance System
Sherman, K., Tyree, P., Ford, A. I., Mazur, A., Nolan, D., Hartwell, M.
Journal of Osteopathic Medicine, 2024/01
Free full text


329

The Effect of the Coronavirus (COVID-19) Pandemic on Gender and Medical School Diversity in Gastroenterology Fellowship Matching
Almujarkesh, M. K., Alsakarneh, S., Almeqdadi, M., Al Ta'ani, O., Mohamad, B., Kinnucan, J.
Gastro Hep Advances, 2024/01
Free full text

330

Visual Health Impact of Online Learning During COVID-19 in Osteopathic Medical Students
Syed, Z., Quadri, S.
Journal of Osteopathic Medicine, 2023/12

331


332

Attitudes of Osteopathic Medical Students on the Future of Medical Education and Clinical Practice following the Dobbs v. Jackson Women’s Health Organization Decision
Zielinski, P., Krzykwa, E., Vilar, N., Lewandowski, T., Llerena, G., Nadery, S., Jacobs, R. J.
Journal of Osteopathic Medicine, 2023/12

333

A Student-Driven Mindfulness Curriculum for First-Year Osteopathic Medical Students: A Pilot Study
Nielsen, C., Katz, S., Parker, M., Trefsgar, J., Bcharah, H., Kalin, J., Delavary, D., Brunk-Grady, M., Jaqua, B.
Journal of Osteopathic Medicine, 2023/12
Free full text

334

Osteopathic Medical Students’ Preferences for Viewing Lectures at a Multi-Campus Medical School
King, L., Rodgers, J., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

335

The Effect of Osteopathic Medical Students’ Age on Desired Specialty
Raidah, A., Huang, P., Tariq, N., Wong, H., Hildreth, L., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

336

Examining Osteopathic Medical Students’ Experiences with Distance Learning and Social Connectedness
Rodgers, J., King, L., Schmitz, E., Beverly, E. A.
Journal of Osteopathic Medicine, 2023/12

337

Building Interest in the Primary Care Specialty Through Enhanced Global Health Experience
Hernandez, M., Ibiwoye, M. O., Ledbetter, M., Thacker, R., Diaz, S.
Cureus, 2023/12
Free full text

338

Mental health differences in medical students based on curriculum and gender
Jestin, M., Sharma, S., Jhaveri, D., Mitchell, B., Micciche, D., Venkataraman, V., Lambert, K.
BMC Medical Education, 2023/12
Free full text

339

Racial, Ethnic, and Sex Diversity Trends in Health Professions Programs From Applicants to Graduates
Majerczyk, D., Behnen, E. M., Weldon, D. J., Kanbar, R., Hardy, Y. M., Matsuda, S. K., Hardinger, K. L., Khalafalla, F. G.
JAMA Network Open, 2023/12
Free full text

340

Improving Transparency in the Residency Application Process: Survey Study
Ulin, L., Bernstein, S. A., Nunes, J. C., Gu, A., Hammoud, M. M., Gold, J. A., Mirza, K. M.
JMIR Formative Research, 2023/12
Free full text

341

Diversity in Mission Statements and Among Students at US Medical Schools Accredited Since 2000
West, K., Oyoun Alsoud, L., Andolsek, K., Sorrell, S., Al Hageh, C., Ibrahim, H.
JAMA Network Open, 2023/12

342

The effectiveness of disinfection protocols in osteopathic family medicine offices
Phyu, R., Patrizio, H. A., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12
Free full text

343

Impact of the USMLE Step 1 and COMLEX Level 1 transition to Pass/Fail on osteopathic medical student stress levels and board preparation
Twardowski, D. A., Montemayor, J., Payton, M., Waller, J.
Journal of Osteopathic Medicine, 2023/12
Free full text

344

Patient, Provider, and Practice Characteristics Predicting Use of Diagnostic Imaging in Primary Care: Cross-Sectional Data From the National Ambulatory Medical Care Survey
Yi, S. Y., Narayan, A. K., Miles, R. C., Martin Rother, M. D., Robbins, J. B., Flores, E. J., Ross, A. B.
Journal of the American College of Radiology, 2023/12

345

Attitudes and Practice Patterns In The Use Of OMM In Patients With Serious Illness
Brisseau, C. N., Hoffman, B., Joseph, N., Noto-Bell, L., Felgoise, S., Srulevich, M.
Journal of Osteopathic Medicine, 2023/12

346

Evaluation of Using Three-Dimensional Sacral Models in the Education of Sacral Osteopathic Manipulative Treatment: A Quality Improvement Study
Carr, G., Schury, C., Hammer, T., Lippert, J., Azevedo, L.
Journal of Osteopathic Medicine, 2023/12

347



349

Healthcare Camp for High School Students Enhances the Understanding of Foundations of Osteopathic Medicine, Identifying Implicit Bias, and Recognizing Social Determinants of Health
Flanagan, M. K., Liu, E. L., Neff, A. R., Klink, A. M., Kruse, K. M., Vroegop, J. M., Orr, A. L., Skinner, B. W., Hum, J. M.
Journal of Osteopathic Medicine, 2023/12

350

Empathy Fatigue in Osteopathic Medical Students
Gernert, E., Malaker, P., Nguyen, T., Uptegrove, L., Nagireddi, S.
Journal of Osteopathic Medicine, 2023/12

351

Accuracy and Student Perceived Confidence of Varying Knee Aspiration Methods
Grayson Lindsey, T., Barron, D., Deal, A., German, E., Hogge, K., Reese, B., Stokes, S., Woodruff, T.
Journal of Osteopathic Medicine, 2023/12


353

Relationship Between Student Specialty Choice and Intention to Utilize Osteopathic Manipulative Techniques
Huang, P., Wong, H., Tariq, N., Hildreth, L., Raidah, A., Jung, M.K., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2023/12

354

Efficacy of Virtual Reality Programs versus Traditional Lectures on Osteopathic Medicine Information Retention
Jacob, T. J., Jose, R. M., Abraham, A., Syed, F., Tran, T.
Journal of Osteopathic Medicine, 2023/12


356

Assessing the Quality and Quantity of Research Among Incoming First-Year Osteopathic Medical Students
Lynch, S., Byrne, J., Sharieff, K.
Journal of Osteopathic Medicine, 2023/12

357

Student Utilization of Osteopathic Manipulative Treatments on Clinical Rotations
Nelson, C., Dean, G., Dean, D., Martinez, E., Goering, E.
Journal of Osteopathic Medicine, 2023/12

358

Implementing Enhanced Disinfection Protocols in Medical School OMM Labs
Patrizio, H. A., Phyu, R., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12

359

The Effectiveness of Disinfecting Protocols in Osteopathic Family Medicine Offices
Phyu, R., Patrizio, H. A., Boyle, T., Schachter, T.
Journal of Osteopathic Medicine, 2023/12



362

Trends in Contributions to the Osteopathic Political Action Committee: A Twenty-Two-Year Analysis
Scully, T., Loria, R., Golden, A., Martinez, V. H., Sees, J.
Journal of Osteopathic Medicine, 2023/12

363

Exploring the Impact of Osteopathic Medical School on Body Composition: A 4-Year Longitudinal Study
Steinberg, R., Donoghue, J.
Journal of Osteopathic Medicine, 2023/12

364

Ultrasound-assisted bony landmark palpation in untrained palpators
Nichols, J. W., Schmidt, C., Raghuraman, D., Turner, D.
Journal of Osteopathic Medicine, 2023/11
Free full text

365

A Pilot Study of Symptoms of Major Depressive Disorder in Medical Students at an Osteopathic Medical School Before and After High-Stakes Examinations
Arabatzis, T. J., Doroshenko, J., Ashraf, M. A., Smith, R. M.
Advances in Medical Education and Practice, 2023/11
Free full text

366

Defining the landscape of patient harm after osteopathic manipulative treatment: synthesis of an adverse event model
Unger, M. D., Barr, J. N., Brower, J. A., Kingston, J. C., Heller, G. R., Palmer, J. L.
BMC Complementary Medicine and Therapies, 2023/11
Free full text

367

Time Until Proof of Credentials Significantly Decreases With the Use of Blockchain Technology and the Document Management System
Tissier, E. A., Berglund, A., Johnson, G. J., Sanzone, Z. A., Goodbread, A. P., Parker, H., Lucas, J., Kashmer, D.
Cureus, 2023/11
Free full text

368

Building Interest in Cardiothoracic Surgery at an Osteopathic Medical School: Results of an Institutional Study and a Guide for Medical Schools
Vogel, A. D., Wynn, A., Sindoni, M., Richards, M. C., Eppler, A. R., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
Cureus, 2023/11
Free full text


370

Educational intervention promotes injury prevention adherence in club collegiate men's lacrosse athletes
Gawrys, S. P., Wong, W. J., Parker, L. M., Bradshaw, J. T., Starr, E. G., Wilde, B.
Journal of Osteopathic Medicine, 2023/11
Free full text

371

Key factors for residency interview selection from the National Resident Matching Program: analysis of residency Program Director surveys, 2016-2020
Stone, C. L., Dogbey, G. Y., Falls, J., Kuo, Y. P.
Journal of Osteopathic Medicine, 2023/11
Free full text

372

Neurosurgery Clerkships in United States Medical Schools: A Survey of MD- and DO-Granting Schools
Hulse, K., Durfy, S., Lassiter, E., Ravanpay, A. C.
World Neurosurgery, 2023/11

373


374

Enhancing Future Healthcare Professional Education Surrounding Substance Use Disorders
Riccio, K. K. C., Hales, K., Whittaker, A.
Journal of Addiction Medicine, 2023/10

375

Implementation of an enhanced recovery after surgery (ERAS) protocol for total abdominal hysterectomies in the division of gynecologic oncology: a network-wide quality improvement initiative
Ackert, K. E., Bauerle, W., Pellegrino, A. N., Stoltzfus, J., Pateman, S., Graves, D., Graul, A., Taylor, N., Zighelboim, I.
Journal of Osteopathic Medicine, 2023/10
Free full text

376

Optimal hand surgery fellowship interview format
Dittman, L. E., Munaretto, N. F., Rhee, P. C.
Journal of Osteopathic Medicine, 2023/10
Free full text

377

Diabetic ketoacidosis diagnosis in a hospital setting
Healy, A. M., Faherty, M., Khan, Z., Emara, N., Carter, C., Scheidemantel, A., Abu-Jubara, M., Young, R.
Journal of Osteopathic Medicine, 2023/10
Free full text

378

Critical care medicine training in the age of COVID-19
Mickey, W.
Journal of Osteopathic Medicine, 2023/09
Free full text

379

The effect of perceived weight status and BMI perception on food attitudes and food relationships
Patel, S. K., Gericke, R., Dougherty, J., Gupta, A.
Journal of Osteopathic Medicine, 2023/09
Free full text

380

The Effectiveness of a Mobile Health Clinic Delivering Mandatory and Elective Middle School Immunizations: A Descriptive Analysis
LaGattuta, N. R., Wilson, T. C., Failla, J. A., Stoner, A. M., Fradua, K., Brown, J., Byrd, S. C., Wilson, A., Jones, D., Carroll, L.
Cureus, 2023/09
Free full text

381

Assessing interest in cardiothoracic surgery at an osteopathic medical school: Results of an institutional survey
Vogel, A. D., Wynn, A., Richards, M. C., Sindoni, M., Hamilton, C. L., Gallegos, J. J., Wallen, T. J.
JTCVS Open, 2023/09

382

Equal but Separate: The Slow Assimilation of Osteopathic Surgery Residents Two Years After the Unified Match
Bello, G., Lyles, E., Owens, S., Wilson, A. S., Westby, R. W., Evans, W., Edmondson, E., Lindsey, T. G. II., Falcone, J. L., Boyev, A.
Journal of Surgical Education, 2023/09


384

Understanding the Use of Program Resources During Virtual Recruitment by Psychiatry Residency Applicants
Bernstein, S. A., Hodgins, G. E., Abu-Hamad, S., Gih, D. E., Gold, J. A.
Academic Psychiatry, 2023/08
Free full text

385

Assessing patient experience of the tenets of osteopathic medicine
Davis, G. E., Hartwig, W. C., Riemer, R. B., Char, C., McTighe, A., Kremelberg, D.
Journal of Osteopathic Medicine, 2023/08
Free full text

386

The Evaluation of a Digital Health Intervention to Improve Human Papillomavirus Vaccine Recommendation Practices of Medical Students
Richman, A. R., Torres, E., Wu, Q., Eldridge, D., Lawson, L.
Journal of Cancer Education, 2023/08

387

Associations of intimate partner violence and maternal comorbidities: a cross-sectional analysis of the Pregnancy Risk Assessment Monitoring System
Hartwell, M., Keener, A., Robling, K., Enmeier, M., Sajjadi, N. B., Greiner, B., Price, J.
Journal of Osteopathic Medicine, 2023/08
Free full text

388

Diversity Differences Among Cardiovascular Fellowships Across Five Geographic Regions in the United States
Dye, M., Saeed, A., Nguyen, T. Q., Yu, S., Bey, J., Hefner, D., Walk, C. T., Lantz, R.
Cureus, 2023/08
Free full text

389

Integrating physiology into the first two years of a new osteopathic medical school curriculum
Slater, N. F., Nizamutdinova, I., Jacobs, B. A., Slater, R. T., 3rd, Bradley
Frontiers in Physiology, 2023/08
Free full text

390

Awareness and interest in osteopathic manipulative treatment in allopathic medical students
Darby, A., Parascando, J. A., Lipinski, M., Lipinski, C., Mendez-Miller, M., Berg, A., Rabago, D., Oser, T. K.
Journal of Osteopathic Medicine, 2023/08
Free full text

391

The Revolving Door of Residency: Predictors of Residency Attrition for Urology Matriculants Between 2001 and 2016
Gurayah, A. A., Mohamed, A. I., Rahman, F., Bernstein, A. P., Asafu-Adjei, D., Ezeh, U. C., Willey, B. C., Balumuka, D., Yarholar, L. M., Gosman, A., Ramasamy, R.
Urology, 2023/07

392

Surgical simulation in osteopathic medical schools
Seely, K. D., Hansen, M., Paluri, S. N., Rasmussen, K., Carter, S., Nigh, A.
Journal of Osteopathic Medicine, 2023/07
Free full text

393

Trends and forecasted rates of adverse childhood experiences among adults in the United States: an analysis of the Behavioral Risk Factor Surveillance System
Hartwell, M., Hendrix-Dicken, A., Terry, R., Schiffmacher, S., Conway, L., Croff, J. M.
Journal of Osteopathic Medicine, 2023/07
Free full text

394

Integrating A Student Co-Created Health Systems Science Curriculum Within UME
Ethridge, B., Steadman, M., Crews, B.
Southern Medical Journal, 2023/07


396

Physician stress in the era of COVID-19 vaccine disparity: a multi-institutional survey
Zahl, S., Mondal, D., Tolentino, D., Fischer, J. A., Jimenez, S.
Journal of Osteopathic Medicine, 2023/07

397

Osteopathic manipulative treatment for the allopathic resident elective: does it change practice after graduation?
Slattengren, A. H., Wootten, M. E., Carlin, C. S., Nissly, T. J.
Journal of Osteopathic Medicine, 2023/07
Free full text

398

Learning abnormal physical examination signs: an introductory course
Sabirov, A., Chludzinski, M., Eminof, E., Eddy, A., Gallagher, J., Jung, I.
Journal of Osteopathic Medicine, 2023/06
Free full text

399

Incorporation of an osteopathic-focused lecture series into an already established pediatric residency curriculum
Wysong, M., Copenheaver, D., Powers, L., Flaherty, R.
The AAO Journal, 2023/06
Free full text

400

Trends of colorectal cancer screening methods: an analysis of Behavioral Risk Factor Surveillance System data from 2018-2020
Balcerak, G., Garrett, M., Greiner, B. H., Hartwell, M.
Journal of Osteopathic Medicine, 2023/06
Free full text

401

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists: An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/06

402

The relationship between required physician letters of recommendation and decreasing diversity in osteopathic medical school admissions
Fox, J., Burgess, J., Stoner, A. M., Garner, H., Bendyk, H.
Journal of Osteopathic Medicine, 2023/06
Free full text

403

Utilization and Reimbursement Trends of Osteopathic Manipulative Treatment for Medicare Patients: 2000-2019
Starr, E., Smith, J. F., Hanson, R. B., Woolstenhulme, J. B., Roush, A. J., Sperry, N. B., Wilde, B., Brooks, A., Zapata, I.
Journal of Osteopathic Medicine, 2023/06
Free full text


405

Allopathic and Osteopathic Residents Perform Similarly on the Orthopedic In-Training Examination (OITE)
Gomez, C., Ranson, R., Gianakos, A., Miskimin, C., Mulcahey, M. K.
Journal of Surgical Education, 2023/05
Free full text



408

Beyond burnout: a four-year survey of osteopathic medical student mental health and the implications for the development of wellness and mental health programs
Ley, A. F., Han, J. J., Hare, E., Sikorskii, A., Taylor, J. R., Shahed, A., Guro, C.
Journal of Osteopathic Medicine, 2023/05
Free full text


410

Comparison of Hospital Outcomes for Patients Treated by Allopathic Versus Osteopathic Hospitalists : An Observational Study
Miyawaki, A., Jena, A. B., Gross, N., Tsugawa, Y.
Annals of Internal Medicine, 2023/05

411

Barriers to research opportunities among osteopathic medical students
Ho, A., Auerbach, A., Faulkner, J. J., Guru, S. K., Lee, A., Manna, D.
Journal of Osteopathic Medicine, 2023/04
Free full text

412

Understanding and preference toward DOs and OMT before and after an osteopathic principles and practice fellow lecture series
Ellson, L., Wong, N., Harper, J., Williamson, G., Zapata, I., Putnam, K., Roberts, J.
Journal of Osteopathic Medicine, 2023/03
Free full text

413

Evaluation of academic detailing to educate clinicians regarding childhood lead poisoning prevention: a pilot study
Newman, N. C., Knapke, J. M., Kiniyalocts, R., Belt, J., Haynes, E.
Journal of Osteopathic Medicine, 2023/03
Free full text



416

Racial discrimination among children in the United States from 2016 to 2020: an analysis of the National Survey of Children's Health
Elenwo, C., Hendrix-Dicken, A., Lin, V., Gatewood, A., Chesher, T., Escala, M., Hartwell, M.
Journal of Osteopathic Medicine, 2023/02
Free full text

417

The assessment of point-of-care-ultrasound (POCUS) in acute care settings is benefitted by early medical school integration and fellowship training
Kern, J., Scarpulla, M., Finch, C., Martini, W., Bolch, C. A., Al-Nakkash, L.
Journal of Osteopathic Medicine, 2023/02
Free full text

418

Factors Leading to Successful Performance on U.S. National Licensure Exams for Medical Students: A Scoping Review
Jeyaraju, M., Linford, H., Bosco Mendes, T., Caufield-Noll, C., Tackett, S.
Academic Medicine, 2023/01


420

Is cadaveric dissection essential in medical education? A qualitative survey comparing pre-and post-COVID-19 anatomy courses
Kochhar, S., Tasnim, T., Gupta, A.
Journal of Osteopathic Medicine, 2023/01
Free full text

421

Advancing care and research for traumatic brain injury: a roadmap
Sees, J. P., Matney, C., Bowman, K.
Journal of Osteopathic Medicine, 2023/01
Free full text

422

A narrative review of nine commercial point of care influenza tests: an overview of methods, benefits, and drawbacks to rapid influenza diagnostic testing
Morehouse, Z. P., Chance, N., Ryan, G. L., Proctor, C. M., Nash, R. J.
Journal of Osteopathic Medicine, 2023/01
Free full text

423

Influence of Preventive Medicine Residency Programs and Combined Master of Public Health Programs on Specialty Selection
Harding, M. C., Jung, P.
American Journal of Preventive Medicine, 2023/01
Free full text

424

How did the dietary habits of patients with chronic medical conditions change during COVID-19?
Patel, S. K., Gupta, A.
Journal of Osteopathic Medicine, 2023/01
Free full text

425

Disparities in seasonal influenza vaccine uptake and language preference among Hispanic US adults: an analysis of the 2017-2020 BRFSS
Perkins, D., Giron Lopez, A., Balcerak, G., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2023/01
Free full text

426

The effect of the COVID-19 pandemic on osteopathic education in ACGME-OR residencies from February 2020 to February 2021
Bingham, S., Bray, N. N., Eddy, A. J.
Journal of Osteopathic Medicine, 2022/12
Free full text


428

A web-based review of global health programs in U.S. allopathic and osteopathic medical schools
Edwards, M. K., An, C., Rohrbaugh, R., Peluso, M. J., Lam, S. K.
Medical Teacher, 2022/12

429

Gender Differences in Stress, Anxiety, and Depression Perceived by Osteopathic Medical Students Within the Context of the COVID-19 Pandemic
Herr, V., Emanuel, J., Farid, A., Morris, A., Balentine, J., Blazey, W., Krishnamachari, B.
Journal of Osteopathic Medicine, 2022/12

430

A Peer-led Program to Increase Diversity in Osteopathic Medical Schools: Three Year Update
Hu, J., Smart, H., Garo, J. A., Rachdi, O., Fernandes Paul, M.
Journal of Osteopathic Medicine, 2022/12

431

Osteopathic and Podiatric Medical Students’ Attitudes Toward Low Back Pain
Johnson, S., Garcia, E., Bauer, C., McLaughlin, K. S., Fuchs, S.
Journal of Osteopathic Medicine, 2022/12

432

Student Developed Didactic Series Rooted in Osteopathic Philosophy
Newman, N., Ahmed, S., Shiffler, V., Sinitsa, I., Harold, Z., Naeem, A., Lovett, G., Nazar, A.
Journal of Osteopathic Medicine, 2022/12

433

Beliefs and Attitudes About Opioid Prescribing in Patients With Low Back Pain: A Survey of Osteopathic Physicians
Pham, B., Tzau, A., Lee, A. S., DeStefano, L. A., Popovich, J. M.
Journal of Osteopathic Medicine, 2022/12

434

Reduction in Stress Among Frontline Healthcare Workers Receiving Osteopathic Manipulation
Schnautz, R., Eilerman, A., Faherty, M.
Journal of Osteopathic Medicine, 2022/12

435

Measuring the Perception of Readiness with an EHR Training: A Look into Primary Care
Saldivar, E.
Unpublished Dissertation, 2022/11
Free full text

436

Podiatric Medical Resident Wellness: A Group Survey Study
Deheer, P. A., Wolfe, W., Nichols, J. A., Badell, B. J., Patel, N. A.
Journal of the American Podiatric Medical Association, 2022/11

437

Promoting cultural competency and osteopathic medicine awareness among premedical students through a summer premedical rural enrichment program
Kadavakollu, S., Lund, K. S., Swamy, V., Kim, W. D., Llenado, R. A., Nunes, T. F., Qureshi, M., Graneto, J. W., Boyanovsky, B. B.
Journal of Osteopathic Medicine, 2022/11
Free full text

438

The effect of postgraduate osteopathic manipulative treatment training on practice: a survey of osteopathic residents
Kerr, A. M., Nottingham, K. L., Martin, B. L., Walkowski, S. A.
Journal of Osteopathic Medicine, 2022/11
Free full text

439

Osteopathic manipulative treatment use among family medicine residents in a teaching clinic
Caldwell, G., Zeng, L., Kaufman, J., Bates, J.
Journal of Osteopathic Medicine, 2022/10
Free full text

440

On “Manual Therapy in Preadolescent Children: A Delphi Investigation of Physical Therapists in the United States.“
Shear, D. L., Wetzler, G., Wisneski, L. A., Rasmussen, T. R.
Physical Therapy & Rehabilitation Journal, 2022/10
Free full text

441

Exploring New Patient Understanding of Osteopathic Manipulative Medicine using a Cross-Sectional Survey and Mixed Methods Approach
Ham-Ying, J., Wisniewski, S. J., Rowan, J., Birsanescu, I., Speak, A., Malouin, R.
Spartan Medical Research Journal., 2022/09
Free full text

442

Doctors of Osteopathic Medicine (DO) and their potential impact on Canadian rural health care
Irvine, D. S., Smith, S. D., Telatin, M.
International Journal of Osteopathic Medicine, 2022/09

443

The Predictive Value of the Residency AOBFP In-Service Exam, Produced and Administered by ACOFP
Torres, J. W., Bowling, J. R., Zipp, C., Williams, N., Sandella, J. M., Martinez, L., Moore, B.
Family Medicine, 2022/09
Free full text

444

Student Attitudes About Osteopathic Medical Schools: Increasing Student Willingness to Apply
Mattiace, S. M.
Unpublished Dissertation, 2022/08
Free full text

445

Reasons Office-Based Physicians in the United States Recommend Common Complementary Health Approaches to Patients: An Exploratory Study Using a National Survey
Stussman, B. J., Nahin, R. L., Barnes, P. M., Scott, R., Feinberg, T., Ward, B. W.
Journal of Integrative and Complementary Medicine, 2022/08
Free full text

446

The Doctor of Osteopathic Medicine: The Affiliation to Orthopaedic Surgery
Sax, O. C., Angerett, N. R., Remily, E. A., Kahan, M. E., Delanois, R. E., Mont, M. A., Nace, J.
The Journal of Bone and Joint Surgery, 2022/08

447

Osteopathic Medicine and the Academic Pediatric Workforce
Cain, R. A., Leslie, L. K., Vinci, R. J., Guercio, E., Turner, A. L., Barnard, J. A.
The Journal of Pediatrics, 2022/08
Free full text

448

Professional Jurisdictions and Intraprofessional Identity Dynamics: Doctors of Osteopathic Medicine and the Doctors of General Medicine
Tsai, G., Veazey Brooks, J.
Journal of the History of Medicine and Allied Sciences, 2022/07

449

Cervical cancer screening among women with comorbidities: a cross-sectional examination of disparities from the behavioral risk factor surveillance system
Austin, J., Delgado, P., Gatewood, A., Enmeier, M., Frantz, B., Greiner, B., Hartwell, M.
Journal of Osteopathic Medicine, 2022/07
Free full text


451

Osteopathic medical students’ understanding of race-based medicine
Jivens, M., Okafor, I., Beverly, E. A.
Journal of Osteopathic Medicine, 2022/06
Free full text

452

Medical student research opportunities: a survey of osteopathic medical schools in the United States
Hamby, T., Wilson, D. P., Bui, P., Lowery, J., Basha, R.
Journal of Osteopathic Medicine, 2022/06
Free full text

453

To the Editor: Limitations and Alternative Solutions to a USMLE COMLEX-USA Concordance
Jurich, D., Liu, C., Clauser, A.
Journal of Graduate Medical Education, 2022/06
Free full text

454

To the Editor: Response to: Limitations and Alternative Approaches to a USMLE COMLEX-USA Concordance
Sandella, J., Boulet, J., Barnum, S., Tsai, T. H., Wang, Y.
Journal of Graduate Medical Education, 2022/06
Free full text


456

Osteopathic student training on preventing domestic violence
Downing-Larick, C., Moore, M., Dreher, M., Stoner, A., Fadel, N., Cheng, N.
Osteopathic Family Physician, 2022/05
Free full text

457

The Effect of Clinical Anatomy Integration on Medical Student Academic Performance and Learning Approach
Stoudemire, Claire, Terrell, Mark, McCarthy, Sarah, Gulati, Raj, Fonner, Christopher, Kulesza, Randy
FASEB journal, 2022/05
Free full text

458

Analysis of Social Mission Commitment at Dental, Medical, and Nursing Schools in the US
Batra, S., Orban, J., Zhang, H., Guterbock, T. M., Butler, L. A., Bogucki, C., Chen, C.
JAMA Network Open, 2022/05
Free full text

459

Cost of medical student virtual conference registration in ophthalmology and urology during the COVID-19 pandemic
Bradshaw, J. T., Parker, L. M., Wong, W. J., Gawrys, S. P.
Journal of Osteopathic Medicine, 2022/05
Free full text

460

Parental leave in medical school: supporting students as parents
Ortega, S. R., Barnes, J. M., Waller, J. D.
Journal of Osteopathic Medicine, 2022/05
Free full text

461

Attracting Medical Students to Family Medicine: An Historical View
Young, R. A., Tinger, S.
Family Medicine, 2022/04
Free full text


463

A retrospective and correlative analysis of academic and nonacademic predictors of COMLEX level 1 performance
Kortz, M. W., Kongs, B. M., Bisesi, D. R., Roffler, M., Sheehy, R. M.
Journal of Osteopathic Medicine, 2022/04
Free full text

464

An analysis of publication trends of orthopedic surgery residency graduates in relation to academic achievement
Carr, M., Anderson, J. M., Shepard, S., Hobbs, J., Walters, C., Johnson, A. L., Vassar, M.
Journal of Osteopathic Medicine, 2022/04
Free full text

465

Evaluating the effectiveness of countywide mask mandates at reducing SARS-CoV-2 infection in the United States
Islam, H., Islam, A., Brook, A., Rudrappa, M.
Journal of Osteopathic Medicine, 2022/04
Free full text

466

Student Perception of an OMM Virtual Practical Examination: In the Setting of Social Distancing
Berenbeim, G., Metzler, I., Lewis, D., Jie, C.
The AAO Journal, 2022/03
Free full text

467

A Concordance Study of COMLEX-USA and USMLE Scores
Barnum, S., Craig, B., Wang, X., Sandella, J., Tsai, T.H., Boulet, J., Wang, Y.
Journal of Graduate Medical Education, 2022/03
Free full text

468



470

COMLEX-USA and USMLE for Osteopathic Medical Students: Should We Duplicate, Divide, or Unify?
Ahmed, H., Carmody, J. B.
Journal of Graduate Medical Education, 2022/02
Free full text

471

The Role of Advanced Academic Degrees in Orthopaedic Sports Medicine Faculty
Chen, A. Z., Greaves, K. M., Fortney, T. A., Ahmad, C. S., Levine, W. N., Trofa, D. P., Lynch, T. S.
Orthopaedic Journal of Sports Medicine, 2022/02
Free full text

472

An integrated rural and urban underserved pathway in medical school
Casapulla, S., Longenecker, R.
Teaching and Learning in Medicine, 2022/02

473

Assessing the Knowledge of the Osteopathic Profession in New York City's Eastern European Communities
Chin, J., Kleyn, L., Dube, E., Terrell, M., Lomiguen, C. M., Volokitin, M.
Cureus, 2022/01
Free full text

474

The effectiveness of the metabolic map in promoting meaningful learning
Gromley, Z., Agwuncha, C., Nahar, V. K., Gromley, A.
Journal of Osteopathic Medicine, 2022/01
Free full text

475

Predictors of academic career placement and scholarly impact in fellowship-trained rhinologists
Vohra, V., Watley, D. C., Yan, C. H., Locke, T. B., Bernstein, I. A., Levy, J. M., Rowan, N. R.
International Forum of Allergy and Rhinology, 2022/01
Free full text

476

Collaboration of a Medical School With a Special Forces Group on Annual Training: A Blueprint
Brisson, P. A., McGregor, D. W. Jr., Murphy, Z.
Journal of Special Operations Medicine, 2022-05

477

Undergraduate pre-requisite coursework: Six important tips for pre-medical students considering Osteopathic Medical school in the USA
Kadavakollu, S., Moullet, Z., Yoshida, M., Qureshi, M., Graneto, J., Boyanovsky, B.
International Journal of Osteopathic Medicine, 2021/12

478

Parkinson's Disease Medication Administration During a Care Transition: The Impact of Interprofessional Team Simulation on Student Competency, Comfort, and Knowledge
Ellis, D. M., Hickey, S., Prieto, P., McLaughlin, C., Felgoise, S. H., Becker, M., O'Connor, M., Puleo, M., Reddy, T., Markey, D., Kim, L., Bernhardt, P. W.
Nursing Education Perspectives, 2021/12

479

Perceptions of COVID-19 vaccines among osteopathic medical students (OMS)
Al Janabi, T., Chinsky, R., Pino, M. A.
International Journal of Osteopathic Medicine, 2021/12
Free full text

480


481

The Efficacy of an OMM Virtual Reality Program on Learning for Osteopathic Medical Students
Jose, J., Ahmed, E., Piscitelli, E., Stout, R. F., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

482

Factors Influencing Osteopathic Medical Students’ Decision to Pursue a Surgical Specialty
Keever, K., Kiernan, R. N., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

483

Factors Affecting Osteopathic Medical Students’ Specialty Choice in Light of a Future Pass/Fail COMLEX Level 1 and USMLE Step 1
Kiernan, R. N., Keever, K., Monaco, A., Pino, M., Saggio, G.
Journal of Osteopathic Medicine, 2021/12

484

Understanding medical student perspectives in virtual osteopathic manipulative medicine education during the COVID pandemic
Liu, T., Torrents, M., Sharma, S., Burke, D., Giovanis, A.
Journal of Osteopathic Medicine, 2021/12

485

Assessing usage and perceptions of osteopathic manipulative treatment (OMT) and self-identity among osteopathic physicians
Mangla, M., Asif, S., Asif, S., Terzella, M., Yao, S. C.
Journal of Osteopathic Medicine, 2021/12

486

A Pilot Study to Examine Medical Students’ Perception of their Osteopathic Manipulative Therapy Education
Mazzi, J., Leavitt, N., Kisby, G.
Journal of Osteopathic Medicine, 2021/12

487

Patient Perception of Clinical Trials With and Without Osteopathic Manipulative Treatment During the COVID-19 Pandemic
Nikakis, J., Singh Arora, U., Wang, L., Abramowitz, C., Malkov, D., Cohen, T. J.
Journal of Osteopathic Medicine, 2021/12

488

Improving Upon Osteopathic Palpatory Skills using a 3D Printed Rotational Lumbar Spine Model
Rey, T., Thomas, A., Nolin, J., Sanders, J. G., Cedoz, K., Berwick, R.
Journal of Osteopathic Medicine, 2021/12

489

The Importance of Dermatology Education During Osteopathic Preclerkship Curriculum
Tan, V., Schukow, C., Vitale, V., Restini, C.
Journal of Osteopathic Medicine, 2021/12


491

MD and DO: Differing Medical Degrees and the Associated Perceptions
Harfouch, N., Grunhut, J., Hsu, A., Pinsky, S., Chacko, J., Raden, M., Slanetz, P. J., Sarkany, D.
Current Problems in Diagnostic Radiology, 2021/11

492

Attitudes toward osteopathic medicine scale: development and psychometrics
Hojat, M., DeSantis, J., Cain, R. A., Speicher, M. R., Bragan, L., Calabrese, L. H.
International Journal of Medical Education, 2021/11
Free full text


494

AOA ophthalmology and otolaryngology program closures as a model to highlight challenges of maintaining GME in high need areas
Ahmed, H., Vo, K., Robbins, W.
Journal of Osteopathic Medicine, 2021/11
Free full text

495

Comprehensive Reform and Greater Equity in Applying to Residency-Trainees' Mixed Responses to a Pass/Fail USMLE Step 1
Ganesh Kumar, N., Pontell, M. E., Makhoul, A. T., Drolet, B. C.
Journal of Graduate Medical Education, 2021/10
Free full text


497

Stimulating the Use of OMT in Primary Care Offices Via Point-of-Care Reminders
Agcopra, A., Collins, P., Jha, S., Mancuso, A.
Osteopathic Family Physician, 2021/10

498

Exploring Race and Ethnicity Representational Inequities in Illinois Medical Schools
Francone, N. O., Simon, M. A., Ortega, P.
Health Equity, 2021/09
Free full text

499

The Challenges of Implementing a Joint Interprofessional Education Program Between a Pharmacy College and an Osteopathic Medical College: A Case Study
Huggins, C., Basu, P., Senhaji-Tomza, B., Warwick, S., Anthony, M. E.
International Journal of Osteopathic Medicine, 2021/09

500

Termination of the USMLE Step 2 CS: Perspectives of Surgical Residents with Diverse Medical Backgrounds
Rajesh, A., Desai, T. J., Patnaik, R., Asaad, M.
Journal of Surgical Research, 2021/09

501

Promoting Access of Osteopathic Medical Students to Surgical Residency Training Programs
Petree, B. S., Heard, M. A., Schenarts, P. J., Beaty, J. S.
The American Surgeon, 2021/09

502

Resident opinions of diabetes management in training: a survey
Healy, A. M., Uhrig, J. L., Shubrook, J. H., Aung, N. L., Sadhu, A. R.
Journal of Osteopathic Medicine, 2021/09
Free full text


504


505

Arkansas College of Osteopathic Medicine Simulated Emergency Response Team: A Student Driven Pilot Program
Newman, C. W., Ackerman, R., Brown, T., Ramsey, H., Spector, D., Carson, J., Sanders, K., Daniels, D., Potts, H.
Southern Medical Journal, 2021/08


507

The Single Accreditation System: Risks to the Osteopathic Profession
Cummings, M.
Academic Medicine, 2021/08
Free full text


509

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V. K., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/08
Free full text



512

U.S. medical school admissions and enrollment practices: status of LGBTQ inclusivity
Gamble, R. M., Pregnall, A. M., Deng, A., Ehrenfeld, J. M., Talley, J.
Journal of Osteopathic Medicine, 2021/07
Free full text

513

Efficacy of implementing intermittent STOP THE BLEED® reviews on long term retention of hemorrhage control skills of first year medical students
Sainbayar, E., Holt, N., Jacobson, A., Bhatia, S., Weaver, C.
Journal of Osteopathic Medicine, 2021/06
Free full text

514

Diversity and Inclusion on General Surgery, Integrated Thoracic Surgery, and Integrated Vascular Surgery Residency Program Websites
Mortman, R., Frazier, H. A., Haywood, Y. C.
Journal of Graduate Medical Education, 2021/06
Free full text

515

Effect of a required online graded curriculum in the clerkship years on medical student national standardized examination performance
Glaser, K., Pazdernik, V., Sackett, D., Sheridan, V.
Journal of Osteopathic Medicine, 2021/06
Free full text


517

The Experiences of Women as Latinx Osteopathic Medical Students
Weiss, D. L.
Unpublished Dissertation, 2021/06

518

The Osteopathic Approach During the 1918 Influenza Pandemic, Featuring Newly Analyzed Case Reports
Ching, L. M., Watson, A., Watson, T., Ridgway, P.
The AAO Journal, 2021/06
Free full text

519

Scholar 12: Beta Trial of an Osteopathic Research Cultural Development Computer Application
Rowane, M.J., Hellmann, D. E., Branning, R. A., Cola, H. M., Fahoum, J. M., Snyder, B. M., Healy, A. M., Qi-Lytle, X., Rowane, M. P., Terrell, M. A., Hostoffer, R. W.
The AAO Journal, 2021/06
Free full text

520

Current state of nutrition and nutritional supplement training in medical schools
Lowther, D. P.
Unpublished PhD thesis, 2021/05
Free full text

521

Demystifying Documentation and Billing for Osteopathic Manipulative Treatment
James, S., Johannes, J., Novak, C.
Family Practice Management, 2021/05

522

The Rule of Three
Abend, D.
Osteopathic Family Physician, 2021/05
Free full text

523

Examining concurrent validity between COMLEX-USA Level 2-Cognitive Evaluation and COMLEX-USA Level 2-Performance Evaluation
Craig, B., Wang, X., Sandella, J., Tsai, T. H., Kuo, D., Finch, C.
Journal of Osteopathic Medicine, 2021/05
Free full text

524

Osteopathic Medicine: What Radiologists Need to Know
Gunderman, L. D., Gunderman, R. B.
Academic Radiology, 2021/05


526

Cost comparison of osteopathic manipulative treatment for patients with chronic low back pain
Cooley, D., Bailey, J., Jermyn, R.
Journal of Osteopathic Medicine, 2021/04
Free full text

527

Perceptions of nonopioid treatment for pain in a homeless population
Fraser, K. A., Nguyen, H., Kim, S., Park, F., Bernal, J., Westberg, A. D., Podawiltz, A.
Journal of Osteopathic Medicine, 2021/04
Free full text

528

Meaningful use of COMSAE Phase 1 in preparation for COMLEX-USA Level 1
Wang, X., Maeda, H., Craig, B., Tsai, T. H., Sandella, J. M., Fleury, M.
Journal of Osteopathic Medicine, 2021/04
Free full text

529

Using contact-based education to destigmatize opioid use disorder among medical students
Mort, S. C., Díaz, S. R., Beverly, E. A.
Teaching and Learning in Medicine, 2021/04

530

The ACGME Single Accreditation System: Alterations in the Force of Graduate Medical Education
Nasca, T. J., Miller, R., Brigham, T. P.
Academic Medicine, 2021/04

531

Mentors’ experiences in an osteopathic medical student research program
Hamby, T., Bowman, W. P., Wilson, D. P., Basha, R.
Journal of Osteopathic Medicine, 2021/04
Free full text

532

Joining forces to administer COVID-19 vaccines
Johnson, K. H.
Journal of Osteopathic Medicine, 2021/03
Free full text

533

Predictors of research self efficacy in first-year osteopathic medical students
Jacobs, R. J., Kane, M. N.
International Journal of Osteopathic Medicine, 2021/03


535

Radiation oncology education and experience in the undergraduate medical setting
Odiase, O. M., Huang, D., Sura, K. T.
Medical Education Online, 2021/03
Free full text

536

Poor match rates of osteopathic applicants into ACGME dermatology and other competitive specialties
Craig, E., Brotzman, E., Farthing, B., Giesey, R., Lloyd, J.
Journal of Osteopathic Medicine, 2021/03
Free full text

537

Osteopathic students and graduates matching into pathology residency, 2011–2020
Jajosky, R. P., Coulson, H. C., Rosengrant, A. J., Jajosky, A. N., Jajosky, P. G.
Journal of Osteopathic Medicine, 2021/02
Free full text

538

Osteopathic manipulative treatment and the Spanish flu: a historical literature review
Baroni, F., Mancini, D., Tuscano, S. C., Scarlata, S., Lunghi, C., Cerritelli, F., Haxton, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

539

The flipped classroom: a novel approach to physical examination skills for osteopathic medical students
Bhai, S. A., Poustinchian, B.
Journal of Osteopathic Medicine, 2021/02
Free full text

540

Evaluating disease outbreaks with syndromic surveillance using medical student clinical rotation patient encounter logs
Bruzda, G., Rawlins, F., Sumpter, C., Garner, H. R.
Journal of Osteopathic Medicine, 2021/02
Free full text

541

Diversity in osteopathic medical school admissions and the COMPASS program
Dady, N., Mungroo, K. A., Young, T., Akinsanya, J., Forstein, D.
Journal of Osteopathic Medicine, 2021/02
Free full text

542

Osteopathic manipulative treatment for allopathic physicians: piloting a longitudinal curriculum
Dubey, J., James, S., Zakletskaia, L.
Journal of Osteopathic Medicine, 2021/02
Free full text

543

Predictors of emotional wellbeing in osteopathic medical students in a COVID-19 world
Jacobs, R., Lanspa, M., Kane, M., Caballero, J.
Journal of Osteopathic Medicine, 2021/02
Free full text

544

Characteristics and treatment of geriatric patients in an osteopathic neuromusculoskeletal medicine clinic
King, A. A., Cox, J., Bhatia, S., Snider, K. T.
Journal of Osteopathic Medicine, 2021/02
Free full text

545

Pediatric Osteopathic Manipulative Medicine: A Scoping Review
DeMarsh, S., Huntzinger, A., Gehred, A., Stanek, J. R., Kemper, K. J., Belsky, J. A.
Pediatrics, 2021/02

546

Should Osteopathic Medical Students Take the USMLE?
Lenchus, J.
Academic Medicine, 2021/02
Free full text

547

Education, Perceptions, and Delivery: Factors Shaping the Perceived Role in the Pre-Exposure Prophylaxis (PrEP) Care Continuum Among a Sample of Osteopathic Medical Students
O'Neil, A. M., Meyers, H. J., DeBoy, K. R., Stowe, M., Hamrick, J., Giano, Z., Hubach, R. D.
AIDS Education and Prevention, 2021/02

548

Associations between stress, anxiety, depression, and emotional intelligence among osteopathic medical students
Doyle, N. A., Davis, R. E., Quadri, S. S. A., Mann, J. R., Sharma, M., Wardrop, R. M., Nahar, V. K.
Journal of Osteopathic Medicine, 2021/02
Free full text

549

Impact of an osteopathic presence in a large categorical pediatric residency training program
Barnhardt, E. W., Comer, F., Zmuda, E., Rakowsky, A.
Journal of Osteopathic Medicine, 2021/01
Free full text

550

Transforming a clerkship with telemedicine
Bhatia, R. K., Cooley, D., Collins, P. B., Caudle, J., Coren, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

551

Characterizing the use of osteopathic manipulative medicine in the obstetric population by trimester and indications for use
Faloon, J., Bishop, K., Craig, W., Brock, J.
Journal of Osteopathic Medicine, 2021/01
Free full text

552

Osteopathic manipulative treatment (OMT) use among osteopathic physicians in the United States
Healy, C. J., Brockway, M. D., Wilde, B. B.
Journal of Osteopathic Medicine, 2021/01
Free full text

553

Journal of Osteopathic Medicine: a refreshed and refocused publication for our profession
Zafonte, R. D.
Journal of Osteopathic Medicine, 2021/01
Free full text


555

Perceptions of the Osteopathic Profession in New York City's Korean Communities
Justin Chin, D. O., Haeinn Woo, Oms-Iv, Diane Choi, O. M. S., III, Emily Dube, M. S., Mikhail Volokitin, Md Do, Christine Lomiguen
Osteopathic Family Physician, 2021/01
Free full text

556

Undergraduate Knowledge of Osteopathic Medicine: What Premedical Students Know About Osteopathic Medicine and Its Effect on Burnout
Collins, P. B., Collins, L., Darrow, G. B., Sepede, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text

557

Comparison of State Medical Licensing Board Disclosures Regarding Resident Performance for United States Allopathic, Osteopathic, and Foreign Medical Graduates
Gajewski, M., Hillen, M., Matassa, D., Kunac, A., Anana, M., Pompeo, L., Kothari, N., Murano, T.
The Journal of the American Osteopathic Association, 2020/12
Free full text

558

Readmission Risk Factors and Heart Failure With Preserved Ejection Fraction
Harmon, D., Rathousky, J., Choudhry, F., Grover, H., Patel, I., Jacobson, T., Boura, J., Crawford, J., Arnautovic, J.
The Journal of the American Osteopathic Association, 2020/12
Free full text


560

Motivating High School Students From Rural Areas to Attend College and Pursue Careers as Osteopathic Physicians
Kadavakollu, S., Shindi, R. S., Nummerdor, H. R., Singh, V. K., Pillai, S. B., Ontiveros, S. J., Boyanovsky, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

561

Training Osteopathic Medical Students for Drastic 2021 Health Record Documentation Policy Changes
Bains, R., Gill, A., Singh, J., Antos, A., Lim, S., Molga, H., Malik, A., St. Pierre, S., Davis, G., Warner, M.
The Journal of the American Osteopathic Association, 2020/12

562

Hand Model Utility for Osteopathic Pelvic Diagnosis in a Remote Learning Setting
Burg, B. J., Ketigian, L. A., Yao, S. C.
The Journal of the American Osteopathic Association, 2020/12

563

Effects of the COVID-19 Pandemic on Osteopathic Medical Students’ Screen Time
Edimo, C. O., Espares, J. K., Falus, N. A., Bupathi, S. K., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

564

Prevalence of Computer Vision Syndrome (CVS) Symptoms on Osteopathic Medical Students
Espares, J. K., Edimo, C. O., Bupathi, S. K., Falus, N. A., Jung, M.K., Heller, M.
The Journal of the American Osteopathic Association, 2020/12

565

Burn-out in Osteopathic Medical Students: The Effects of Meditation Before and After the Arrival of the COVID-19 Pandemic
Krishnamachari, B., Morris, A., Chinsky, R., Pendyala, R., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2020/12

566

Levels of Resilience & Coping of Osteopathic Medical Students during COVID-19: Implications for Mental Health Innovations for Physicians in Training
Lanspa, M. E., Jacobs, R. J., Patel, K. C.
The Journal of the American Osteopathic Association, 2020/12

567

Toward Resilience: Medical Students' Perception of Social Support
Casapulla, S., Rodriguez, J., Nandyal, S., Chavan, B.
The Journal of the American Osteopathic Association, 2020/12
Free full text

568

DERMS DO 5: A Proposed Curriculum for Dermatologic Training in 5 Osteopathic Competencies
Giesey, R., Kamel, J., Delost, G., Lloyd, J.
The Journal of the American Osteopathic Association, 2020/11
Free full text

569

The Battle Between Politics and Science Is Costing Us a Timely Victory Over the COVID-19 Pandemic
Hahn, M. B.
The Journal of the American Osteopathic Association, 2020/11
Free full text

570

Status of Entrustable Professional Activities (EPA) Implementation at Colleges of Osteopathic Medicine in the United States and Future Considerations
Linsenmeyer, M., Wimsatt, L., Speicher, M., Basehore, P., Sexton, P. S.
The Journal of the American Osteopathic Association, 2020/11

571


572

Communication Skills of Grandview/Southview Medical Center General Surgery Residents
Johnson, W., Ngo, A., Elrod, M.
The Journal of the American Osteopathic Association, 2020/10
Free full text

573

Osteopathic Medical Licensing Compliance With the Americans With Disabilities Act of 1990
Lincoln, K. A., Wagner, B. E.
The Journal of the American Osteopathic Association, 2020/10
Free full text

574

Report on 7 Years' Experience Implementing an Undergraduate Medical Curriculum for Osteopathic Medical Students Using Entrustable Professional Activities
Reynolds, T. S., Frothingham, C., Carreiro, J. E., Branda, A., Schuenke, M. D., Tucker, K. L., Daly, F., Willard, F. H.
The Journal of the American Osteopathic Association, 2020/08
Free full text

575

Life vs Loans: Does Debt Affect Career Satisfaction in Osteopathic Graduates?
Richards, J., Scheckel, C. J., Anderson, A., Newman, J. R., Poole, K. G.
The Journal of the American Osteopathic Association, 2020/08
Free full text


577

Osteopathic Considerations for the Pregnant Patient with COVID-19
Gray, K. M., Murphy, L., Buckner, B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

578

48-Hour Hospice Home Immersion Encourages Osteopathic Medical Students to Broaden Their Views on Dying and Death
Gugliucci, M. R., Padmanabhan, D. L., Silberstein, E. B.
The Journal of the American Osteopathic Association, 2020/08
Free full text

579

Making the Connection: Using Concept Mapping to Bring the Basic Sciences to the Diagnosis
Spicer, D. B., Thompson, K. H., Kilgallen, S. M.
The Journal of the American Osteopathic Association, 2020/08
Free full text

580

Learning Together: Interprofessional Education at the University of New England
Mokler, D. J., Konrad, S. C., Hall, K., Rodriguez, K., St Pierre, S., Thieme, V. S., Van Deusen, J.
The Journal of the American Osteopathic Association, 2020/08
Free full text

581

Forty Years of University of New England's Research and Scholarship and its Impact in Maine, New England, and Beyond
Carreiro, J. E.
The Journal of the American Osteopathic Association, 2020/08
Free full text

582

Effect of Opioid Prescribing Education for Obstetrics and Gynecology Residents in a Safety-Net Hospital
Evans, C., McCullough, D., Best, K., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/07
Free full text

583

Osteopathic Physician Mortality in the Influenza Pandemic of 1918-1920
Watson, A., Watson, T., Ching, L.
The Journal of the American Osteopathic Association, 2020/07
Free full text

584

Evaluating Financial Conflicts of Interest Among Contributors to Clinical Practice Guidelines of the American College of Obstetricians and Gynecologists
Wright, M. R., Frye, L., Vo Solis, L., Checketts, J. X., Guevara, C., Smith, L., Vassar, M.
The Journal of the American Osteopathic Association, 2020/07
Free full text

585

Services and staffing practices in academic health sciences libraries serving college of osteopathic medicine programs: a mixed methods study
Muellenbach, J. M., Duncan, W. C., Vanier, C., Ennis, L. A., Yang, A.
Journal of the Medical Library Association, 2020/07
Free full text

586

How Trainees Finance Their Medical Education: Implications of Higher Education Act Reform
Scheckel, C. J., Richards, J. R., Newman, J. R., Fangman, B. D., Poole, K. G.
The Journal of the American Osteopathic Association, 2020/06
Free full text

587

Empathy in Medicine Self and Other in Medical Education: Initial Emotional Intelligence Trend Analysis Widens the Lens Around Empathy and Burnout
Singer-Chang, G., Dong, F., Seffinger, M., Nevins, N., Blumer, J., Musharbash, H., Helf, S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

588

Choosing Primary Care: Factors Influencing Graduating Osteopathic Medical Students
Stefani, K. M., Richards, J. R., Newman, J., Poole, K. G., Scott, S. C., Scheckel, C. J.
The Journal of the American Osteopathic Association, 2020/06
Free full text

589

Does Empathy Decline in the Clinical Phase of Medical Education? A Nationwide, Multi-Institutional, Cross-Sectional Study of Students at DO-Granting Medical Schools
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
Academic Medicine, 2020/06
Free full text

590

Practice Locations of Michigan Ophthalmologists as a Model to Compare Practice Patterns of DO and MD Surgical Subspecialists
Ahmed, H., Price, M. J., Robbins, W., Braich, P. S.
The Journal of the American Osteopathic Association, 2020/06
Free full text

591

Influence of Research on Osteopathic Medical Student Residency Match Success
Lowery, J. W., Hum, J. M., Obeime, I., Zahl, S., Parr, C. P., Larsen, B., King, T., Kisby, G.
The Journal of the American Osteopathic Association, 2020/06
Free full text

592

Partnering With Patients to Reduce Firearm-Related Death and Injury
Ozuna, L., Champion, C., Yorkgitis, B. K.
The Journal of the American Osteopathic Association, 2020/06
Free full text

593

Double Jeopardy: The USMLE for Osteopathic Medical Students
Ahmed, H., Carmody, J. B.
Academic Medicine, 2020/05
Free full text

594

Does the Halo Effect for Level 1 Trauma Centers Apply to High-Acuity Nonsurgical Admissions?
Hwalek, A. E., Kothari, A. N., Wood, E. H., Blanco, B. A., Brown, M., Plackett, T. P., Kuo, P. C., Posluszny, J.
The Journal of the American Osteopathic Association, 2020/05
Free full text



597

Transitions in Undergraduate Medical Education
Baker, J., Wright, A.
The Journal of the American Osteopathic Association, 2020/05

598

Perceptions of the nurse practitioner in the hosptial setting
Cunningham, M. R.
Unpublished Dissertation, 2020/04
Free full text

599

Developing Neuraxial and Regional Pain Procedural Skills Through Innovative 3-Dimensional Printing Technology
Headman, Z. C., Matson, M. C., Schneider, R. P., Potter, J. L., Loguda-Summers, D. L., Bhatia, S., Kondrashova, T.
The Journal of the American Osteopathic Association, 2020/04
Free full text

600

Relationship of Clinical Skills Performance in Medical School With COMLEX-USA Level 2-Performance Evaluation
Wang, S., Basehore, P.
The Journal of the American Osteopathic Association, 2020/04
Free full text

601

Assessment of the Research Interests and Perceptions of First-Year Medical Students at 4 Colleges of Osteopathic Medicine
Nguyen, V., Kaneshiro, K., Nallamala, H., Kirby, C., Cho, T., Messer, K., Zahl, S., Hum, J., Modrzakowski, M., Atchley, D., Ziegler, D., Pipitone, O., Lowery, J. W., Kisby, G.
The Journal of the American Osteopathic Association, 2020/04
Free full text

602



604

Success Predictors For Third-Year Osteopathic Medical Students on National Standardized Examinations: A Family Medicine Clerkship Course Study
Glaser, K., Sackett, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2020/03
Free full text

605

CATALYST: Piloting a Longitudinal Assessment and Learning Program for Board Recertification and Continuous Professional Development
Horber, D. T., Flamini, J., Gimpel, J. R., Tsai, T. E., Shrum, K., Hudson, K.
The Journal of the American Osteopathic Association, 2020/03
Free full text

606

Characteristics and Treatment of Pediatric Patients in an Osteopathic Manipulative Medicine Clinic
Kaiser, G., Degenhardt, B. F., Michael Menke, J., Snider, K. T.
The Journal of the American Osteopathic Association, 2020/03
Free full text

607

Shift Workers at Risk for Metabolic Syndrome
Kulkarni, K., Schow, M., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2020/02
Free full text

608

Value of the Continuing Certification Modules and Challenging the Status Quo
Capoocia, A.
The Journal of the American Osteopathic Association, 2020/02
Free full text


610

Perceptions of the osteopathic profession in New York City’s Chinese Communities
Chin, J., Li, S., Yim, G., Zhou, Y. Q., Wan, P., Dube, E., Volokitin, M., Sahni, S., Terrell, M., Lomiguen, C.
Family Medicine and Community Health, 2020/01
Free full text

611

U.S. Physician Recommendations to Their Patients About the Use of Complementary Health Approaches
Stussman, B. J., Nahin, R. R., Barnes, P. M., Ward, B. W.
The Journal of Alternative and Complementary Medicine, 2020/01
Free full text

612

2019 United States Osteopathic Medical Regulatory Summit: Consensus, Recommendations, and Next Steps in Defining Osteopathic Distinctiveness
Gimpel, J. R., Belanger, S. I., Knebl, J. A., LaBaere, R. J., Shaffer, D. C., Shannon, S. C., Shears, T., Steingard, S. A., Turner, M. D., Williams, D. G.
The Journal of the American Osteopathic Association, 2020/01
Free full text

613

Burnout, Perceived Stress, Sleep Quality, and Smartphone Use: A Survey of Osteopathic Medical Students
Brubaker, J. R., Beverly, E. A.
The Journal of the American Osteopathic Association, 2020/01
Free full text

614

Who Uses Osteopathic Manipulative Treatment? A Prospective, Observational Study Conducted by DO-Touch.NET
Johnson, J. C., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2019/12
Free full text

615

Impact of Predoctoral Teaching Fellows on Osteopathic Medical Students: A Near-Peer Teaching Program Evaluation
Akers, B., Davis, G., Keys, J., Pierce-Talsma, S. L., Lund, G.
The AAO Journal, 2019/12
Free full text

616

Influence of Future Prescribers’ Personal and Clinical Experiences With Opioids on Plans to Treat Patients With Opioid Use Disorder
Mort, S. C., Díaz, S. R., Miller, C., Bowlby, M., Henderson, D., Beverly, E. A.
The Journal of the American Osteopathic Association, 2019/12
Free full text

617

OMT as Wellness in the Family Medicine Residency
Conaway, E., O'Donnell, A., Pena, M., Pepe, J., Du, Y.
The Journal of the American Osteopathic Association, 2019/12

618

Perceptions and Awareness of Osteopathic Medicine Among Students in Other Health Professions
Dyches, R. P., Ruck, L. D., Stein, A. B., Gailius, G. C., Worden, K.
The Journal of the American Osteopathic Association, 2019/12

619

Patient Perceptions of Osteopathic Treatment Distinction
Hartwig, W., Davis, G. E., McTighe, A. J., Riemer, R. B.
The Journal of the American Osteopathic Association, 2019/12

620

Meditation and Empathy in Osteopathic Medical Students: A Longitudinal Randomized Controlled Trial
Krishnamachari, B., Ramya, P., Shermon, S., Blazey, W., Balentine, J.
The Journal of the American Osteopathic Association, 2019/12

621

Osteopathic Medical Students: Promoting Physical Activity
Law, A., Hollar, L., Sklar, E., Sprague, P.
The Journal of the American Osteopathic Association, 2019/12

622


623

Review of Opioid Prescribing in the Osteopathic and Ambulatory Setting
Hussein, A. I., Bekampis, C. F., Jermyn, R. T.
The Journal of the American Osteopathic Association, 2019/12
Free full text

624

Integrating the Principles and Practice of Scholarly Activity Into Undergraduate Medical Education: A Narrative Review and Proposed Model for Implementation
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M.
The Journal of the American Osteopathic Association, 2019/09
Free full text

625

Evaluating the Influence of Research on Match Success for Osteopathic and Allopathic Applicants to Residency Programs
Matthews, C. N., Estrada, D. C., George-Weinstein, M., Claeson, K. M., Roberts, M. B.
The Journal of the American Osteopathic Association, 2019/09
Free full text

626

Student Perceived Value of Reading Assignments During Mandatory Clerkship-Years OMM Course
Lewis, D. D., Pickos, J. J.
The AAO Journal, 2019/09
Free full text

627

Patient Education of Osteopathic Manipulative Medicine as a Gateway to Treatment: A Pilot Study
Majetich, S. A., Majetich, M. W., Clegg, J. M., Ratay, S. M.
The AAO Journal, 2019/09
Free full text

628

The Development of a Pediatric Osteopathic Recognition Track
Rakowsky, A., Backes, C., Mahan, J. D., Wolf, K., Zmuda, E.
Academic Pediatrics, 2019/09

629

Using the Multitheory Model to Predict Initiation and Sustenance of Physical Activity Behavior Among Osteopathic Medical Students
Nahar, V. K., Wilkerson, A. H., Stephens, P. M., Kim, R. W., Sharma, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

630

Interprofessional Education: Collaboration and Learning in Action
Felgoise, S. H., Branch, J., Poole, A., Levy, L., Becker, M.
The Journal of the American Osteopathic Association, 2019/08
Free full text

631

Influence of Osteopathic Medical Students’ Personal Health on Attitudes Toward Counseling Obese Pediatric Patients
Whipps, J., Mort, S. C., Beverly, E. A., Guseman, E. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

632

Novel Approach to Introducing an Ultrasonography Curriculum With Limited Instructor Resources
Evans, D. K., Thiessen, M. E. W.
The Journal of the American Osteopathic Association, 2019/08
Free full text

633

Empathy in Medicine National Norms for the Jefferson Scale of Empathy: A Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Hojat, M., Shannon, S. C., DeSantis, J., Speicher, M. R., Bragan, L., Calabrese, L. H.
The Journal of the American Osteopathic Association, 2019/08
Free full text

634

WVSOM Anatomy Lab Tour Program: An Osteopathic Medicine Pipeline With Student Teaching Opportunities
Wines, K. S.
The Journal of the American Osteopathic Association, 2019/07
Free full text

635

Student academic performance factors affecting matching into first-choice residency and competitive specialties
Mitsouras, K., Dong, F., Safaoui, M. N., Helf, S. C.
BMC Medical Education, 2019/07
Free full text

636

Effect of osteopathic visceral manipulation on female pelvic congestion syndrome
Eldeeb, A., Marwan, Y., Alshafie, M., El-Mekawy, H.
Journal of Women's Health, 2019/06

637

Osteopathic Manipulative Medicine Consultations for Hospitalized Patients
Levy, V. J., Holt, C. T., Haskins, A. E.
The Journal of the American Osteopathic Association, 2019/05
Free full text

638

Survey of Osteopathic Medical Students Regarding Physician Shadowing Experiences Before and During Medical School Training
Langenau, E., Frank, S. B., Calardo, S. J., Roberts, M. B.
Journal of Medical Education and Curricular Development, 2019/05
Free full text

639

A National Evaluation of Scholarly Activity Requirement in Osteopathic EM Residency Programs: Survey of EM Program Directors
Kirkpatrick, A., Doran, T., Mullins, D., Gnugnoli, D., Ashurst, J.
Southern Medical Journal, 2019/05

640

Can Osteopathic Medical Students Accurately Measure Abdominal Aortic Dimensions Using Handheld Ultrasonography Devices in the Primary Care Setting?
Hower, K., Young, C. F., Wagner, A., Thorsen, D., Dugan, J.
The Journal of the American Osteopathic Association, 2019/05
Free full text

641

Palliative care use in the rural primary care setting
Johns, H. D.
Unpublished PhD thesis, 2019/04
Free full text

642

Role of Debt and Loan Forgiveness/Repayment Programs in Osteopathic Medical Graduates' Plans to Enter Primary Care
Scheckel, C. J., Richards, J., Newman, J. R., Kunz, M., Fangman, B., Mi, L., Poole, K. G.
The Journal of the American Osteopathic Association, 2019/04
Free full text

643

Comprehensive Medical College Admission Test Preparatory Course as a Strategy to Encourage Premedical Students to Pursue Osteopathic Medicine in Rural Areas
Shipley, T. W., Phu, N., Etters, A. M., Kadavakollu, S.
The Journal of the American Osteopathic Association, 2019/04
Free full text

644

Improving Medical Education by Coupling Basic Science Lectures With ICD-10 Codes
Stanco, K. M., Prater, M. R., Wubah, A., Sumpter, C., Rawlins, F., Garner, H. R.
The Journal of the American Osteopathic Association, 2019/04
Free full text

645

The Osteopathic Applicant
Hansen, E., Pilarski, A., Plasner, S., Cheaito, M. A., Epter, M., Kazzi, A.
The Journal of Emergency Medicine, 2019/04
Free full text

646

Longitudinal Assessment of Medical Student Emotional Intelligence Over Preclinical Training
Mintle, L. S., Greer, C. F., Russo, L. E.
The Journal of the American Osteopathic Association, 2019/04
Free full text

647

Single Accreditation System for Graduate Medical Education: Transition Update
Buser, B. R., Swartwout, J., Lischka, T., Biszewski, M.
The Journal of the American Osteopathic Association, 2019/04
Free full text

648

Assessing Competency in Family Medicine Residents Using the Osteopathic Manipulative Medicine Mini Clinical Evaluation Exercise
LeBeau, L., Morgan, C., Heath, D., Pazdernik, V. K.
The Journal of the American Osteopathic Association, 2019/02
Free full text

649

PROSPER or Not? Potential Medical Education Financing Reforms and Impacts
Richards, J. R., Scheckel, C., Newman, J. R.
The Journal of the American Osteopathic Association, 2019/02
Free full text

650

Nelson-Denny Reading Test Scores as a Predictor of Student Success in Osteopathic Medical Education
Linsenmeyer, M., Ridpath, L.
The Journal of the American Osteopathic Association, 2019/02
Free full text

651

Medical Degree Disparity Among Authors in Obstetrics and Gynecology Journals
Merritt, B., Simunich, T., Ashurst, J.
The Journal of the American Osteopathic Association, 2019/02
Free full text

652

Jeanette “Nettie“ Bolles: The First Female DO
Quinn, T. A.
The Journal of the American Osteopathic Association, 2019/01
Free full text

653

Recommendations from the Council of Emergency Medicine Residency Directors: Osteopathic Applicants
Stobart-Gallagher, M., Smith, L., Giordano, J., Jarou, Z., Lutfy-Clayton, L., Kellogg, A., Hillman, E.
Western Journal of Emergency Medicine, 2019/01
Free full text

654

Exodus From the Classroom: Student Perceptions, Lecture Capture Technology, and the Inception of On-Demand Preclinical Medical Education
Ikonne, U., Campbell, A. M., Whelihan, K. E., Bay, R. C., Lewis, J. H.
The Journal of the American Osteopathic Association, 2018/12


656

Moving Down the Road Less Traveled: The GROUPIE Program at Touro California
Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

657

Public Health and Interprofessional Education as Critical Components in the Evolution of Osteopathic Medical Education
Eduardo Velasco-Mondragon, H., Menini, T., West, C., Clearfield, M.
The Journal of the American Osteopathic Association, 2018/11
Free full text

658

The Other 45: Improving Patients' Chronic Disease Self-Management and Medical Students' Communication Skills
Stoner, A. M., Cannon, M., Shan, L., Plewa, D., Caudell, C., Johnson, L.
The Journal of the American Osteopathic Association, 2018/11
Free full text

659

An Education in Osteopathic Ultrasonography (AEIOU) Program: One Institution's Approach to Advancing an Ultrasonography Curriculum
Hendriksz, T., Markman, Z., Pera, A.
The Journal of the American Osteopathic Association, 2018/11
Free full text



662

The Influence of Medical School Debt on Specialty Choice: An Analysis of Colleges of Osteopathic Medicine
Dyches, R. P., Speicher, M. R.
The Journal of the American Osteopathic Association, 2018/11

663

Medical Student Use of Osteopathic Manipulative Medicine (OMM) in Outpatient and Inpatient Clinical Rotations
Granat, L. M., Docherty, J., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11


665

Patient Perceptions of Osteopathic and Allopathic Physician Communication Style and Empathy and Reported Satisfaction with Low Back Care
Licciardone, J. C., Schmitt, M. E.
The Journal of the American Osteopathic Association, 2018/11

666

Current Trends in COMLEX-USA Level 1 and Level 2-CE Study Resources
McMurray, M., Bires, S.
The Journal of the American Osteopathic Association, 2018/11

667

Integration of Pressure Sensors in Lumbar Palpation Education
Panchmatia, J. H., Docherty, J., Kooyman, P., Abu-Sbaih, R., Yao, S. C.
The Journal of the American Osteopathic Association, 2018/11

668

Where Comfort and Confidence Diverge: Missed Opportunities for Sexual and Gender Minority Competency in Osteopathic Education
Rashid, H., Schenck-Smith, N., Weirich, E., Lenox, A., Sheikh, H., Boesler, D.
The Journal of the American Osteopathic Association, 2018/11

669

Structure and Function in Medical Education: Trend Analysis of Osteopathic Medical Student Emotional Intelligence (EI) Suggests Curricular Modifications May Improve Functional Traits
Singer-Chang, G., Dong, F., Nevins, N., Seffinger, M., Blumer, J., Darmani, N., Helf, S.
The Journal of the American Osteopathic Association, 2018/11

670

An Osteopathic Approach to Leveraging Community Support for Prevention and Management of Chronic Disease in Rural and Appalachian Virginia
Slaymaker, K. A., Meacham, S., Horn, R., Goessl, C., Meisha, D., Mahaney, J.
The Journal of the American Osteopathic Association, 2018/11

671

The Effect of Osteopathic Manipulation on Anxiety and Depression in Medical Students
Torrents, M., Giovanis, A., Indelicato, J., Ahden, S., Giza, J., Wolf, D.
The Journal of the American Osteopathic Association, 2018/11

672

Using the Flipped Classroom With Simulation-Based Medical Education to Engage Millennial Osteopathic Medical Students
Riley, B.
The Journal of the American Osteopathic Association, 2018/10
Free full text

673

Association Between Performance on COMLEX-USA and the American College of Osteopathic Family Physicians In-Service Examination
Hudson, K. M., Feinberg, G., Hempstead, L., Zipp, C., Gimpel, J. R., Wang, Y.
Journal of Graduate Medical Education, 2018/10
Free full text

674

The One Health Initiative as a Basis for Research Development in the Department of Pharmacology at Midwestern University
Prozialeck, W. C., Edwards, J. R.
The Journal of the American Osteopathic Association, 2018/09
Free full text

675

Empathy and Osteopathic Manipulative Medicine: Is It All in the Hands?
Rizkalla, M. N., Henderson, K. K.
The Journal of the American Osteopathic Association, 2018/09
Free full text


677

Association of Mindfulness With Residency Preference and Curriculum Selection in Preclinical Osteopathic Medical Students
Nayyar, N., Saggio, G., Plummer, M., Jung, M. K., Kappenberg, J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

678

History of Research at Midwestern University/Chicago College of Osteopathic Medicine
Nichols, K. J.
The Journal of the American Osteopathic Association, 2018/09
Free full text

679

Osteopathic Distinction, One Student at a Time
Obadia, S.
The Journal of the American Osteopathic Association, 2018/09
Free full text

680

Diabetes Fellowship in Primary Care: A Survey of Graduates
Healy, A. M., Tanenberg, R. J., Schwartz, F. L., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2018/08
Free full text

681

Sleep and Lifestyle Habits of Osteopathic Emergency Medicine Residents During Training
Hughes, K. E., Hughes, P. G., Hughes, M. J.
The Journal of the American Osteopathic Association, 2018/08
Free full text

682

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
listed, , No authors
The Journal of the American Osteopathic Association, 2018/08
Free full text

683

Educating Leaders 2018: Abstracts From AACOM's Annual Conference
No authors listed,
Journal of Osteopathic Medicine, 2018/08
Free full text

684

Teaching Medical Students About Health Systems Science and Osteopathic Principles and Practice Using a Virtual World: The Envision Community Health Center
McCoy, L., Lewis, J. H., Bennett, T., Fernandez, M., Heath, D. M., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2018/08
Free full text

685

Resident Duty Hour Restrictions: The Implications Behind the New Data Ahead of the Single Accreditation System
Berry, A. C., McClain, E. K.
The Journal of the American Osteopathic Association, 2018/08
Free full text

686

Oral Health Training in Osteopathic Medical Schools: Results of a National Survey
Simon, L., Silk, H., Savageau, J., Sullivan, K., Riedy, C.
The Journal of the American Osteopathic Association, 2018/07
Free full text

687

Medical Students' Knowledge, Attitudes, and Behaviors With Regard to Skin Cancer and Sun-Protective Behaviors
Ivanov, N. N., Swan, A., Guseman, E. H., Whipps, J., Jensen, L. L., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/07
Free full text

688

Use of complementary health approaches at military treatment facilities, active component, U.S. Armed Forces, 2010-2015
Williams, V. F., Clark, L. L., McNellis, M. G.
Medical Surveillance Monthly Report, 2018/07

689

Burnout Rates in Oklahoma State University - College of Osteopathic Medicine Alumni
Chaffin, J.
Unpublished MSc thesis, 2018/07
Free full text

690

Practice Area Intentions of Graduates of Colleges of Osteopathic Medicine: What Role Does Debt Play?
Richards, J. R., Scheckel, C. J., Kunz, M., Newman, J. R., Poole, K. G., Mi, L. Y.
The Journal of the American Osteopathic Association, 2018/06
Free full text

691

Teaching Osteopathic Principles and Practices: Easy as ABCs
Nuno, V., Pena, N. J., Hughes, N. F., Cuny, L. A. M., Pierce-Talsma, S. L.
The AAO Journal, 2018/06
Free full text

692

National Institutes of Health and Osteopathic Medicine: Another call for action and equality in a legal struggle won long ago
Peppers, B. P., Blumer, J. U., Hostofer, R. W., Rowane, M. P., Thomas, K. A., Byrnes, T. R.
The AAO Journal, 2018/06
Free full text

693

Osteopathic Manipulation Improves Functional Status in Patients With Non-Specific Chronic Back Pain in a Rural Outpatient Setting
Wilson, D. J., Gorham, L. G., Lamb, T., Daniel, T.
The AAO Journal, 2018/06
Free full text

694

First-Year Osteopathic Medical Students' Knowledge of and Attitudes Toward Physical Activity
Guseman, E. H., Whipps, J., Howe, C. A., Beverly, E. A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

695

Musculoskeletal Education in Medical Schools: A Survey of Allopathic and Osteopathic Medical Students
Sabesan, V. J., Schrotenboer, A., Habeck, J., Lombardo, D., Stine, S., Jildeh, T. R., Meiyappan, A.
Journal of the American Academy of Orthopaedic Surgeons. Global research & reviews, 2018/06
Free full text

696

Reducing Health Disparities: Understanding the Unintended Effects of Health Care Professional and Patient Characteristics on Treatment
Nazione, S., Nazione, A.
The Journal of the American Osteopathic Association, 2018/06
Free full text

697

Insights on the Nationwide Project in Osteopathic Medical Education and Empathy (POMEE)
Newton, B. W.
The Journal of the American Osteopathic Association, 2018/06
Free full text

698

Faculty Vitality in Osteopathic Medical Schools: A Pilot Study
Ables, A. Z., Shan, L., Broyles, I. L.
The Journal of the American Osteopathic Association, 2018/05
Free full text

699

Women in Osteopathic and Allopathic Medical Schools: An Analysis of Applicants, Matriculants, Enrollment, and Chief Academic Officers
Basha, M. E., Bauer, L. J., Modrzakowski, M. C., Baker, H. H.
The Journal of the American Osteopathic Association, 2018/05
Free full text

700

Factors Associated With Osteopathic Primary Care Residency Choice Decisions
Dogbey, G. Y., Collins, K., Russ, R., Brannan, G. D., Mivsek, M., Sewell, S.
The Journal of the American Osteopathic Association, 2018/04
Free full text

701

Appendix 2: American Osteopathic Association Specialty Board Certification
Wieting, J. M., Williams, D. G., Kelly, K. A., Morales-Egizi, L.
The Journal of the American Osteopathic Association, 2018/04
Free full text


703

Resident and Faculty Attitudes Toward Osteopathic-Focused Education
Hempstead, L. K., Rosemergey, B., Foote, S., Swade, K., Williams, K. B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

704

Assessment Considerations for Core Entrustable Professional Activities for Entering Residency
Linsenmeyer, M., Wimsatt, L., Speicher, M., Powers, J., Miller, S., Katsaros, E.
The Journal of the American Osteopathic Association, 2018/04
Free full text

705

Educational Intervention in a Medically Underserved Area
Atance, J., Mickalis, M., Kincade, B.
The Journal of the American Osteopathic Association, 2018/04
Free full text

706

Single Accreditation System Update: A Year of Progress
Buser, B. R., Swartwout, J. E., Biszewski, M., Lischka, T.
The Journal of the American Osteopathic Association, 2018/04
Free full text

707

Interprofessional Collaborative Practice: Use of Simulated Clinical Experiences in Medical Education
Carpenter, A. M., Hirthler, M. A., King, C. J.
The Journal of the American Osteopathic Association, 2018/04
Free full text

708

Increasing Self-Awareness of Medical Students Through the Use of Ultrasonography
Sandefur, K., Kondrashova, T.
The Journal of the American Osteopathic Association, 2018/03
Free full text

709

A Focus on Research at the First School of Osteopathic Medicine
Heard, J. T., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

710

Tool for Predicting Medical Student Burnout From Sustained Stress Levels: Factor Analysis of the Medical Education Hassles Scale-R
Johnson, J. C., Degenhardt, B. F., Smith, C. K., Wolf, T. M., Peterson, D. F.
The Journal of the American Osteopathic Association, 2018/03
Free full text

711

Addressing the Opioid Crisis Through the Teachings of A.T. Still
Blumer, J.
The Journal of the American Osteopathic Association, 2018/03
Free full text

712

Physician-Mentored Patient Rounds to Observe and Assess Entrustable Professional Activities 1 and 2 in Preclinical Medical Students
Chamberlain, N. R., Sexton, P. S., Hardee, M. R., Baer, R. W.
The Journal of the American Osteopathic Association, 2018/03
Free full text

713

Integration of Ultrasonography into the Undergraduate Medical Curriculum: Seven Years of Experience
Kondrashova, T., Kondrashov, P.
Missouri Medicine, 2018/02
Free full text

714

Human Patient Simulation as a Teaching Tool
Schrant, B. L., Archer, L. L., Long, R.
Missouri Medicine, 2018/02
Free full text

715

Maintaining Balance in Medical School through Medical Humanities Electives
Sexton, P.
Missouri Medicine, 2018/02
Free full text

716

Implementation of Oral Case Presentations in an Immunology Course
Stuart, M. K.
Missouri Medicine, 2018/02
Free full text

717

Research at A.T. Still University's Kirksville College of Osteopathic Medicine
Wilson, M. A.
Missouri Medicine, 2018/02
Free full text

718

Association Between Undergraduate Performance Predictors and Academic and Clinical Performance of Osteopathic Medical Students
Agahi, F., Speicher, M. R., Cisek, G.
The Journal of the American Osteopathic Association, 2018/02
Free full text

719

Conceptualizing Addiction From an Osteopathic Perspective: Dopamine Homeostasis
Baron, D., Blum, K., Chen, A., Gold, M., Badgaiyan, R. D.
The Journal of the American Osteopathic Association, 2018/02
Free full text

720

Correlation of Personal Experience and Acquired Knowledge With Intent to Recommend Adjunctive Osteopathic Manipulative Treatment or Yoga for Patients With Chronic Low Back Pain
Seffinger, M. A., Hurwitz, E., Quiamas, J., Kitch, A., Mervyn-Cohen, V., Lin, E.
The Journal of the American Osteopathic Association, 2018/01
Free full text

721

Discovering Osteopathic Antiquity in Historical Osteopathic Pamphlets
Fitterling, L., Oro, R.
The Journal of the American Osteopathic Association, 2018/01
Free full text

722

Gross Anatomy Education Today: The Integration of Traditional and Innovative Methodologies
Houser, J. J., Kondrashov, P.
Missouri Medicine, 2018/01
Free full text


724

Medical Student Decision-Making: Standard Surgical Excision or Mohs Micrographic Surgery to Manage Basal Cell Carcinoma
Mancuso, C., Morris, J. B., Hernandez, N., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2018/01
Free full text

725

Osteopathic Medical Education: Answering the Call
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

726

Gratitude: Reflections and Belonging in the Osteopathic Family
McClain, E. K.
The Journal of the American Osteopathic Association, 2018/01
Free full text

727

Predictors of Osteopathic Medical Students' Readiness to Use Health Information Technology
Jacobs, R. J., Iqbal, H., Rana, A. M., Rana, Z., Kane, M. N.
The Journal of the American Osteopathic Association, 2017/12
Free full text

728

Opinion and Special Articles: Neurology education at US osteopathic medical schools
Freedman, D. A., Albert, D. V. F.
Neurology, 2017/12
Free full text

729

Defining Osteopathic Continuing Medical Education
Loveless, B.
The Journal of the American Osteopathic Association, 2017/12
Free full text

730

Collaboration Between ACGME and AOA Programs to Enhance Success in the Single Accreditation System: A Process Paper
Weidner, A. K. H., Pauwels, J., McGuire, M., Davis, A.
The Journal of the American Osteopathic Association, 2017/11
Free full text

731

Effects of Group Fitness Classes on Stress and Quality of Life of Medical Students
Yorks, D. M., Frothingham, C. A., Schuenke, M. D.
The Journal of the American Osteopathic Association, 2017/11
Free full text


733

Meditation, Empathy, and Stress in Osteopathic Medical Students: An Interventional Pilot Study
Balentine, J., Goldfinger, M., Blazey, W., Jung, M.K., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2017/11

734

Student Application of Osteopathic Manipulative Medicine (OMM) During Third-Year Rotations
Ganatra, L. B., Belisario, C., Terzella, M., Gilliar, W., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/11


736

Empathy in Residency Years
Impens, A. J., Henderson, K., Rizkalla, M. N., Ivlovic, K.
The Journal of the American Osteopathic Association, 2017/11

737

Touro California Student-Run Free Clinic: An Investigation of Actual vs Target Patient Demographic and the Impact of Osteopathic Manipulative Medicine in the Vallejo, California, Community
Jamall, S., Ang, B., Kimpo, J. V., Liu, B., Donn, E., Szeto, H., Devanney, J., Pearce, M.
The Journal of the American Osteopathic Association, 2017/11

738

Creation of a Student-Driven Mental Health Taskforce to Improve Mental Health and Wellness at Lake Erie College of Osteopathic Medicine
Johannessen, M., Mckenney-Groff, S., Kordick, C., Dunbar, M.
The Journal of the American Osteopathic Association, 2017/11

739

Evolving Practice Settings for Osteopathic Graduates: How Debt Influences Anticipated Career Path
Kunz, M., Richards, J., Scheckel, C., Newman, J., Poole, K., Mi, L.
The Journal of the American Osteopathic Association, 2017/11

740

Entrustable Professional Activities for Entering Residency: Establishing Common Osteopathic Performance Standards in the Transition From Medical School to Residency
Basehore, P. M., Mortensen, L. H., Katsaros, E., Linsenmeyer, M., McClain, E. K., Sexton, P. S., Wadsworth, N.
The Journal of the American Osteopathic Association, 2017/11
Free full text


742

Entry of Medical School Graduates Into Family Medicine Residencies: 2016-2017
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

743

Results of the 2017 National Resident Matching Program(R) and the American Osteopathic Association Intern/Resident Registration Program
Kozakowski, S. M., Travis, A., Marcinek, J. P., Bentley, A., Fetter, G. T.
Family Medicine, 2017/10
Free full text

744

Telehealth 2.0 and Osteopathic Medicine
Subbarao, I., Cooper, G. P.
The Journal of the American Osteopathic Association, 2017/10
Free full text

745

Assessment of Nutrition Knowledge and Attitudes in Preclinical Osteopathic Medical Students
Hargrove, E. J., Berryman, D. E., Yoder, J. M., Beverly, E. A.
The Journal of the American Osteopathic Association, 2017/10
Free full text

746

The Case for an Osteopathic Entrustable Professional Activity
Weiss, J., Pearce, M., Pierce-Talsma, S., Davis, G. E.
The Journal of the American Osteopathic Association, 2017/10
Free full text

747

Perceived Importance of Pursuing Osteopathic Recognition in the Single Accreditation System: A Survey of Medical Students, Residents, and Faculty
Hortos, K., Corser, W., Church, B., Rohrer, J., Waarala, K.
The Journal of the American Osteopathic Association, 2017/10
Free full text

748

Scholar 7: The Development of Regional Community Hospitals' Scholastic Environment
Peppers, B. P., Varma, P., Kim, Y. M., Hostoffer, R. W., Jr., Rowane
The Journal of the American Osteopathic Association, 2017/10
Free full text

749

An observational study of ultrasound to confirm cervical spine segmental positional rotation
Flaum, T. B., Rusnack, F. M., Mirza, A., Apoznanski, T. E., Munarova, A., Mazzie, J. P., Terzella, M.l J., Yao, S. C.
International Journal of Osteopathic Medicine, 2017/09/01/

750

Mother Still
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/09
Free full text

751

What Osteopathic Physicians Do
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2017/09
Free full text

752

Pennsylvania Otolaryngologists as a Model for the Implications of Practice Location of Osteopathic vs Allopathic Surgical Subspecialists
Griffith, S., Power, A., Strand, M.
The Journal of the American Osteopathic Association, 2017/09
Free full text

753

Addressing Rural Health Challenges Head On
Nielsen, M., D'Agostino, D., Gregory, P.
Missouri Medicine, 2017/09
Free full text

754

Self-efficacy of Osteopathic Medical Students in a Rural-Urban Underserved Pathway Program
Casapulla, S. L.
The Journal of the American Osteopathic Association, 2017/09
Free full text

755

Clinical Preceptors' Perceptions of Empathy: The Empathy in Osteopathic Training and Education (EMOTE) Study
Davis, G. E., Hartwig, W. C., McTighe, A. J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

756

Ready for Residency: A Bloomian Analysis of Competency-Based Osteopathic Medical Education
Rosenberger, K., Skinner, D., Monk, J.
The Journal of the American Osteopathic Association, 2017/08
Free full text

757

Effects of Clinical Exposure to Osteopathic Manipulative Medicine on Confidence Levels of Medical Students
Shapiro, L. N., Defoe, D., Jung, M. K., Li, T. S., Yao, S. C.
The Journal of the American Osteopathic Association, 2017/08
Free full text

758

In Reply to Buser and to Shannon
Cummings, M.
Academic Medicine, 2017/08
Free full text

759

The 2017 Match and the Future US Workforce
Dalen, J. E., Ryan, K. J., Alpert, J. S.
The American Journal of Medicine, 2017/08
Free full text

760

Integrating Point-of-Care Ultrasonography Into the Osteopathic Medical School Curriculum
Russ, B. A., Evans, D., Morrad, D., Champney, C., Woodworth, A. M., Thaut, L., Thiessen, M.
The Journal of the American Osteopathic Association, 2017/07
Free full text


762

Financing Reform for Long-term Services and Supports
Zwibel, H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

763

Highlights From the American Diabetes Association's 2017 Standards of Medical Care in Diabetes for Osteopathic Physicians
Johnson, E. L., Pfotenhauer, K., Bradley, S., Kalyani, R. R., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2017/07
Free full text

764

Assessment of Research Interests of First-Year Osteopathic Medical Students
Carter, L., McClellan, N., McFaul, D., Massey, B., Guenther, E., Kisby, G.
The Journal of the American Osteopathic Association, 2017/07
Free full text

765

Osteopathic medical students entering family medicine and attitudes regarding osteopathic manipulative treatment: Preliminary findings of differences by sex
Baker, H. H., Linsenmeyer, M., Ridpath, L. C., Bauer, L. J., Foster, R. W.
The Journal of the American Osteopathic Association, 2017/06
Free full text

766

Difference in R01 Grant Funding Among Osteopathic and Allopathic Emergency Physicians over the Last Decade
Antony, M., Savino, J., Ashurst, J.
Western Journal of Emergency Medicine, 2017/06
Free full text

767

Allopathic and Osteopathic Medicine Unify GME Accreditation: A Historic Convergence
Ahmed, A. K. H., Schnatz, P. F., Adashi, E. Y.
Family Medicine, 2017/05
Free full text

768

Preparing Physicians for Rural-Based Primary Care Practice: A Preliminary Evaluation of Rural Training Initiatives at OSU-COM
Wheeler, D. L., Hackler, J. B.
The Journal of the American Osteopathic Association, 2017/05
Free full text

769

Introducing High School Students to Careers in Osteopathic Medicine
Wilson, N. F.
The Journal of the American Osteopathic Association, 2017/05
Free full text

770

A descriptive, cross-sectional study of medical student preferences for vodcast design, format and pedagogical approach
Pettit, R. K., Kinney, M., McCoy, L.
BMC Medical Education, 2017/05
Free full text

771

Response to “Contribution of Osteopathic Training to the Primary Care Workforce“
Kozakowski, S. M., Travis, A., Bentley, A., Fetter, G.
Family Medicine, 2017/04
Free full text

772

Contribution of Osteopathic Training to the Primary Care Workforce
Malouin, R. A., Keenum, A.
Family Medicine, 2017/04
Free full text

773

Evidence-Based Redesign of the COMLEX-USA Series
Gimpel, J. R., Horber, D., Sandella, J. M., Knebl, J. A., Thornburg, J. E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

774

Residency Program Directors' Interview Methods and Satisfaction With Resident Selection Across Multiple Specialties
VanOrder, T., Robbins, W., Zemper, E.
The Journal of the American Osteopathic Association, 2017/04
Free full text

775

Attitudes of Family Medicine Program Directors Toward Osteopathic Residents Under the Single Accreditation System
Hempstead, L. K., Shaffer, T. D., Williams, K. B., Arnold, L. C.
The Journal of the American Osteopathic Association, 2017/04
Free full text

776

Blended Learning Educational Format for Third-Year Pediatrics Clinical Rotation
Langenau, E. E., Lee, R., Fults, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

777

Appendix 1: Osteopathic Graduate Medical Education, 2017
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2017/04
Free full text

778

Can the Humanities Humanize Health Care?
Baltonado, J., Cymet, T.
The Journal of the American Osteopathic Association, 2017/04
Free full text

779

Changes in Osteopathic Medical Education: The Journey Continues
McClain, E. K.
The Journal of the American Osteopathic Association, 2017/04
Free full text

780

Opening the Doors of Medicine to Women
Quinn, T. A.
The Journal of the American Osteopathic Association, 2017/03
Free full text

781

Dermascope Use by Osteopathic Primary Care Physicians
Morris, J. B., Alfonso, S. V., Hernandez, N., Fernández, M. I.
The Journal of the American Osteopathic Association, 2017/03
Free full text

782

A Qualitative, Interview-Based Study of the Health Policy Fellowship's Osteopathic Identity
Skinner, D., Franz, B.
The Journal of the American Osteopathic Association, 2017/03
Free full text

783

Innovation in graduate medical education – using a competency based medical education curriculum
Riley, B. A., Riley, G.
International Journal of Osteopathic Medicine, 2017/03

784

The role of ultrasound and preparation in first-year medical students' learning lumbar spine anatomy and diagnostic skills
Chan, V., Curtis, S., Flaum, T., Terzella, M., Yao, S. C., Cheriyan, G.
International Journal of Osteopathic Medicine, 2017/03

785

History of Osteopathic Medicine: Still Relevant?
Orenstein, R.
The Journal of the American Osteopathic Association, 2017/03
Free full text

786

Osteopathic Medical Student Practice of Osteopathic Manipulative Treatment During School Break
Pierce-Talsma, S., Hiserote, R. M., Lund, G.
The Journal of the American Osteopathic Association, 2017/03
Free full text

787

Comparison of Basic Science Knowledge Between DO and MD Students
Davis, G. E., Gayer, G. G.
The Journal of the American Osteopathic Association, 2017/02
Free full text

788

Correlation Between United States Medical Licensing Examination and Comprehensive Osteopathic Medical Licensing Examination Scores for Applicants to a Dually Approved Emergency Medicine Residency
Kane, K. E., Yenser, D., Weaver, K. R., Barr, G. C. Jr., Goyke, T. E., Quinn, S. M., Worrilow, C. C., Burckhart, A. J., Leonetti, A. L., Yoshioka, I. E., Dusza, S. W., Kane, B. G.
The Journal of Emergency Medicine, 2017/02

789

Osteopathic Philosophy and Manipulation Enhancement Program: Influence on Osteopathic Medical Students' Interest in Osteopathic Manipulative Medicine
Volokitin, M., Ganapathiraju, P. V.
The Journal of the American Osteopathic Association, 2017/01
Free full text

790

Keeping Osteopathic Medicine Osteopathic in a Single Accreditation System for Graduate Medical Education
Levine, M. S.
The Journal of the American Osteopathic Association, 2017/01
Free full text


792

Examining Health Care Students' Attitudes toward E-Professionalism
Gettig, J. P., Noronha, S., Graneto, J., Obucina, L., Christensen, K. J., Fjortoft, N. F.
American Journal of Pharmaceutical Education, 2016/12
Free full text


794

Outcomes-Oriented Medical Training: A Critical Curricular Design Consideration in Developing 21st Century Health Care Professionals
D'Agostino, D., Papa, F. J.
The Journal of the American Osteopathic Association, 2016/11
Free full text

795

Does replacing live demonstration with instructional videos improve student satisfaction and osteopathic manipulative treatment examination performance?
Seals, R., Gustowski, S. M., Kominski, C., Li, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text

796

Programmatic Approach to Increasing Osteopathic Medical Student Participation in Research: The TCOM Experience
Smith-Barbaro, P., AH, O. Yurvati
The Journal of the American Osteopathic Association, 2016/11
Free full text

797

Moving Medical Knowledge, Discovery, and Osteopathic Health Care Forward
Smith-Barbaro, P., Mason, D. C., Filipetto, F.
The Journal of the American Osteopathic Association, 2016/11
Free full text


799

Faculty Development Directed at Curricular Reforms Designed to Improve Patient Outcomes
Papa, F. J., D'Agostino, D.
The Journal of the American Osteopathic Association, 2016/11
Free full text

800

Requirements for Certification in Surgery: A Comparison of the American Board of Surgery and the American Osteopathic Board of Surgery
Termuhlen, P. M., AH, O. Yurvati, Stella, J. J.
The Journal of the American Osteopathic Association, 2016/10
Free full text

801

Using Patient Perspective Sessions to Increase Empathy and Recall in Preclinical Medical Students
Hendriksz, T.
The Journal of the American Osteopathic Association, 2016/10
Free full text

802

Effect of Medical Education on Empathy in Osteopathic Medical Students
McTighe, A. J., DiTomasso, R. A., Felgoise, S., Hojat, M.
The Journal of the American Osteopathic Association, 2016/10
Free full text

803

Empathy: A Vital Sign for the Osteopathic Medical Profession
Calabrese, L. H.
The Journal of the American Osteopathic Association, 2016/10
Free full text

804

Redefining Competency Domains for Osteopathic Medical Practice
Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/09
Free full text

805

Lifestyle Medicine: A New Paradigm Embedded in Osteopathic Principles
Drozek, D.
The Journal of the American Osteopathic Association, 2016/08
Free full text

806

Correlation Between Scores on Weekly Quizzes and Performance on the Annual Resident In-Service Examination
Wagner, B. J., Ashurst, J. V., Simunich, T., Cooney, R.
The Journal of the American Osteopathic Association, 2016/08
Free full text


808

Quantitative Description of Medical Student Interest in Neurology and Psychiatry
Ramos, R. L., Cuoco, J. A., Guercio, E., Levitan, T.
The Journal of the American Osteopathic Association, 2016/07
Free full text

809

The Use of COMLEX-USA and USMLE for Residency Applicant Selection
Sandella, J. M., Gimpel, J. R., Smith, L. L., Boulet, J. R.
Journal of Graduate Medical Education, 2016/07
Free full text

810

Marian University and the Research Enterprise at Its College of Osteopathic Medicine
Larsen, B.
The Journal of the American Osteopathic Association, 2016/07
Free full text

811

Osteopathic Manipulative Treatment Technique Scores on the COMLEX-USA Level 2-PE: An Analysis of the Skills Assessed
Smith, L. L., Xu, W., Sandella, J. M., Dowling, D. J.
The Journal of the American Osteopathic Association, 2016/06
Free full text

812

Time, space and form: Necessary for causation in health, disease and intervention?
Evans, D. W., Lucas, N., Kerry, R.
Medicine, Health Care and Philosophy, 2016/06

813

Osteopathic medical students' perception of teaching effectiveness of their primary care clinical preceptors
Ojano Sheehan, O., Brannan, G., Dogbey, G.
International Journal of Osteopathic Medicine, 2016/06

814

Proposed Amendments to the AOA Constitution, Bylaws, and Code of Ethics
listed, No authors
The Journal of the American Osteopathic Association, 2016/05
Free full text


816

Growing Research Among Osteopathic Residents and Medical Students: A Consortium-Based Research Education Continuum Model
Brannan, G. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

817

Premedical Students’ Attitudes Toward Primary Care Medicine
Beverly, E. A., Wietecha, D. A., Nottingham, K., Rush, L. J., Law, T. D.
The Journal of the American Osteopathic Association, 2016/05
Free full text

818

Preparation Strategies of Osteopathic Medical Students for the COMLEX-USA Level 2-PE
Sandella, J. M., Peters, A., Smith, L. L., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

819

Advising Needs of Osteopathic Medical Students Preparing for the Match
Speicher, M. R., Pradhan, S. R.
The Journal of the American Osteopathic Association, 2016/04
Free full text

820

Program Characteristics Influencing Allopathic Students' Residency Selection
Stillman, M. D., Miller, K. H., Ziegler, C. H., Upadhyay, A., Mitchell, C. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

821

Effect of a Mandatory Third-Year Osteopathic Manipulative Treatment Course on Student Attitudes
Heineman, K. L., Lewis, D. D., Finnerty, E. P., Crout, S. V., Canby, C.
The Journal of the American Osteopathic Association, 2016/04
Free full text

822

Appendix 1: Osteopathic Graduate Medical Education, 2016
Martinez, B., Biszewski, M.
The Journal of the American Osteopathic Association, 2016/04
Free full text

823

Osteopathic Medical Education: Innovations in a Changing Environment
McClain, E. K.
The Journal of the American Osteopathic Association, 2016/04
Free full text

824

Perceptions of US and Australian Medical Students and Instructors About Clinical Professional Attire: LAPEL Study
Bramstedt, K. A., Colaco, C. M. G., de Silva, E., Rehfield, P. L., Blumenthal-Barby, J. S.
The Journal of the American Osteopathic Association, 2016/04
Free full text

825

Osteopathic manipulative treatment for older patients: A national survey of osteopathic physicians
Channell, M. K., Wang, Y., McLaughlin, M. H., Ciesielski, J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2016/03
Free full text

826

Establishing a Professionalism Score in an Osteopathic Manipulative Medicine Curriculum
Snider, K. T.
The Journal of the American Osteopathic Association, 2016/02
Free full text

827

Factors Modifying Burnout in Osteopathic Medical Students
Lapinski, J., Yost, M., Sexton, P., LaBaere, R. J.
Academic Psychiatry, 2016/02



830

Evaluating medical student engagement during virtual patient simulations: a sequential, mixed methods study
McCoy, L., Pettit, R. K., Lewis, J. H., Allgood, J. A., Bay, C., Schwartz, F. N.
BMC Medical Education, 2016/01
Free full text

831

Gamification and Multimedia for Medical Education: A Landscape Review
McCoy, L., Lewis, J. H., Dalton, D.
The Journal of the American Osteopathic Association, 2016/01
Free full text

832

Linking Community Hospital Initiatives With Osteopathic Medical Students' Quality Improvement Training: A Pilot Program
Brannan, G. D., Russ, R., Winemiller, T. R., Mast, E.
The Journal of the American Osteopathic Association, 2016/01
Free full text

833

GME Graduate Retention Rates: A Single Institution Study
Frieswyk, T. J.
Unpublished PhD thesis, 2015/12
Free full text



836

A National Study of Primary Care Provided by Osteopathic Physicians
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2015/12
Free full text


838

Implementation of a Resident-Led Osteopathic Manipulative Treatment Clinic in an Allopathic Residency
Busey, B., Newsome, J., Raymond, T., O'Mara, H.
The Journal of the American Osteopathic Association, 2015/12
Free full text

839

Incorporating Osteopathic Curriculum Into a Family Medicine Residency
Hempstead, L. K., Harper, D. M.
Family Medicine, 2015/11

840

Development of Peer Tutoring Services to Support Osteopathic Medical Students’ Academic Success
Swindle, N., Wimsatt, L.
The Journal of the American Osteopathic Association, 2015/11
Free full text


842

Physical activity training in US medical schools: Preparing future physicians to engage in primary prevention
Stoutenberg, M., Stasi, S., Stamatakis, E., Danek, D., Dufour, T., Trilk, J. L., Blair, S. N.
The Physician and Sportsmedicine, 2015/11

843

Learning With Reflection: Practices in an Osteopathic Surgery Clinical Clerkship Through an Online Module
Lewis, K. O., Farber, S., Chen, H., Peska, D. N.
The Journal of the American Osteopathic Association, 2015/11
Free full text

844

Defining Wellness as a Balance
Wilson, M.
Missouri Medicine, 2015/11
Free full text

845

Feasibility of Using Ultrasonography to Establish Relationships Among Sacral Base Position, Sacral Sulcus Depth, Body Mass Index, and Sex
Lockwood, M. D., Kondrashova, T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/11
Free full text


847

Quantification of Motion Palpation
Kasparian, H., Signoret, G., Kasparian, J.
The Journal of the American Osteopathic Association, 2015/10
Free full text

848

Analysis of provider specialties in the treatment of patients with clinically diagnosed back and joint problems
Wilson, F. A., Licciardone, J. C., Kearns, C. M., Akuoko, M.
Journal of Evaluation in Clinical Practice, 2015/10


850

Recommended Knowledge Base for Entering ACGME Residencies With Osteopathic Recognition
Trustees, American Academy of Osteopathy&rsquo, s Board of
The AAO Journal, 2015/09

851

Approaching the Single Accreditation System: Curricular Variation in Allopathic, Osteopathic, and Dually Accredited Family Medicine Residency Programs
Mims, L. D., Wannamaker, L. R., Bressler, L. C.
Journal of Graduate Medical Education, 2015/09
Free full text

852

Effect of Table Trainer-to-Student Ratios on Outcome in Student Assessments of Cervical Muscle Energy Techniques
Snider, K. T., Dowling, D. J., Seffinger, M. A., Channell, M. K., Yao, S. C., Gustowski, S. M., Johnson, J. C., Pryor, M. J.
The Journal of the American Osteopathic Association, 2015/09
Free full text

853

Accuracy of Anterior Superior Iliac Spine Symmetry Assessment by Routine Structural Examination
Lee, A. S., Pyle, C. W., Redding, D.
The Journal of the American Osteopathic Association, 2015/08
Free full text

854

Role Modeling in the First 2 Years of Medical School
Obadia, S. J.
The Journal of the American Osteopathic Association, 2015/08
Free full text

855

The State of Graduate Medical Education Funding and Meeting Our Nation's Health Care Needs
Chung, B. M.
The Journal of the American Osteopathic Association, 2015/08
Free full text


857

The Doctors Hospital and Nationwide Children’s Hospital Dually Accredited Pediatric Residency Program: A Potential Best Model for Pediatric Osteopathic GME Training
Rakowsky, A., Mahan, J., Donthi, R., Backes, C.
The Journal of the American Osteopathic Association, 2015/06
Free full text

858

Osteopathic schools are producing more graduates, but fewer are practicing in primary care
Barnes, K., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

859

Shifting sources of U.S. Primary care physicians
Lin, S. X., Klink, K., Wingrove, P., Petterson, S., Bazemore, A.
American Family Physician, 2015/06
Free full text

860

Oral cancer knowledge, behavior, and attitude among osteopathic medical students
McCready, Z. R., Kanjirath, P., Jham, B. C.
Journal of Cancer Education, 2015/06

861

Proposed Amendments to the AOA Constitution
listed, No authors
The Journal of the American Osteopathic Association, 2015/06
Free full text

862

Canadian DOs: International Expansion of Osteopathic Medical Education North of the Border
Evren, S., Chander, P., Kim, J., Bi, A., Fiddler, D., Wayent, E., Teitelbaum, H. S.
The Journal of the American Osteopathic Association, 2015/05
Free full text

863

Variations in the diagnosis and treatment of somatic dysfunction between 4 osteopathic residency programs
Hon, G. A., Snider, K. T., Johnson, J. C.
The Journal of the American Osteopathic Association, 2015/05
Free full text

864

The extent of familial hypercholesterolemia instruction in US schools and colleges of medicine, pharmacy, and osteopathic medicine
Withycombe, B., Winden, J. C., Hassanyn, R., Duell, P. B., Ito, M. K.
Journal of Clinical Lipidology, 2015/05

865

Student perceptions of gamified audience response system interactions in large group lectures and via lecture capture technology
Pettit, R. K., McCoy, L., Kinney, M., Schwartz, F. N.
BMC Medical Education, 2015/05
Free full text

866

Transitions in osteopathic medical education
Cymet, T. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

867

Challenges of teaching live and distance audiences simultaneously
Davis, S. S., Hurtubise, L.
The Journal of the American Osteopathic Association, 2015/04
Free full text

868

Comparison of COMLEX-USA scores, medical school performance, and preadmission variables between women and men
Dixon, D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

869

Evolution of AOA specialty board certification
Scheinthal, S., Wieting, J. M., Elko, E., Bowling, J., Gonzalez, F., Librizzi, R., Murcek, B., Simms, B.
The Journal of the American Osteopathic Association, 2015/04
Free full text

870

Relationship between residency placement and clerkship site enrollment: a retrospective analysis
Elliott, S. P., Goldstein, L. B., Meinberg, D., Jeger, A. M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

871

The CAST model: enhancing medical student and resident clinical performance through feedback
Sefcik, D., Petsche, E.
The Journal of the American Osteopathic Association, 2015/04
Free full text

872

Single accreditation system: opportunity and duty to promote osteopathic training for all interested residency programs
Hempstead, L. K.
The Journal of the American Osteopathic Association, 2015/04
Free full text

873

New colleges of osteopathic medicine, branch campuses, and additional locations--what is the difference?
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2015/04
Free full text

874

A structural examination of medical education reform
Kirstein, I. J.
The Journal of the American Osteopathic Association, 2015/04
Free full text

875

Innovative approach to teaching osteopathic manipulative medicine: the integration of ultrasonography
Kondrashova, T., Lockwood, M. D.
The Journal of the American Osteopathic Association, 2015/04
Free full text

876

A systematic review of service-learning in medical education: 1998-2012
Stewart, T., Wubbena, Z. C.
Teaching and Learning in Medicine, 2015/04

877

Comprehensive Osteopathic Medical Licensing Examination-USA level 1 and level 2-cognitive evaluation preparation and outcomes
Maholtz, D. E., Erickson, M. J., Cymet, T.
The Journal of the American Osteopathic Association, 2015/04
Free full text

878

Developing technology-enhanced active learning for medical education: challenges, solutions, and future directions
McCoy, L., Pettit, R. K., Lewis, J. H., Bennett, T., Carrasco, N., Brysacz, S., Makin, I. R., Hutman, R., Schwartz, F. N.
The Journal of the American Osteopathic Association, 2015/04
Free full text

879

Osteopathic postdoctoral training institutions' 2014 annual report
Biszewski, M., Ball, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

880

The single graduate medical education accreditation system
Buser, B. R., Swartwout, J., Gross, C., Biszewski, M.
The Journal of the American Osteopathic Association, 2015/04
Free full text

881

Leveraging the principles of osteopathic medicine to improve diabetes outcomes within a new era of health care reform
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

882

Diabetes management within evolving health care delivery models: the osteopathic perspective
Ciervo, C. A., Shubrook, J. H., Grundy, P.
The Journal of the American Osteopathic Association, 2015/04
Free full text

883

In reply to brock and scott
Kauffman, M.
Academic Medicine, 2015/03
Free full text

884

Osteopathic manipulative treatment use in the emergency department: a retrospective medical record review
Ault, B., Levy, D.
The Journal of the American Osteopathic Association, 2015/03
Free full text

885

Osteopathic medical students' understanding of the Patient Protection and Affordable Care Act: a first step toward a policy-informed curriculum
Beverly, E. A., Skinner, D., Bianco, J. A., Ice, G. H.
The Journal of the American Osteopathic Association, 2015/03
Free full text

886

Research in the osteopathic medical profession: roadmap to recovery-conundrums in osteopathic research require consensus and collaboration
Walkowski, S. A., Eland, D. C., Hain, S., Byron, S.
The Journal of the American Osteopathic Association, 2015/02
Free full text

887

Osteopathic manipulative treatment for self-reported fatigue, stress, and depression in first-year osteopathic medical students
Wiegand, S., Bianchi, W., Quinn, T. A., Best, M., Fotopoulos, T.
The Journal of the American Osteopathic Association, 2015/02
Free full text

888

Use of complementary health approaches among children aged 4-17 years in the United States: National Health Interview Survey, 2007-2012
Black, L. I., Clarke, T. C., Barnes, P. M., Stussman, B. J., Nahin, R. L.
National Health Statistics Reports, 2015/02
Free full text

889

Relationship of admissions variables and college of osteopathic medicine variables to performance on COMLEX-USA level 3
Baker, H. H., Shuman, V. L., Ridpath, L. C., Pence, L. L., Fisk, R. M., Jr., Boisvert
The Journal of the American Osteopathic Association, 2015/02
Free full text

890

Pain: Alternative to a Narco-Epidemic
Moreau, M.
Unpublished Dissertation, 2015/01

891

Use of a novel assay to measure pre- to posttraining palpatory skills of first-year osteopathic medical students
Loh, M. S., Gevitz, N., Gilliar, W. G., Iacono, L. M., Jung, M. K., Krishnamachari, B., Amsler, K.
The Journal of the American Osteopathic Association, 2015/01
Free full text



894

Experiential Learning: An Irreplaceable Tool in Osteopathic Student Education
Bikman, T. J., Ford, J., Schmidt, D., Ridpath, L.
The Journal of the American Osteopathic Association, 2014/12


896

Effects of Osteopathic Manipulative Treatment (OMT) in Lowering Perceived Stress in Medical, Dental, and Pharmacy Student Populations
Frye, K. L., Williams, C. J., Johnson, B. N., Quinn, T. A., Fotopoulos, T. J.
The AAO Journal, 2014/11
Free full text

897

Osteopathic emergency medicine programs infrequently publish in high-impact emergency medicine journals
Baskin, S. M., Lin, C., Carlson, J. N.
Western Journal of Emergency Medicine, 2014/11
Free full text

898

A call to include medical humanities in the curriculum of colleges of osteopathic medicine and in applicant selection
Hoff, G., Hirsch, N. J., Means, J. J., Streyffeler, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

899

Acceptance of lesbian, gay, bisexual, and transgender patients, attitudes about their treatment, and related medical knowledge among osteopathic medical students
Lapinski, J., Sexton, P., Baker, L.
The Journal of the American Osteopathic Association, 2014/10
Free full text

900

Relationships between the Comprehensive Osteopathic Medical Achievement Test (COMAT) subject examinations and the COMLEX-USA Level 2-Cognitive Evaluation
Li, F., Kalinowski, K. E., Song, H., Bates, B. P.
The Journal of the American Osteopathic Association, 2014/09
Free full text

901

Battling a diploma mill: the early fight to preserve the osteopathic principles of A.T. Still
Jordan, L.
The Journal of the American Osteopathic Association, 2014/09
Free full text

902

CORR(R) curriculum--osteopathic and allopathic residency education: Why not the same standards?
Dougherty, P. J., Opipari, M. I.
Clinical Orthopaedics and related Research, 2014/09
Free full text

903

Nonmedical Use of Stimulants Among Medical Students
Wasserman, J. A., Fitzgerald, J. E., Sunny, M. A., Cole, M., Suminski, R. R., Dougherty, J. J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

904

Research in the osteopathic medical profession: roadmap to recovery
Clark, B. C., Blazyk, J.
The Journal of the American Osteopathic Association, 2014/08
Free full text

905

Burnout among osteopathic otolaryngology residents: identification during formative training years
Yost, M. G., Johnson, J. C., Johns, M. M., Burchett, K. D.
The Journal of the American Osteopathic Association, 2014/08
Free full text

906

Association between cervical and thoracic somatic dysfunction among second-year osteopathic medical students
Brindise, J. P., Nelson, K. E., Kappler, R. E.
The Journal of the American Osteopathic Association, 2014/07
Free full text

907

Effect of the single accreditation system
Connett, D. A.
The Journal of the American Osteopathic Association, 2014/07
Free full text

908

Perception-based effects of clinical exposure to osteopathic manipulative treatment on first- and second-year osteopathic medical students
Vazzana, K. M., Yao, S. C., Jung, M. K., Terzella, M. J.
The Journal of the American Osteopathic Association, 2014/07
Free full text

909

From “Doctor of Osteopathy“ to “Doctor of Osteopathic Medicine“: a title change in the push for equality
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/06
Free full text

910

Comparison of Patient Records From the Still-Hildreth Sanatorium With Published Reports
Ching, L. M., Shaw, H. H.
The AAO Journal, 2014/06
Free full text

911

Assessing palpation thresholds of osteopathic medical students using static models of the lumbar spine
Snider, E. J., Pamperin, K., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2014/06
Free full text

912

Predictive relationship of osteopathic manual medicine grades and COMLEX-USA Level 1 total scores and osteopathic principles and practice subscores
Lewis, D. D., Johnson, M. T., Finnerty, E. P.
The Journal of the American Osteopathic Association, 2014/06
Free full text



915

The Journal of the American Osteopathic Association: the next generation
Orenstein, R.
The Journal of the American Osteopathic Association, 2014/05
Free full text

916

Osteopathic graduate medical education: new research standards needed
Shulman, H. M., Cooper, K., Devine, W., Trzeciak, M., Burney, U., Chan, W. P., Gomez, A., Humpherys, J., Safavi, H., Yoshida, M.
The Journal of the American Osteopathic Association, 2014/05
Free full text

917

The 'little m.d.' or the 'big D.O.': the path to the California merger
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/05
Free full text

918

To an intern: what if you were the patient?
Bitterman, A.
The Journal of the American Osteopathic Association, 2014/05
Free full text

919

Preliminary outcomes of the Lake Erie College of Osteopathic Medicine's 3-year Primary Care Scholar Pathway in osteopathic predoctoral education
Raymond, R. M., Madden, M. M., Ferretti, S. M., Ferretti, J. M., Ortoski, R. A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

920

Citation and correction of deficiencies in osteopathic graduate medical education programs: opportunities for improvement
Pierson, A.
The Journal of the American Osteopathic Association, 2014/04
Free full text

921

The use of technology and perceptions of its effectiveness in training physicians
Mason, P. B., Turgeon, B. M., Cossman, J. S., Lay, D. M.
Medical Teacher, 2014/04

922

Consistency of interrater scoring of student performances of osteopathic manipulative treatment on COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Dowling, D. J.
The Journal of the American Osteopathic Association, 2014/04
Free full text

923

Reevaluating osteopathic medical education for the 21st century and beyond
Shannon, S. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text

924

Concurrent validity of the Osteopathic General Surgery In-Service Examination
Falcone, J. L., Rosen, M. E.
The Journal of the American Osteopathic Association, 2014/04
Free full text

925

Student- and faculty-reported importance of science prerequisites for osteopathic medical school: a survey-based study
Binstock, J., Junsanto-Bahri, T.
The Journal of the American Osteopathic Association, 2014/04
Free full text

926

Unified graduate medical education accreditation: a better plow
Bulger, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

927

Moving from EBM to EBOM: an osteopathic perspective on evidence-based medicine
Danto, J. B.
The Journal of the American Osteopathic Association, 2014/04
Free full text

928

Keyboard data entry use among osteopathic medical students and residents
Helstrom, J. M., Langenau, E. E., Sandella, J. M., Mote, B. L.
The Journal of the American Osteopathic Association, 2014/04
Free full text

929

Relationship between COMLEX-USA scores and performance on the American Osteopathic Board of Emergency Medicine Part I certifying examination
Li, F., Gimpel, J. R., Arenson, E., Song, H., Bates, B. P., Ludwin, F.
The Journal of the American Osteopathic Association, 2014/04
Free full text

930

Colleges of osteopathic medicine: substantive changes--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2014/04
Free full text

931

The “doctor of osteopathy“: expanding the scope of practice
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/03
Free full text

932

Usefulness of Video Learning for Osteopathic Manipulative Medicine Techniques in the Classroom and Clinical Setting
Meghpara, M., Yao, S. C., Flaum, T. B., Caron, E., Terzella, M. J.
The AAO Journal, 2014/03
Free full text

933

Factors important to applicants to osteopathic versus allopathic emergency medicine residency programs
St Amour, B. A.
Western Journal of Emergency Medicine, 2014/03
Free full text

934

Is the osteopathic medical profession prepared for a radiologic or nuclear incident?
Stowers, R. E., Christensen, D. M., Parrillo, S. J., Subbarao, I. A., Seaman, M. P., Glassman, E. S.
The Journal of the American Osteopathic Association, 2014/03
Free full text

935

Evidence of declining empathy in third year osteopathic medical students
Caruso, H. M., Bernstein, B.
International Journal of Osteopathic Medicine, 2014/03

936

Osteopathic education: The link between mission and accreditation
Getz, R., Frait, S.
International Journal of Osteopathic Medicine, 2014/03

937

Assessment and management of back pain
Licciardone, J. C., Gatchel, R., Dagenais, S.
JAMA Internal Medicine, 2014/03

938

The “diplomate in osteopathy“: from “school of bones“ to “school of medicine“
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/02
Free full text

939

Correlation of the emergency medicine resident in-service examination with the American Osteopathic Board of Emergency Medicine Part I
Levy, D., Dvorkin, R., Schwartz, A., Zimmerman, S., Li, F.
Western Journal of Emergency Medicine, 2014/02
Free full text

940

Should osteopathic students applying to allopathic emergency medicine programs take the USMLE Exam?
Weizberg, M., Kass, D., Husain, A., Cohen, J., Hahn, B.
Western Journal of Emergency Medicine, 2014/02
Free full text

941

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text


943

Patterns of misrepresentation of clinical findings on patient notes during the COMLEX-USA Level 2-PE
Sandella, J. M., Smith, L. A., Gallagher, L. A., Langenau, E. E.
The Journal of the American Osteopathic Association, 2014/01
Free full text

944

Differences in patient satisfaction between osteopathic and allopathic physicians
Demosthenes, G. A.
Unpublished MSc thesis, 2014/01
Free full text

945

A degree of difference: the origins of osteopathy and first use of the “DO“ designation
Gevitz, N.
The Journal of the American Osteopathic Association, 2014/01
Free full text


947

Awareness of Hereditary Cancer in Osteopathic Physicians
Cohn, J. E., Soshnick, S., Blazey, W., Koehler, S., Laurent, B., Chan, V., Jung, M.K., Tegay, D., Krishnamachari, B.
The Journal of the American Osteopathic Association, 2014/01


949

Prevention curricula assessment of osteopathic medical schools in the United States
Dombrowski, H. T., Vincent, O. D., Wiley, C. L.
International Journal of Osteopathic Medicine, 2013/12

950

Standardizing the osteopathic practical
Rapacciuolo, J., Channell, M. K., Cooley, D.
International Journal of Osteopathic Medicine, 2013/12


952

Correlates and changes in empathy and attitudes toward interprofessional collaboration in osteopathic medical students
Calabrese, L. H., Bianco, J. A., Mann, D., Massello, D., Hojat, M.
The Journal of the American Osteopathic Association, 2013/12
Free full text

953

Osteopathic graduate medical education: a way forward
Terry, R.
The Journal of the American Osteopathic Association, 2013/12
Free full text

954

Tobacco dependence curricula in US osteopathic medical schools: a follow-up study
Griffith, B. N., Montalto, N. J., Ridpath, L., Sullivan, K.
The Journal of the American Osteopathic Association, 2013/11
Free full text

955

Dementia: an evidence-based review of common presentations and family-based interventions
Buffington, A. L., Lipski, D. M., Westfall, E.
The Journal of the American Osteopathic Association, 2013/10
Free full text

956

A turning point for scholarly osteopathic publications
Rogers, F. J.
The Journal of the American Osteopathic Association, 2013/10
Free full text

957

Retrospective medical record review of an osteopathic manipulative medicine hospital consultation service
Snider, K. T., Snider, E. J., DeGooyer, B. R., Bukowski, A. M., Fleming, R. K., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/10
Free full text

958

2013-2022 strategic plan for research: a role for everyone in promoting research in the osteopathic medical profession
Degenhardt, B. F., Standley, P. R.
The Journal of the American Osteopathic Association, 2013/09
Free full text

959

Frequency of counterstrain tender points in osteopathic medical students
Snider, K. T., Glover, J. C., Rennie, P. R., Ferrill, H. P., Morris, W. F., Johnson, J. C.
The Journal of the American Osteopathic Association, 2013/09
Free full text


961

Relighting the fire in our bellies
Cain, R. A.
The Journal of the American Osteopathic Association, 2013/08
Free full text

962

Effects of Osteopathic Manipulative Treatment on Self-Perceived Stress in First-Year Osteopathic Medical Students
Bianchi, W., Cooper, M., Roberts, C., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

963

Portfolios in Osteopathic Medical Education: A Qualitative Pilot Study
Miner, A., Pierce, L. J., Sidhu, K., Menini, T.
The Journal of the American Osteopathic Association, 2013/08

964

Reducing Medical Student Fatigue With Osteopathic Manipulative Treatment
Wiegand, S., Jordan, L., Van Tiem, M., Quinn, T. A., Fotopoulos, T. J.
The Journal of the American Osteopathic Association, 2013/08

965

Osteopathic Training for MDs
Fredericks, T. R.
The Journal of the American Osteopathic Association, 2013/07
Free full text

966

Osteopathic Continuous Certification: it's here--are you prepared?
Scheinthal, S., Gross, C.
The Journal of the American Osteopathic Association, 2013/06
Free full text

967

He walked with confidence into the wilderness of life: a tribute to Philip E. Greenman, DO (1928-2013)
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2013/05
Free full text


969

Response
Suminski, R. R., Wasserman, J. A., Guillory, V. J., Hendrix, D., May, L. E.
The Journal of the American Osteopathic Association, 2013/04
Free full text

970

Osteopathic postdoctoral training institutions and academic sponsorship
Biszewski, M.
The Journal of the American Osteopathic Association, 2013/04
Free full text

971

Osteopathic graduate medical education 2013
DeRosier, A., Lischka, T. A., Martinez, B.
The Journal of the American Osteopathic Association, 2013/04
Free full text

972

AOA specialty board certification
Gross, C., Bell, E. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

973

Bibliometric measures and National Institutes of Health funding at COMs, 2006-2010
Gugliucci, A.
The Journal of the American Osteopathic Association, 2013/04
Free full text

974

Developing osteopathic competencies in geriatrics for medical students
Noll, D. R., Channell, M. K., Basehore, P. M., Pomerantz, S. C., Ciesielski, J., Eigbe, P. A., Jr., Chopra
The Journal of the American Osteopathic Association, 2013/04
Free full text

975

New colleges of osteopathic medicine: steps in achieving accreditation--an update
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2013/04
Free full text

976

Osteopathic training of MDs
Noone, S. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

977

The Journal of the American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2013/04
Free full text

978



980

Predictors of scoring at least 600 on COMLEX-USA Level 1: successful preparation strategies
Vora, A., Maltezos, N., Alfonzo, L., Hernandez, N., Calix, E., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2013/02
Free full text

981

Response to “Geographic patterns in primary care visits provided by osteopathic physicians“
Fordyce, M. A., Chen, F. M., Doescher, M. P., Hart, L. G.
Family Medicine, 2013/01
Free full text

982

A new look for the Journal of the American Osteopathic Association
Berneath Lang, D., D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2013/01
Free full text

983

2012 student research abstracts and poster competitions
Neufeld, K. S.
The Journal of the American Osteopathic Association, 2013/01
Free full text

984

Survey of Patient Knowledge of Osteopathic Physicians and Osteopathic Manipulative Treatment
Snell, P. D., AbdurRaqeeb, O. A., Smith, T. L., Huckabee, M. M., Keenum, A.
The Journal of the American Osteopathic Association, 2013/01

985

A six year head-to-head comparison of osteopathic and allopathic applicants to a university-based, allopathic general surgery residency
Schlitzkus, L. L., Clark, C. J., Agle, S. C., Schenarts, P. J.
Journal of Surgical Education, 2012/12-11
Free full text

986

International health electives: strengthening graduate medical education
Coupet, S.
The Journal of the American Osteopathic Association, 2012/12
Free full text

987

A single, unified graduate medical education accreditation system
Buser, B. R.
The Journal of the American Osteopathic Association, 2012/12
Free full text


989

Waste land
Zukas, J.
The Journal of the American Osteopathic Association, 2012/12
Free full text

990

OCC: will it never end?
Sylvara, J. T.
The Journal of the American Osteopathic Association, 2012/12
Free full text

991

Bibliometric measures and National Institutes of Health funding at colleges of osteopathic medicine, 2006-2010
Suminski, R. R., Hendrix, D., May, L. E., Wasserman, J. A., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/11
Free full text


993

Research funding at colleges of osteopathic medicine in the United States
Suminski, R. R., May, L. E., Guillory, V. J.
The Journal of the American Osteopathic Association, 2012/10
Free full text

994

Joining forces: military perspectives for osteopathic medical education
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2012/10
Free full text



997

The eccentricities of osteopathy
Moore, W.
The BMJ, 2012/09

998

Need to OPPOSE PROPOSED ACGME Common Program Requirements
Zeichner, S. B.
The Journal of the American Osteopathic Association, 2012/09
Free full text

999

Assessing the effectiveness of OMT provided by predoctoral teaching fellows as measured by a visual analog pain scale
Sarkaria, J. A., Render, R. M., Lerma, C. M., Henley, N., Seffinger, M. A., Hruby, R. J.
The AAO Journal, 2012/09
Free full text

1000

Frequency of specific osteopathic manipulative treatment modalities used by candidates while taking COMLEX-USA Level 2-PE
Langenau, E. E., Dowling, D. J., Dyer, C., Roberts, W. L.
The Journal of the American Osteopathic Association, 2012/08
Free full text


1002

The Phoenix Physician: defining a pathway toward leadership in patient-centered care
Good, R. G., Bulger, J. B., Hasty, R. T., Hubbard, K. P., Schwartz, E. R., Sutton, J. R., Troutman, M. E., Nelinson, D. S.
The Journal of the American Osteopathic Association, 2012/08
Free full text

1003

Assessing Palpation Thresholds Using Static Lumbar Spine Models
Snider, E. J., Pamperin, K. L., Johnson, J. C., Shurtz, N. R., Degenhardt, B. F.
The Journal of the American Osteopathic Association, 2012/08

1004

Burnout Among Osteopathic Otolaryngology Residents: Identification, Prevention, and Treatment During Formative Training Years
Yost, M., Johnson, J. C., Burchett, K.
The Journal of the American Osteopathic Association, 2012/08


1006

We have met the enemy and he is us
Vanderburgh, A. J.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1007

Thinking Osteopathically
St. Amour, B. A.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1008

A new triadic paradigm for osteopathic research in real-world settings
Licciardone, J. C., Kearns, C. M.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1009

Use of and attitudes toward complementary and alternative medicine among osteopathic medical students
Kanadiya, M. K., Klein, G., Shubrook, J. H.
The Journal of the American Osteopathic Association, 2012/07
Free full text

1010

Military medicine content in an osteopathic medical school's curriculum
Berkowitz, M. R.
The Journal of the American Osteopathic Association, 2012/07
Free full text


1012

Osteopathic physicians and international medical graduates in the rural primary care physician workforce
Fordyce, M. A., Doescher, M. P., Chen, F. M., Hart, L. G.
Family Medicine, 2012/06

1013

Quoting A.T. Still With Rigor: An Historical and Academic Review
Stark, J. E.
The Journal of the American Osteopathic Association, 2012/06
Free full text

1014

Empathy in osteopathic medical students: a cross-sectional analysis
Kimmelman, M., Giacobbe, J., Faden, J., Kumar, G., Pinckney, C. C., Steer, R.
The Journal of the American Osteopathic Association, 2012/06
Free full text


1016

Letter About “Thanks, but No Thanks: How Denial of Osteopathic Service in the World Wars Shaped the Profession–1”
Stiger, J.
The Journal of the American Osteopathic Association, 2012/05
Free full text

1017

Trainer-to-Student Ratios for Teaching Psychomotor Skills in Health Care Fields, as Applied to Osteopathic Manipulative Medicine
Snider, K. T., Seffinger, M. A., Ferrill, H. P., Gish, E. E.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1018

The problem with graduate medical education
Shannon, S. C.
The Journal of the American Osteopathic Association, 2012/04
Free full text

1019

Successful implementation of new osteopathic graduate medical education programs in a community hospital: challenges and lessons learned
Hayes III., O. W., Miller, R., Recupero, P. J., Cashwell, D.
The Journal of the American Osteopathic Association, 2012/04
Free full text



1022

Chiropractic or Osteopathic Manipulation for Children in the United States: An Analysis of Data from the 2007 National Health Interview Survey
Ndetan, H., Evans, M. W., Hawk, C., Walker, C.
The Journal of Alternative and Complementary Medicine, 2012/03
Free full text

1023

Graduating osteopathic medical students' perceptions and recommendations on the decision to take the United States Medical Licensing Examination
Hasty, R. T., Snyder, S., Suciu, G. P., Moskow, J. M.
The Journal of the American Osteopathic Association, 2012/02
Free full text

1024

Oral health awareness for osteopathic medical students--a medical and dental collaborative effort
Rosenheck, A. H., Scott, G. J., Dombrowski, H. T., Cohen, H. V., York, J. A., Kleiman, A., Coren, J. S.
The Journal of the American Osteopathic Association, 2012/02
Free full text


1026

Background and methodology of the Osteopathic Survey of Health Care in America 2010 (OSTEOSURV 2010)
Licciardone, J. C., Kearns, C. M., Ruggiere, P.
The Journal of the American Osteopathic Association, 2011/12
Free full text




1030

Time to direct COM candidates away from the MCAT?
Kauffman, M.
The Journal of the American Osteopathic Association, 2011/11
Free full text

1031

Osteopathic medical students' beliefs about osteopathic manipulative treatment at 4 colleges of osteopathic medicine
Draper, B. B., Johnson, J. C., Fossum, C., Chamberlain, N. R.
The Journal of the American Osteopathic Association, 2011/11
Free full text

1032

Osteopathic distinctiveness in osteopathic predoctoral education and its effect on osteopathic graduate medical education
Ching, L. M., Burke, W. J.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1033

Promoting safe and efficacious vaccines for adults
Grogg, S. E.
The Journal of the American Osteopathic Association, 2011/10
Free full text

1034

The battle to join the fight
Barber, J.
Military Medicine, 2011/09
Free full text


1036

Eating our seed corn, again!
Berkowitz, M. R.
The AAO Journal, 2011/09
Free full text

1037


1038

What Drew You to Osteopathic Medicine? A Survey of Osteopathic Medical Students From 10 Schools
Draper, B. B., Johnson, J. C., Chamberlain, N.
The Journal of the American Osteopathic Association, 2011/08

1039

Osteopathic Medical Students' Attitude Toward Complementary and Alternative Medicine
Shubrook, J. H., Kanadiya, M. K.
The Journal of the American Osteopathic Association, 2011/08

1040

Improving Resident Research Projects by Providing a Focused Research Infrastructure and Training on Evidence-Based Practice
Weiss, L. B., Filipetto, F. A., Zipp, C. P., Gupta, A. K., Switala, C. A.
The Journal of the American Osteopathic Association, 2011/08

1041

Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes
Langenau, E. E., Sandella, J. M.
The Journal of the American Osteopathic Association, 2011/07
Free full text

1042

26 steps into the future--a year of Presidential COM visits
Nichols, K. J.
The Journal of the American Osteopathic Association, 2011/07
Free full text

1043

Competency-based classification of COMLEX-USA cognitive examination test items
Langenau, E., Pugliano, G., Roberts, W.
The Journal of the American Osteopathic Association, 2011/06
Free full text

1044

Support for the osteopathic graduate medical education development initiative
Nichols, K. J., Buser, B. R.
The Journal of the American Osteopathic Association, 2011/06
Free full text


1046

Pain management and osteopathic manipulative medicine in the Army: new opportunities for the osteopathic medical profession
Goff, M. B., Nelson, M. A., Deighton, M. M., Fredricks, C. T.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1047

DOs should endorse an evidence-based national healthcare policy
Graham, J. D.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1048

Can laypersons be trained to effectively deliver osteopathic manual therapy to patients with HIV?: a pilot study
Newberry, M. A., Bowen, G. S., Trubey, K., Fernandez, M. I.
The Journal of the American Osteopathic Association, 2011/05
Free full text


1050

One osteopathic physician's path through an ACGME-Accredited Residency
Patchett, D. C.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1051

“Whatever you are, be a good one“: osteopathic identity, equality, and the california merger
Ryan, H. W.
The Journal of the American Osteopathic Association, 2011/05
Free full text

1052

Accrediting osteopathic postdoctoral training institutions
Duffy, T.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1053

AOA Approval of ACGME Internship and Residency Training
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1054

Osteopathic graduate medical education 2011
Freeman, E., Derosier, A., Lischka, T. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1055

Osteopathic approach to implementing and promoting interprofessional education
Mackintosh, S. E., Adams, C. E., Singer-Chang, G., Hruby, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1056

Osteopathic Issues Raised by the September 2010 JAOA
Patriquin, D. A.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1057

Understanding osteopathic medical school applicants and the class of 2014
Ramos, R. L., Zhou, C., Hasan, M., Herrera, S. J., Bono, N. A., Hallas, B. H.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1058

Osteopathic medical education in 2011: adapting to changes in the healthcare system
Shannon, S. C.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1059

Teaching of anterior cruciate ligament function in osteopathic medical education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1060

Incorporating a Mandatory Osteopathic Manipulative Medicine (OMM) curriculum in clinical clerkships: impact on student attitudes toward using OMM
Teng, A. Y., Terry, R. R., Blue, R. J.
The Journal of the American Osteopathic Association, 2011/04
Free full text

1061

An evaluation of osteopathic school programs designed to promote rural location by graduates
Whitacre, B. E., Pace, V., Hackler, J. B., Janey, M., Landgraf, C. E., Pettit, W. J.
International Journal of Osteopathic Medicine, 2011/03

1062

AOA Not Enforcing OMM Educational Standards
McCombs, T. M.
The Journal of the American Osteopathic Association, 2011/03
Free full text

1063

New COMLEX-USA-to-USMLE conversion formula needed
Burmeister, J. D.
The Journal of the American Osteopathic Association, 2011/02
Free full text

1064

Relationship between encounter time and candidate performance on COMLEX-USA Level 2-PE
Sandella, J. M., Roberts, W. L., Langenau, E. E.
The Journal of the American Osteopathic Association, 2011/01
Free full text

1065

Effects of repeated use of the American Osteopathic Association's Clinical Assessment Program on measures of care for patients with diabetes mellitus
Shubrook Jr., J. H., Snow, R. J., McGill, S. L.
The Journal of the American Osteopathic Association, 2011/01
Free full text


1067

“D.O. or die“: identity negotiation among osteopathic medical students
Norander, S., Mazer, J. P., Bates, B. R.
Health Communication, 2011/01
Free full text

1068

On the Role of the Glossary
Berkowitz, M. R.
The AAO Journal, 2010/12
Free full text

1069

`Osteopathic physician' defines our identity
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text


1071

Osteopathic medical terminology--redux
Allen, T. W.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1072

Is something wrong with osteopathic graduate medical education?
Steier, K. J.
The Journal of the American Osteopathic Association, 2010/12
Free full text

1073

Medical business education in colleges of osteopathic medicine
Fredricks, T. R.
The Journal of the American Osteopathic Association, 2010/11
Free full text

1074

American Osteopathic Association guidelines for osteopathic manipulative treatment (OMT) for patients with low back pain
Seffinger, M. A., Buser, B. R., Licciardone, J. C., Lipton, J. A., Lynch, J. K., Patterson, M. M., Snow, R., Troutman, M. E.
The Journal of the American Osteopathic Association, 2010/11
Free full text

1075

How the AOA established the first national guidelines for OMT
Seffinger, M. A.
The Journal of the American Osteopathic Association, 2010/11
Free full text



1078

Attitudes and Confidence Levels of Fourth Year Osteopathic Medical Students towards Osteopathic Manipulative Medicine
Quinn, T., Best, M., Fotopoulos, T. J., Ball, L. D., Ruston, V. J.
The AAO Journal, 2010/09
Free full text

1079

COMLEX Level 2-PE Performance Differences between Left-handed and Right-handed Candidates
Langenau, E. E., Dyer, C.
The Journal of the American Osteopathic Association, 2010/08

1080

Standardized Patients and Osteopathic Manipulative Treatment During COMLEX-USA Level 2-PE
Sandella, J. M., Pugliano, G.
The Journal of the American Osteopathic Association, 2010/08

1081

Changes in US healthcare: our time is now, but for what?
Cain, R. A.
The Journal of the American Osteopathic Association, 2010/05
Free full text


1083

Osteopathic manual therapy versus conventional conservative therapy in the treatment of temporomandibular disorders: a randomized controlled trial
Cuccia, A. M., Caradonna, C., Annunziata, V., Caradonna, D.
Journal of Bodywork and Movement Therapies, 2010/04
Free full text



1086

The Effect of Early Clinical Exposure on Future OMT Use
Dalprat, J., Thompson, C., Hruby, R.
The AAO Journal, 2010/03
Free full text

1087

AOA should support IOM report on resident work hours
Conklin, J. H.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1088

Examining OPTI operations with a new light
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1089

Osteopathic graduate medical education 2010
Freeman, E., Duffy, T., Lischka, T. A.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1090

Addiction medicine: a model osteopathic medical school curriculum
Lande, R. G., Wyatt, S. A., Przekop Jr., P. R.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1091

Osteopathic medical education in 2010: another decade of growth
Shannon, S. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1092

Colleges of osteopathic medicine: the process of continuous evaluation
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2010/03
Free full text

1093

You call the shots
Cymet, T. C.
The Journal of the American Osteopathic Association, 2010/02
Free full text

1094

The relationship between a statewide preceptorship program and family medicine residency selection
Kubal, V. S., Zweifler, J., Hughes, S., Reilly, J. M., Newman, S.
Journal of the American Board of Family Medicine, 2010/01
Free full text

1095

Accreditation standards of DO- and MD-granting medical schools: an incomplete comparison
Hunt, D., Barzansky, B., Sabalis, R.
Academic Medicine, 2010/01
Free full text

1096

Relationship between COMLEX and USMLE scores among osteopathic medical students who take both examinations
Chick, D. A., Friedman, H. P., Young, V. B., Solomon, D.
Teaching and Learning in Medicine, 2010/01

1097


1098

The Efficacy of OMT by Osteopathic Medical Students on Musculoskeletal Pain and Somatic Findings
Hallas, S. J., Seffinger, M., Hurwitz, E.
The Journal of the American Osteopathic Association, 2010/01

1099

Osteopathic Manipulative Treatments in the Emergency Department: Osteopathic Emergency Physicians’ Perspectives
Holbrook, N. B., Fryer, G., Johnson, J. C., Holbrook, C.
The Journal of the American Osteopathic Association, 2010/01

1100

Anterior Cruciate Ligament Function in Osteopathic Medical Education
Surek, C. C., Lorimer, S. D., Dougherty, J. J., Stephens, R. E.
The Journal of the American Osteopathic Association, 2010/01

1101

A Study to Investigate the Efficacy of a Novel Interactive Web-Based Virtual Clinical Scenario System (Virtual People Factory) in Medical Education
Surkunalingam, N., Walker, J., McCaskill, S., Taranto, C., Blanchard, C., Lind, D. S., Rossen, B., Lok, B.
The Journal of the American Osteopathic Association, 2010/01

1102

Perception of osteopathic medicine among allopathic physicians in the deep central southern United States
Brown, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1103

Keeping the osteopathic medical profession parallel and distinctive
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1104

Reject influence of pharmaceutical industry
McPartland, J. M.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1105

Discrimination against DOs alive and well
Hoegerl, C.
The Journal of the American Osteopathic Association, 2009/12
Free full text

1106

Billing and coding for OMT
Doss, Y. L., Snider, K. T.
The Journal of the American Osteopathic Association, 2009/11
Free full text

1107

Clearly distinct: outcomes of initiative to increase integration of osteopathic principles and practice at West Virginia School of Osteopathic Medicine
Steele, K. M., Baker, H. H.
The Journal of the American Osteopathic Association, 2009/11
Free full text

1108

Student performance on levels 1 and 2-CE of COMLEX-USA: do elective upper-level undergraduate science courses matter?
Wong, S. K., Ramirez, J. R., Helf, S. C.
The Journal of the American Osteopathic Association, 2009/11
Free full text

1109

Maintaining distinctiveness and affordability of osteopathic medical education
DeLengocky, T.
The Journal of the American Osteopathic Association, 2009/10
Free full text

1110

Personality types and performance: COMLEX-USA Level 2-CE
Getz, R., Sefcik, D. J.
The Journal of the American Osteopathic Association, 2009/10
Free full text

1111

Biomedical research competencies for osteopathic medical students
Cruser, D. A., Dubin, B., Brown, S. K., Bakken, L. L., Licciardone, J. C., Podawiltz, A. L., Bulik, R. J.
Osteopathic Medicine and Primary Care, 2009/10
Free full text

1112

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1113

Curricular analysis of competency-based osteopathic medical education: application of a matrix for quality enhancement to a standardized patient encounter example
Lockwood, M. D., Tucker-Potter, S., Sargentini, N. J.
The Journal of the American Osteopathic Association, 2009/09
Free full text

1114

Osteopathic medicine and the silver tsunami: preparing tomorrow's first responders for the elder boom
Gugliucci, M. R., Giovanis, A. T.
The Journal of the American Osteopathic Association, 2009/09
Free full text


1116

The Osteopathic Physician and End-of-Life Care
Hernandez, M. B., Ledbetter, S. L., Trevil, R., Perez, A. M., White, C.
The Journal of the American Osteopathic Association, 2009/08

1117

Billing and coding for osteopathic manipulative treatment
Snider, K. T., Jorgensen, D. J.
The Journal of the American Osteopathic Association, 2009/08
Free full text

1118

Osteopathic Physicians and HIV/STI Prevention: Are HIV Testing and Sexual History–Taking Part of Routine Patient Care?
Gongidi, P., Bowen, G. S., Fernandez, I. M.
The Journal of the American Osteopathic Association, 2009/08

1119

Teaching Psychiatry in Osteopathic Medical Schools: A Survey of Current Curriculum and a Suggested Primary Care Approach
Lowe, M., Murphy, M.
The Journal of the American Osteopathic Association, 2009/08

1120

Creation of a Database Template for Performing a Retrospective Chart Review of an OMM Hospital Consultation Service
Snider, K. T., Snider, E. J., Bukowski, A. M., Johnson, J. C., DeGooyer, B. R.
The Journal of the American Osteopathic Association, 2009/08

1121

Retrospective Chart Review of the OMM Hospital Consultation Service at NRMC - Preliminary Results
Snider, K. T., Snider, E. J., DeGooyer, B. R., Johnson, J. C., Bukowski, A. M.
The Journal of the American Osteopathic Association, 2009/08

1122

Spiritual and Religious Characteristics of Osteopathic Medical Students
Workman, G. M., Lee, M. M., Nichols, K. J., Workman, D. E., Christian, V. L., Orlinsky, D. E.
The Journal of the American Osteopathic Association, 2009/08

1123

The DO difference: an analysis of causal relationships affecting the degree-change debate
Bates, B. R., Mazer, J. P., Ledbetter, A. M., Norander, S.
The Journal of the American Osteopathic Association, 2009/07
Free full text

1124

Stop smoking, save money, get free OMM
Byrnes Jr., T. R.
The Journal of the American Osteopathic Association, 2009/07
Free full text

1125

Survey results: OMT and CAM
Ramos, R. L., Sharma, S., Lipoff, D. M.
The Journal of the American Osteopathic Association, 2009/07
Free full text

1126

Measuring awareness, interest, and involvement in the osteopathic community through board certification: a survey of DO residents in ACGME-accredited training programs
Scott, S. C., O'Connor, E. M., Marlow, R. A.
The Journal of the American Osteopathic Association, 2009/06
Free full text

1127

Personality types and performance on aptitude and achievement tests: implications for osteopathic medical education
Sefcik, D. J., Prerost, F. J., Arbet, S. E.
The Journal of the American Osteopathic Association, 2009/06
Free full text

1128

The separate osteopathic medical education pathway: uniquely addressing national needs.
Chen, C., Mullan, F.
Academic Medicine, 2009/06
Free full text

1129

AM Last Page: Osteopathic medicine in the U.S.A
Cummings, M., Rohrer, J.
Academic Medicine, 2009/06
Free full text

1130

The transformation of osteopathic medical education
Gevitz, N.
Academic Medicine, 2009/06
Free full text

1131

Foreword: Osteopathic medicine and medical education in the 21st century
Hahn, M. B.
Academic Medicine, 2009/06
Free full text

1132

What is your threshold for evidence to treat?
Kanter, S. L.
Academic Medicine, 2009/06
Free full text

1133

Osteopathic clinical training in three universities
Krueger, P. M., Dane, P., Slocum, P., Kimmelman, M.
Academic Medicine, 2009/06
Free full text


1135

Osteopathic postdoctoral training institutions: a decentralized model for facilitating accreditation and program quality
Peska, D. N., Opipari, M. I., Watson, D. K.
Academic Medicine, 2009/06
Free full text


1137

The status and future of osteopathic medical education in the United States
Shannon, S. C., Teitelbaum, H. S.
Academic Medicine, 2009/06
Free full text

1138

The National Osteopathic Research Center at the University of North Texas Health Science Center: inception, growth, and future
Stoll, S. T., McCormick, J., Degenhardt, B. F., Hahn, M. B.
Academic Medicine, 2009/06
Free full text

1139

Factors affecting specialty choice among osteopathic medical students
Teitelbaum, H. S., Ehrlich, N., Travis, L.
Academic Medicine, 2009/06
Free full text




1143


1144

Spinal and sacroiliac assessment and treatment techniques used by osteopathic physicians in the United States
Fryer, G., Morse, C. M., Johnson, J. C.
Osteopathic Medicine and Primary Care, 2009/04
Free full text

1145

OPTImizing osteopathic postdoctoral training institutions
Duffy, T., Martinez, B.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1146

Prevention, diagnosis, and management of osteoporosis-related fracture
Fakih, M.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1147

Dual and parallel postdoctoral training programs: implications for the osteopathic medical profession
Burkhart, D. N., Lischka, T. A.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1148

Osteopathic medical education in 2009: sails set for improved healthcare?
Shannon, S. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text

1149

Evolution of colleges of osteopathic medicine: a discussion of the COCA's “substantive change“ policies
Williams, A., Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2009/03
Free full text


1151

An Analysis of the Use of Web-Based Materials by Medical Students and its Relationship to Learning Style
Halbert, C., Fresa-Dillon, K., Kriebel, R., Coughlin, P., Cuzzolino, R.
The Journal of the American Osteopathic Association, 2009/01

1152

Performing Preclerkship Pelvic Examinations Improves Student Perceptions of Clerkship Preparedness
Lievens, A. M., May, L. E.
The Journal of the American Osteopathic Association, 2009/01

1153

Mayo Clinic Proceedings' relationship with osteopathic physicians misrepresented
Lanier, W. L.
The Journal of the American Osteopathic Association, 2008/12
Free full text

1154

COMLEX-USA and in-service examination scores: tools for evaluating medical knowledge among residents
Sevensma, S. C., Navarre, G., Richards, R. K.
The Journal of the American Osteopathic Association, 2008/12
Free full text


1156

End-of-life care curricula in undergraduate medical education: a comparison of allopathic and osteopathic medical schools
Rothman, M. D., Gugliucci, M. R.
American Journal of Hospice and Palliative Care, 2008/10-11

1157

United States Osteopathic Education; The Challenge of Globalization
Comeaux, Z. J.
The AAO Journal, 2008/09
Free full text

1158

Osteopathic certification evolving into a continuous certification model
Moskowitz, J. S.
The Journal of the American Osteopathic Association, 2008/09
Free full text

1159

Assessing Educational Impact of Osteopathic Pre-doctoral Teaching Fellows
Cross, B. M., Villanueva, R., Glover, J. C., Hiserote, R. M., Davis, G.
The Journal of the American Osteopathic Association, 2008/08

1160

The Value of Osteopathy in Anesthesiology: A Survey
Johansson, N. M., Yarmush, J., Guirguis, A., Apergis, M., Kalstein, A.
The Journal of the American Osteopathic Association, 2008/08

1161

The Use of Osteopathic Manipulation to Address Pulmonary Distress as Related to Asthma in Southwest Virginia
Latter, M. L.
The Journal of the American Osteopathic Association, 2008/08

1162

Use of Ultrasonography in the Preclinical Education of Osteopathic Medical Students: A Pilot Study
Syperda, V. A., Trivedi, P. N., Melo, L. C., Freeman, M. L., Ledermann, E. J., Smith, T. M., Alben, J. O.
The Journal of the American Osteopathic Association, 2008/08

1163

Osteopathic medicine and community health fairs: increasing public awareness while improving public health
Stamat, H. M., Injety, K. R., Liechty, D. K., Pohlod, C. A., Aguwa, M. I.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1164

Evidence-based publications: balancing research mission and our community's needs
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1165

Keeping the flames of OMM burning
Hogarty, D. C.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1166

Eliminating bad, bad medicine: problems with P4P initiatives
McDonald, R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1167

Dangers of for-profit education: more than just words
Mychaskiw, G.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1168

Election year's first shot over the bow: reforms needed
Porcelli, M. J.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1169

Increase efforts to promote primary care
Rapp, R. W.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1170

Spirituality is fundamental to osteopathic medicine
Reeves, R. R., Beazley, A. R.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1171

Introducing osteopathic medical education in an allopathic residency
Rubeor, A., Nothnagle, M., Taylor, J. S.
The Journal of the American Osteopathic Association, 2008/08
Free full text

1172

AOA is strong advocate for debt relief and primary care
Crosby, J. B.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1173

Living in fast forward
Harper, D. L.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1174

Current regulations and modest proposals regarding disposal of unused opioids and other controlled substances
Herring, M. E., Shah, S. K., Shah, S. K., Gupta, A. K.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1175

The osteopathic research center will remain key to osteopathic medical profession
Licciardone, J. C., King, H. H., Kearns, C. M.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1176

Culture drives research funding
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2008/07
Free full text

1177

AAO Convocation in Dallas, Texas
Beck, M.
Osteopathische Medizin, 2008/05

1178

Excessive tuition does not equal excellent education
Andrews, C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1179

Award-winning debt-management education
Goeppinger, K. H.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1180

Mortgaging our future, foreclosing our profession
Kraus II., C. K.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1181

Working to ease debt burdens
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/05
Free full text

1182

Spirituality and medicine: prevalence of spirituality-in-medicine instruction at osteopathic medical schools
McClain, E. K., McClain, R. L., Desai, G. J., Pyle, S. A.
The Journal of the American Osteopathic Association, 2008/04
Free full text

1183

AACOM projections for growth through 2012: results of a 2007 survey of US Colleges of Osteopathic Medicine
Levitan, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1184

Pushing bodies through COMs
Lisowsky, T.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1185

New colleges of osteopathic medicine: steps in achieving accreditation
Miskowicz-Retz, K. C., Williams, A.
The Journal of the American Osteopathic Association, 2008/03

1186

Osteopathic medical education in 2008: course corrections and new horizons
Shannon, S. C.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1187

Medical education summits: building a solid foundation for the future of the osteopathic medical profession
Watson, D. K., Nichols, K. J.
The Journal of the American Osteopathic Association, 2008/03
Free full text

1188

OMM education vs “real world“ medicine
Davidson, S. M.
The Journal of the American Osteopathic Association, 2008/02
Free full text

1189

Colleges of osteopathic McMedicine?
Pandeya, N. K.
The Journal of the American Osteopathic Association, 2008/02
Free full text


1191

Attitudes toward pay-for-performance initiatives among primary care osteopathic physicians in small group practices
Locke, R. G., Srinivasan, M.
The Journal of the American Osteopathic Association, 2008/01
Free full text

1192


1193

Three Shortcomings of Current Osteopathic Medical Education Curricula, a Student Perspective
Alvarez, R. A., Feitell, S., Jones, A. C., Landry, B. W., Mapley, A. C., Mason, C. R., Sarmiento, P. A., Schrick-Senasac, S. L.
Journal of Osteopathic Medicine, 2007/08

1194

Applicant Selection Criteria for Osteopathic Residency Programs
Ballam, G. O., Guillory, V. J.
Journal of Osteopathic Medicine, 2007/08

1195

Awareness of Health Disparities in Organ Donation among Osteopathic Medical Students
Burch, D. M., Gordon, A. R., Burnett, P. A.
The Journal of the American Osteopathic Association, 2007/08

1196

Attitudes towards Osteopathic Manipulation in Career Choices (ATOMICC)
Dunbar, B. D., Desai, G. J.
The Journal of the American Osteopathic Association, 2007/08

1197

Measuring pressures used by physicians and students for cervical diagnosis of segmental somatic dysfunction using the Iso-TOUCH® Palpation Monitor System
Jean, N. T., Kuchera, M. L., Schoenfeldt, B., Dombrowski, R. T., Vardy, T., Williams, L.
The Journal of the American Osteopathic Association, 2007/08

1198

Teaching Palpatory Force to Osteopathic Medical Students
Marchioni, R. M., Badoolah, A. H., Caban-Martinez, A., Patterson, M. M.
The Journal of the American Osteopathic Association, 2007/08

1199

Factors Contributing to Osteopathic Manipulation Usage at Army Family Medicine Residency Programs
Platz, K. E., Asplund, C. A.
The Journal of the American Osteopathic Association, 2007/08

1200

Getting back to the country
Ortolon, K.
Texas Medicine, 2007/07




1204

Approval of ACGME Training as an AOA-approved internship: history and review of current data
Bulger, J. B.
The Journal of the American Osteopathic Association, 2006/12
Free full text

1205

Developing professionalism of osteopathic trainees through mentorship: KCOM's “Societies“ model
Laird, S. D., McNabb, J. E., Coon, S. A.
The Journal of the American Osteopathic Association, 2006/12
Free full text

1206

The predicament of osteopathic postdoctoral education
Cummings, M.
Academic Medicine, 2006/12
Free full text

1207

A problem-based learning pathway for medical students: Improving the process through action research
Chegwidden, W. R.
Annals of the Academy of Medicine Singapore, 2006/09
Free full text

1208

How to predict USMLE scores from COMLEX-USA scores: a guide for directors of ACGME-accredited residency programs
Slocum, P. C., Louder, J. S.
The Journal of the American Osteopathic Association, 2006/09
Free full text

1209

Computer-assisted instruction: a survey on the attitudes of osteopathic medical students
Forman, L. J., Pomerantz, S. C.
The Journal of the American Osteopathic Association, 2006/09
Free full text

1210

Establishing a case for cause and effect
Carbon, J. R.
The Journal of the American Osteopathic Association, 2006/08
Free full text

1211

Teaching Osteopathic Manipulative Treatment to Allopathic Family Medicine Residents: The Role of the Community Preceptor
Jorgensen, S., Quinlan, J., Soldo, T.
The Journal of the American Osteopathic Association, 2006/08

1212

Assessing the Effectiveness of OMT Provided by Undergraduate Teaching Fellows as Measured by a Visual Analog Pain Scale
Lerma, C. M., Render, R. M., Sarkaria, J. A., Homertgen, K. D., Hruby, R. J.
The Journal of the American Osteopathic Association, 2006/08

1213

AOA needs to reach out more
Tatum, W. O.
The Journal of the American Osteopathic Association, 2006/08
Free full text

1214

Osteopathic physicians in the United States: antibiotic prescribing practices for patients with nonspecific upper respiratory tract infections
Sun, C., Jew, S., Dasta, S. L.
The Journal of the American Osteopathic Association, 2006/08
Free full text

1215

Worlds of Western medicine and Chinese medicine learning from each other
Wu, E.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1216

Future of osteopathic medicine depends on investing in graduate medical education
Tosca, M.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1217

Addressing substance abuse in medical school curricula
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2006/07
Free full text

1218

Progressive idea for osteopathic medical education
Belsky, D. H.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1219

Relationships between scores on the COMLEX-USA Level 2-Performance Evaluation and selected school-based performance measures
Baker, H. H., Cope, M. K., Adelman, M. D., Schuler, S., Foster, R. W., Gimpel, J. R.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1220

Characteristics of osteopathic physicians choosing to practice rural primary care
Miller, T., Hooker, R. S., Mains, D. A.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1221

Survey on the clinical skills of osteopathic medical students
Gimpel, J. R., Boulet, J. R., Weidner, A. C.
The Journal of the American Osteopathic Association, 2006/05
Free full text

1222

Continuity of thought and tradition in the discipline supported by ongoing AOA efforts
Crosby, J. B.
The Journal of the American Osteopathic Association, 2006/04
Free full text

1223

Let the beauty of the marketplace benefit healthcare
Bliss, G.
The Journal of the American Osteopathic Association, 2006/04
Free full text

1224

Osteopathische Forschung in Amerika
(Osteopathic Research in the USA)
Heard, J.
DO - Deutsche Zeitschrift für Osteopathie, 2006/04

1225

Credit where credit's due: forebears of the Osteopathic Research Center
Goldsmith, D. M.
The Journal of the American Osteopathic Association, 2006/04

1226

Factors associated with high-severity disciplinary action by a state medical board: a Texas study of medical license revocation
Cardarelli, R., Licciardone, J. C.
The Journal of the American Osteopathic Association, 2006/03
Free full text

1227

Aligning the interests of osteopathic and allopathic teachers of family medicine
Morzinski, J., Henley, C.
Annals of Family Medicine, 2006/03
Free full text

1228

Family medicine's search for manpower: The American Osteopathic Association accreditation option
Cummings, M., Kunkle, J. L., Doane, C.
Family Medicine, 2006/03
Free full text

1229

Osteopathic postdoctoral training institutions
Webb, J. B.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1230

Osteopathic continuing medical education
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1231

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1232

Osteopathic graduate medical education
Obradovic, J. L., Beaudry, S. W., Winslow-Falbo, P.
The Journal of the American Osteopathic Association, 2006/02
Free full text

1233

Undergraduate osteopathic medical education: addressing the impact of college growth on the applicant pool and student enrollment
Griffin, A. V., Sweet, S.
The Journal of the American Osteopathic Association, 2006/02
Free full text


1235

Osteopathic medicine and the practice of dermatology: history and current status. An overview of the American Osteopathic College of Dermatology, an affiliate specialty college of the American Osteopathic Association
Austin, E., Way, B. V., Lustig, C., Green, J., Manlio, C., Broomer, A., Persichetti, G., Akhtar, A., Elias, M., Favreau, T., Skopit, S.
Journal of the American Academy of Dermatology, 2005/12

1236

The coming influenza pandemic: lessons from the past for the future
Patterson, M. M.
The Journal of the American Osteopathic Association, 2005/11
Free full text

1237

Dynamic duo: Maine-Dartmouth Family Practice Residency program and University of New England College of Osteopathic Medicine
Perakis, C.
The Journal of the American Osteopathic Association, 2005/11
Free full text

1238

American Osteopathic Association's policy statement on end-of-life care
Issues, Council on Palliative Care
The Journal of the American Osteopathic Association, 2005/11
Free full text

1239

Community-based osteopathic manipulative medicine student clinic: changes in curriculum and student confidence levels
Steele, K. M., Baker, H. H., Boxwell, G. F., Steele-Killeen, S.
The Journal of the American Osteopathic Association, 2005/11
Free full text

1240

Surprised by surgery statistics
Kattner, K. A.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1241

Missed opportunity for osteopathic medical education
Rodos, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1242

The “Big DO“
Werrell, B. H.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1243

Jumping through hoops for osteopathic internships
Snyder, J. J.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1244

Graduate medical education: accuracy of AOA's annual data-reporting mechanisms questioned
Cummings, M.
The Journal of the American Osteopathic Association, 2005/10
Free full text

1245

American osteopathic association commitment to quality and lifelong learning
Tunanidas, A. G., Burkhart, D. N.
The Journal of the American Osteopathic Association, 2005/09
Free full text

1246

Legends and Lessons: William “Wild Bill” Wyatt, DO
Capobianco, A. D.
The AAO Journal, 2005/09
Free full text

1247

Osteopathic physicians and the family medicine workforce
American Family Physician, 2005/08
Free full text

1248

Medical students' perceptions of medical education research and their roles as participants
Forester, J. P., McWhorter, D. L.
Academic Medicine, 2005/08
Free full text

1249

CV4 technique as a tool to decrease psychological stress in osteopathic medical students
Shah, A., Donaldson, N., Campomanes, C., Barragan, H., Menini, T., Binkerd, J.
The Journal of the American Osteopathic Association, 2005/07

1250

The Impact of Osteopathic Manipulative Treatment on Future Osteopathic Physicians
Williams, J., Howell, J. P.
The Journal of the American Osteopathic Association, 2005/07

1251

Tagebuch aus Kirksville
(Diary from Kirksville)
Sutmar, S.C.
DO - Deutsche Zeitschrift für Osteopathie, 2005/07

1252

The irony of osteopathic medicine and primary care
Cummings, M., Dobbs, K. J.
Academic Medicine, 2005/07
Free full text

1253

Promoting active engagement with osteopathic principles and practice in interns and residents
Cain, R. A.
The Journal of the American Osteopathic Association, 2005/05
Free full text

1254

Andrew Taylor Still and the Mayo brothers: convergence and collaboration in 21st-century osteopathic practice
Orenstein, R.
The Journal of the American Osteopathic Association, 2005/05
Free full text


1256

Kudos on electronic-only COMLEX-USA
Hoegerl, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1257

AOA's position against use of placebos for pain management in end-of-life care
Nichols, K. J., Galluzzi, K. E., Bates, B., Husted, B. A., Leleszi, J. P., Simon, K., Lavery, D., Cass, C.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1258

“Hardship exception“ is necessary
Zawadzki, E.
The Journal of the American Osteopathic Association, 2005/03

1259

Specialist or Generalist?
Chila, A. G.
The AAO Journal, 2005/03
Free full text

1260

Survey of osteopathic and allopathic residents' attitudes toward osteopathic manipulative treatment
Allee, B. A., Pollak, M. H., Malnar, K. F.
The Journal of the American Osteopathic Association, 2005/03
Free full text

1261

Chairman of COPT concludes debate on “hardship exception“
Opipari, M. I.
The Journal of the American Osteopathic Association, 2005/02
Free full text

1262

Integrating Osteopathic terminology into SNOMED CT
Nash, S.
AMIA - Annual Symposium Proceedings, 2005/01
Free full text


1264

Osteopathic medical training: developing the seasoned osteopathic physician
Clark, R. C.
The Journal of the American Osteopathic Association, 2004/11

1265

Board certification of osteopathic physicians
Ramirez, A. F.
The Journal of the American Osteopathic Association, 2004/11
Free full text

1266

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2004/11
Free full text

1267

DO outlines steps to malpractice reform
Michaud, R. G.
The Journal of the American Osteopathic Association, 2004/10
Free full text

1268

The hospitalist: a patient-focused paradigm?
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2004/09
Free full text

1269

DO notes difference between residency programs
Hornbeck, K. L.
The Journal of the American Osteopathic Association, 2004/09
Free full text

1270

Relation between variables of preadmission, medical school performance, and COMLEX-USA levels 1 and 2 performance
Dixon, D.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1271

Tobacco dependence curricula in undergraduate osteopathic medical education
Montalto, N. J., Ferry, L. H., Stanhiser, T.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1272

Conclusion of frequently used unsupported by data
Smith, R. M.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1273

In opposition to Resolution 42
Steier, K. J.
The Journal of the American Osteopathic Association, 2004/08
Free full text

1274

Yes, Dr Still, an MD won the 2004 Northup Writing Award!
D'Alonzo, G. E.
The Journal of the American Osteopathic Association, 2004/07
Free full text

1275

Charles J. Smutny III - Neuer Fellow der AAO
(Charles J. Smutny III - New Fellow of the AAO)
Newiger, C.
DO - Deutsche Zeitschrift für Osteopathie, 2004/07
Free full text


1277

Professionalism: orientation exercises for incoming osteopathic medical students and developing class vision statements
Fresa-Dillon, K. L., Cuzzolino, R. G., Veit, K. J.
The Journal of the American Osteopathic Association, 2004/06
Free full text

1278

Evaluating the rationale of the osteopathic internship
Smith, A. B.
The Journal of the American Osteopathic Association, 2004/06
Free full text


1280

Joint clinical clerkships for osteopathic and allopathic medical students: New England's experience
Tulgan, H., DeMarco, W. J., Pugnaire, M. P., Buser, B. R.
The Journal of the American Osteopathic Association, 2004/05
Free full text


1282

Musculoskeletal disorders: does the osteopathic medical profession demonstrate its unique and distinctive characteristics?
Sun, C., Desai, G. J., Pucci, D. S., Jew, S.
The Journal of the American Osteopathic Association, 2004/04
Free full text

1283

Osteopathic emergency medicine
Anderson, G. V.
Annals of Emergency Medicine, 2004/03
Free full text

1284

Status of complementary and alternative medicine in the osteopathic medical school curriculum
Saxon, D. W., Tunnicliff, G., Brokaw, J. J., Raess, B. U.
The Journal of the American Osteopathic Association, 2004/03
Free full text


1286

Medical Education Goes to Prison: Why?
Alemagno, S. A., Wilkinson, M., Levy, L.
Academic Medicine, 2004/02
Free full text

1287

Bridging the gap between medical education and application of OPP/OMT
Crosby, J. B.
The Journal of the American Osteopathic Association, 2004/01
Free full text


1289

Osteopathic physicians in primary care, Texas, 2003
Miller, T. L.
Unpublished MSc thesis, 2003/12


1291

Relations between academic performance by medical students and COMLEX-USA Level 2: a multisite analysis
Evans, P., Goodson, L. B., Schoffman, S. I., Baker, H. H.
The Journal of the American Osteopathic Association, 2003/11
Free full text

1292

Correlation between prior exercise and present health and fitness status of entering medical students
Peterson, D. F., Degenhardt, B. F., Smith, C. M.
The Journal of the American Osteopathic Association, 2003/11
Free full text

1293

Implementation of an osteopathic manipulative medicine clinic at an allopathic teaching hospital: a research-based experience
Przekop, P. R., Jr., Tulgan, H., Przekop, A., DeMarco, W. J., Campbell, N., Kisiel
The Journal of the American Osteopathic Association, 2003/11

1294

The Disaster Reserve Partner Group at NYCOM
Vohra, A., Meyler, Z.
The Journal of the American Osteopathic Association, 2003/11
Free full text

1295

How Private Colleges of Osteopathic Medicine Reinvented Themselves
Cummings, M.
Academic Medicine, 2003/11
Free full text

1296

Characteristics of the courses that best predict COMLEX-USA level 1 performance
Sefcik, D. J., Prozialeck, W. C., O'Hare, T. H.
The Journal of the American Osteopathic Association, 2003/10
Free full text

1297

Osteopathic medical education: renaissance or rhetoric?
Teitelbaum, H. S., Bunn, W. E., 2nd, Brown, S. A., Burchett
The Journal of the American Osteopathic Association, 2003/10
Free full text

1298

Productivity outcomes for recent grants and fellowships awarded by the American Osteopathic Association Bureau of Research
Rose, R. C., Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2003/09
Free full text

1299

The Osteopathic Education
Moresi, A. C.
The AAO Journal, 2003/09
Free full text

1300

Osteopathic and Allopathic Family Practice Residents' Attitudes Toward OMT/OPP
Allee, B. A., Pollak, M. H., Malnar, K. F., Elfrink, L. D., Mulkey, L. E.
Journal of Osteopathic Medicine, 2003/08

1301

Dually accredited family practice residencies: wave of the future
Terry, R. R.
The Journal of the American Osteopathic Association, 2003/08
Free full text

1302

Osteopathic physicians in emergency medicine
Pollard, J. A., Leveque, E. A., Lewin, M. R.
Annals of Emergency Medicine, 2003/08
Free full text

1303

Do osteopathic physicians differ in patient interaction from allopathic physicians? An empirically derived approach
Carey, T. S., Motyka, T. M., Garrett, J. M., Keller, R. B.
The Journal of the American Osteopathic Association, 2003/07
Free full text

1304

Predictive validity of osteopathic medical licensing examinations for osteopathic medical knowledge measured by graduate written examinations
Cavalieri, T. A., Shen, L., Slick, G. L.
The Journal of the American Osteopathic Association, 2003/07
Free full text

1305

Osteopathic graduate medical education opportunities abound in south Florida
Pinto, M. G.
The Journal of the American Osteopathic Association, 2003/07
Free full text


1307

Using National Medical Care Survey data to validate examination content on a performance-based clinical skills assessment for osteopathic physicians
Boulet, J. R., Gimpel, J. R., Errichetti, A. M., Meoli, F. G.
The Journal of the American Osteopathic Association, 2003/05
Free full text

1308

Research at US colleges of osteopathic medicine: a decade of growth
Guillory, V. J., Sharp, G.
The Journal of the American Osteopathic Association, 2003/04
Free full text

1309

Thanks for professional support
Meoli, F. G., Wallace, W. S., Kaiser-Smith, J., Shen, L.
The Journal of the American Osteopathic Association, 2003/04


1311

Time to forge affiliations between osteopathic medical schools and hospitals
Belsky, D. H.
The Journal of the American Osteopathic Association, 2003/03
Free full text

1312

Characteristics of physicians disciplined by the State Medical Board of Ohio
Clay, S. W., Conatser, R. R.
The Journal of the American Osteopathic Association, 2003/02
Free full text

1313

Validity and reliability of the Osteopathic Survey of Health Care in America (OSTEOSURV)
Licciardone, J. C.
The Journal of the American Osteopathic Association, 2003/02
Free full text

1314

Benefits of osteopathic schools
Blackstone, E. A.
Health Affairs, 2003/01

1315

Use of osteopathic manipulative treatment by Ohio osteopathic physicians in various specialties
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2003/01
Free full text


1317

Does the osteopathic internship have a future?
Cummings, M.
Academic Medicine, 2003/01
Free full text

1318

Was ist osteopathische Medizin?
[What is osteopathic medicine?]
Buchmann, J.
Deutsche Medizinische Wochenschrift, 2003/01

1319


1320

Reasons for student debt during medical education: a Michigan study
Zonia, S. C., Stommel, M., Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 2002/12
Free full text

1321

Improving the oral health knowledge of osteopathic medical students
Skelton, J., Smith, T. A., Betz, W. T., Heaton, L. J., Lillich, T. T.
Journal of Dental Education, 2002/11

1322

Certification of osteopathic physicians
Ramirez, A. F., Dolan, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1323

Osteopathic postdoctoral training institutions
Dalhouse, S.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1324

Undergraduate osteopathic medical education
Sweet, S.
The Journal of the American Osteopathic Association, 2002/11

1325

Selection criteria for applicants in primary care osteopathic graduate medical education
Bates, B. P.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1326

State of the art in standardized patient programs: a survey of osteopathic medical schools
Errichetti, A. M., Gimpel, J. R., Boulet, J. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text


1328

Institutional impact of a part-time faculty development fellowship program for osteopathic community-based physicians
Pinheiro, S. O., Liechty, D. K., Busch, K. V., Johnson, E. S., Dora, D. L., Butler, R. M.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1329

Training family medicine residents for assessment and advocacy of older adults
Robbins, M. R.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1330

AOA continuing medical education. American Osteopathic Association
Rodgers, D. J.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1331

Osteopathic medical education in 2002
Ross-Lee, B.
The Journal of the American Osteopathic Association, 2002/11
Free full text

1332

Working less, training harder
Chaudhry, H. J.
The Journal of the American Osteopathic Association, 2002/10
Free full text

1333

Research Interests and Motivations Among Osteopathic Medical Students: Results of a Pre-Clinical Student Survey
Licciardone, J. C., Fulda, K., Smith-Barbaro, P.
The Journal of the American Osteopathic Association, 2002/09

1334

Students', Interns' and Residents' Comfort and Confidence With Their OMT Skills
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2002/09

1335

Establishment of a Research Culture in an Osteopathic Family Medicine Department: Results of a Three-Year Project
Smith-Barbaro, P., Knisley, C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/09

1336

Student performance on the Comprehensive Osteopathic Medical Licensing Examination-USA level 2 following a clinical evaluation, feedback, and intervention program
Agostini, D. E., Stano, A. S., Parente, D. H.
The Journal of the American Osteopathic Association, 2002/09
Free full text

1337

Cost Effectiveness of Osteopathic Medicine: A Systemic Review
Gamber, R. G., Holland, B. S., Russo, D. P.
The Journal of the American Osteopathic Association, 2002/08

1338

Differences in the Evaluation and Treatment of Neck and Back Pain among Osteopathic and Allopathic Family Physicians
Pedersen, B., Guillory, V. J., Lynch, J. K.
The Journal of the American Osteopathic Association, 2002/08

1339

The anatomy professor that ate New York: some dinosaurs are teachers, and some teach about dinosaurs
Cammarata, J. F.
The Journal of the American Osteopathic Association, 2002/08
Free full text

1340

Resources in bioethics at osteopathic medical schools
Peppin, J., Leeper, K., Garloff, D.
Academic Medicine, 2002/05
Free full text

1341

Can we afford to lose another osteopathic teaching facility?
Dickason, R. H.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1342

Still-Well osteopathic medical student wellness program
Gaber, R. R., Martin, D. M.
The Journal of the American Osteopathic Association, 2002/05
Free full text

1343

Women students at Kirksville Missouri, Circa 1909
Burns, S. B., Burns, E. A.
The Journal of Alternative and Complementary Medicine, 2002/04

1344

Health status and satisfaction of patients receiving ambulatory care at osteopathic training clinics
Licciardone, J. C., Brittain, P. D., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2002/04
Free full text

1345

'We will look for health': the Osteopathic Center for Children
Chilton, K.
Alternative Therapies in Health and Medicine, 2002/03

1346

Current threats to osteopathic graduate medical education
Magen, J. G.
The Journal of the American Osteopathic Association, 2002/03
Free full text

1347

Research in action: a summary of the 2001 American Osteopathic Association Research Conference
Prozialeck, W. C.
The Journal of the American Osteopathic Association, 2002/03
Free full text

1348

Evaluation of osteopathic manipulative treatment training by practicing physicians in Ohio
Spaeth, D. G., Pheley, A. M.
The Journal of the American Osteopathic Association, 2002/03
Free full text

1349

Founding college of osteopathic medicine continues tradition
Robbins, G. B.
Missouri Medicine, 2002/02

1350

Health Professions Scholarship Program: are the armed forces getting quality osteopathic physicians?
Forester, J. P., McWhorter, D. L.
Military Medicine, 2002/01
Free full text

1351

Patient satisfaction and clinical outcomes associated with osteopathic manipulative treatment
Licciardone, J., Gamber, R., Cardarelli, K.
The Journal of the American Osteopathic Association, 2002/01
Free full text

1352

Identifying competencies for effective osteopathic physicians in the 21st century
Walrod, S.
Unpublished PhD thesis, 2002/01
Free full text

1353

Use of the internet as a resource for consumer health information: results of the second osteopathic survey of health care in America (OSTEOSURV-II)
Licciardone, J. C., Smith-Barbaro, P., Coleridge, S. T.
Journal of Medical Internet Research, 2001/12
Free full text

1354

Careless abandonment of osteopathic identity or lack of instillation in medical school?
Acunto, B.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1355

Can an Internet-based system assist with administration and distance learning for third- and fourth-year rural clinical rotations?
Baker, H. H., Foster, R. W., Cope, M. K., Boisvert, C., Wallace, G. H.
The Journal of the American Osteopathic Association, 2001/12
Free full text


1357

Department of Osteopathic Manipulative Medicine Teaching Assistant Program
Brooks, L., Stoll, S. T.
The AAO Journal, 2001/12
Free full text

1358

Core Clinical Clerkship in Osteopathic Manipulative Medicine at the Texas College of Osteopathic Medicine
Butler, L., Stoll, S. T., Gamber, R. G.
The AAO Journal, 2001/12
Free full text

1359

Years I and II Osteopathic Manipulative Medicine Curricula at Texas College of Osteopathic Medicine
Niedzwecki, C., Stoll, S. T.
The AAO Journal, 2001/12
Free full text


1361

Department of Osteopathic Manipulative Medicine Overview
Stoll, S. T.
The AAO Journal, 2001/12
Free full text



1364

Guide OPTI development beyond organizational differences
Gallagher, R. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1365

Twelve tips for technologic transformation: the NYCOM experience
Kumar, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1366

An adventure in excellence. 1962
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/12

1367

A framework for and case study of medical informatics development at Michigan State University College of Osteopathic Medicine
Notman, M., Greene, J. F.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1368

Ohio Osteopathic Network of Excellence: establishing a statewide telehealth consortium
Phillips, B. O., Duffrin, C.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1369

The ups and downs of medical school applicants
Singer, A. M.
The Journal of the American Osteopathic Association, 2001/12
Free full text

1370

The Osteopathic Graduate Medical Education Development Initiative
Kasovac, M.
The Journal of the American Osteopathic Association, 2001/11
Free full text

1371

Accreditation at colleges of osteopathic medicine
Sweet, S.
The Journal of the American Osteopathic Association, 2001/11
Free full text

1372

Good and compassionate care for dying patients
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/10

1373

Destiny of osteopathic profession. 1916
Meacham, W. B.
The Journal of the American Osteopathic Association, 2001/10

1374

The destiny of the osteopathic profession: the osteopathic difference
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/10
Free full text

1375

American Medical Association and American Osteopathic Association credit systems: accomplishing dual credit for a conference
Plungas, G. S., Tulgan, H., DeMarco, W. J., Aghababian, R. V.
The Journal of Continuing Education in the Health Professions, 2001/09

1376

Trends in Referral Patterns by Osteopathic Physician Preceptors: Results of a Pilot Study
Iverson, G. D., Helduser, J. W., Licciardone, J. C., Coleridge, S. T.
The Journal of the American Osteopathic Association, 2001/09

1377

Respect the friendly adversary
Anderson, R. B.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1378

Marketing lessons and retaining the traditional osteopathic internship
Broder, D. L.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1379

Decline in structural examination compliance in the hospital medical record with advancing level of training
Essig-Beatty, D. R., Klebba, G. E., LaPointe, N. G., Miller, E. D., Strong, R. E.
The Journal of the American Osteopathic Association, 2001/09
Free full text

1380

Development of the Attitudes Toward Osteopathic Principles and Practices Scale (ATOPPS): Preliminary Results of a Pilot Project
Russo, D. P., Stoll, S. T., Shores, J.
The Journal of the American Osteopathic Association, 2001/09

1381

Change professional title for increased recognition of osteopathic physicians
Reid, T.
The Journal of the American Osteopathic Association, 2001/09
Free full text


1383

More on allopathic medical credentialing
Allee, B. A.
The Journal of the American Osteopathic Association, 2001/08
Free full text

1384

The Effects of a Structured OMT Curriculum on Osteopathic Exams and OMT for Hospitalized Patients
Shubrook, J. H.
The Journal of the American Osteopathic Association, 2001/08


1386

Student perceptions of osteopathic manipulative treatment after completing a manipulative medicine rotation
Gamber, R. G., Gish, E. E., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

1387

Characteristics, satisfaction, and perceptions of patients receiving ambulatory healthcare from osteopathic physicians: a comparative national survey
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2001/07
Free full text

1388

Osteopathic medical schools should foster sense of identity
Fogel, R. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1389

Correlation of scores for the Comprehensive Osteopathic Medical Licensing Examination with osteopathic medical school grades
Hartman, S. E., Bates, B. P., Sprafka, S. A.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1390

A new year--a new era
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1391

Who is there to listen?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1392

Signifying what?
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1393

Vox populi
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1394

Sixty-five pieces of silver
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1395

“The California incident“
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1396

“The judgment is reversed“
Northup, G. W.
The Journal of the American Osteopathic Association, 2001/06
Free full text

1397

Research development at the University of Health Sciences College of Osteopathic Medicine
Guillory, V. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1398

President Bush's 2002 budget proposal would hamper geriatric education
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1399

Allergy test results of a rural and small-city population compared with those of an urban population
Taksey, J., Craig, T. J.
The Journal of the American Osteopathic Association, 2001/05
Free full text

1400

Osteopathic education. 1962
Mills, L. W.
The Journal of the American Osteopathic Association, 2001/04
Free full text

1401

Where our students come from. 1932
Willard, A.
The Journal of the American Osteopathic Association, 2001/04
Free full text


1403

Article fails to recognize unequal partners equal odd coupling
Brumberg, M. A.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1404

Prediction of student performance on the Comprehensive Osteopathic Medical Licensing Examination Level I based on admission data and course performance
Cope, M. K., Baker, H. H., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1405

On becoming a doctor
Kelly, M.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1406

Research--beginning the modern era
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1407

Wasn't A.T. Still an MD, too?
Mills, M. V.
The Journal of the American Osteopathic Association, 2001/02
Free full text

1408

Testing osteopathic medical school graduates for licensure: is COMLEX-USA the most appropriate examination?
Graneto, J.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1409

Osteopathy in its early adulthood, 1945-1955
Patterson, M. M.
The Journal of the American Osteopathic Association, 2001/01
Free full text

1410

Fair hearing/peer review: truth or oxymoron?
Chalifoux, R. F.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1411

What osteopathists stand for in legislation. 1910
Hildreth, A. G.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1412

Time for Medicare reform is now
Linz, A. J.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1413

Government control of medicine
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1414

Collaboration between pharmacy and osteopathic medicine to teach via the Internet
Sweeney, M. A., Schuster, M. L.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1415

The future in retrospect. 1935
Swope, C. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1416

Tendencies in a social, political, and governmental way which may influence doctors. 1937
Thomas, E. D.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1417

Hardship deferment saves residents' money
Weinberg, A.
The Journal of the American Osteopathic Association, 2000/12
Free full text

1418

Evaluation of faculty resources to meet curricular needs in an osteopathic medical school
Howell, J. N., Weiser, M., Ross-Lee, B., Dane, P. B.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1419

National Board of Osteopathic Medical Examiners in the 21st century
Meoli, F. G., Cavalieri, T., Buser, B., Smoley, J., Shen, L.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1420

A fresh look at osteopathic medical education in 2000
Miskowicz-Retz, K. C.
The Journal of the American Osteopathic Association, 2000/11

1421

Streamlining osteopathic education during the war emergency. 1943
Peach, J. M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1422

The necessity for emphasizing and strengthening the manipulative service offered in osteopathic hospitals. 1947
Peckham, F. F.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1423

Student assessment in the Ohio University College of Osteopathic Medicine CORE system: progress testing and objective structured clinical examinations
Portanova, R., Adelman, M., Jollick, J. D., Schuler, S., Modrzakowski, M., Soper, E., Ross-Lee, B.
The Journal of the American Osteopathic Association, 2000/11
Free full text


1425

How West Virginia School of Osteopathic Medicine achieves its mission of providing rural primary care physicians
Stookey, J. R., Baker, H. H., Nemitz, J. W.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1426

Educational fundamentals in osteopathy. 1946
Thompson, M.
The Journal of the American Osteopathic Association, 2000/11
Free full text

1427

Osteoporosis
Cymet, T. C., Wood, B., Orbach, N.
The Journal of the American Osteopathic Association, 2000/10

1428

Clinical use of selective estrogen receptor modulators
Krueger, P. M.
The Journal of the American Osteopathic Association, 2000/10

1429

Update: the latest on hormone replacement therapy
Packin, G. S.
The Journal of the American Osteopathic Association, 2000/10
Free full text

1430

An examination of the status of osteopathic medicine from 1960 to 2000
Steinberg, S. H.
Unpublished PhD thesis, 2000/10

1431

“Traditional osteopathy“: an oxymoron?
Findlay, T.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1432

Preparing medical students for the changing healthcare environment in United States
MacKinnon, G. E.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1433

Osteopathic research imperative-III. 1936
McCaughan, R. C., Hulburt, R. G.
The Journal of the American Osteopathic Association, 2000/09
Free full text

1434



1436

Public Perceptions of Osteopathic Physicians: Results from the First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08

1437

The First Osteopathic Survey of Health Care in America
Licciardone, J. C., Herron, K. M.
The Journal of the American Osteopathic Association, 2000/08

1438

Opinions Toward The Use of OMT by Oklahoma D.O.s Responding to Surveys in 1984 and 1999
Yates, H., Johnson, J. C.
The Journal of the American Osteopathic Association, 2000/08


1440

Name change diminishes osteopathic medicine's approach
Chapek, L.
The Journal of the American Osteopathic Association, 2000/06
Free full text

1441

Rural osteopathic family physician supply: past and present
Tooke-Rawlins, D.
The Journal of Rural Health, 2000/06

1442

Study underscores need to consider multiple factors in debate on physician-assisted suicide
Goldstein, F. J.
The Journal of the American Osteopathic Association, 2000/06
Free full text

1443

Time to take bolder initiative with regard to public accountability
Harper, D. L.
The Journal of the American Osteopathic Association, 2000/06
Free full text

1444

Opinions and reactions of physicians in New Jersey regarding the Oregon Death with Dignity Act
Kersh, S., 3rd, Cavalieri, T. A., Ciesielski, J., Forman
The Journal of the American Osteopathic Association, 2000/06
Free full text

1445

Survey of medical ethics in US medical schools: a descriptive study
Silverberg, L. I.
The Journal of the American Osteopathic Association, 2000/06
Free full text

1446

The treatment of influenza. 1918
McConnell, C. P.
The Journal of the American Osteopathic Association, 2000/05
Free full text

1447

Relationship between academic achievement and COMLEX-USA Level 1 performance: a multisite study
Baker, H. H., Foster, R. W., Bates, B. P., Cope, M. K., McWilliams, T. E., Musser, A., Yens, D.
The Journal of the American Osteopathic Association, 2000/04
Free full text

1448

His eighty-five years. 1913
Chiles, H.L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

1449

A home for research. 1913
Chiles, H. L.
The Journal of the American Osteopathic Association, 2000/04
Free full text

1450

National study of the impact of managed care on osteopathic physicians
Horan, J.
The Journal of the American Osteopathic Association, 2000/04
Free full text

1451

Early research: the A.T. Still Research Institute and Louisa Burns
Patterson, M. M.
The Journal of the American Osteopathic Association, 2000/04
Free full text

1452

Unity may preserve osteopathic ideals
Adair, A. D.
The Journal of the American Osteopathic Association, 2000/03
Free full text

1453

Relationship of preadmission variables and first- and second-year course performance to performance on the National Board of Osteopathic Medical Examiners' COMLEX-USA Level 1 examination
Baker, H. H., Cope, M. K., Fisk, R., Gorby, J. N., Foster, R. W.
The Journal of the American Osteopathic Association, 2000/03
Free full text

1454

Physician awareness of domestic violence: does continuing medical education have an impact?
Krueger, P. M., Schafer, S.
The Journal of the American Osteopathic Association, 2000/03
Free full text

1455

AOA's voice supporting fair treatment of physicians in quality review process
Loniewski, E. A.
The Journal of the American Osteopathic Association, 2000/03
Free full text

1456

Letters to the Editor
Orlando, C., Field, L.
The New England Journal of Medicine, 2000/03

1457

Passing of the “Old Doctor“. 1918
Hildreth, A. G., Macon, D. O.
The Journal of the American Osteopathic Association, 2000/02
Free full text

1458

The Comprehensive Osteopathic Medical Licensing Examination, COMLEX-USA: a new paradigm in testing and evaluation
Osborn, G. G., Meoli, F. G., Buser, B. R., Clearfield, M. B., Bruno, J. P., Sumner-Truax, L.
The Journal of the American Osteopathic Association, 2000/02
Free full text

1459

Management of osteoporosis in the new millennium
Cavalieri, T. A.
The Journal of the American Osteopathic Association, 2000/01

1460

Osteoporosis: a new understanding of its impact and pathogenesis
Chopra, A.
The Journal of the American Osteopathic Association, 2000/01

1461

Increased awareness of osteopathic medicine is essential to the profession's survival
Clark, R. C.
The Journal of the American Osteopathic Association, 2000/01
Free full text

1462

Effective strategies for the prevention of osteoporosis across the life span
Dombrowski, H. T.
The Journal of the American Osteopathic Association, 2000/01

1463

Evaluation of osteoporosis
Nichols, K. J.
The Journal of the American Osteopathic Association, 2000/01

1464

In defense of Dr Kevorkian
Suls, M. E.
The Journal of the American Osteopathic Association, 2000/01
Free full text

1465

Comparison of osteopathic and allopathic medical schools' support for primary care
Peters, A. S., Clark-Chiarelli, N., Block, S. D.
Journal of General Internal Medicine, 1999/12

1466


1467

Combined allopathic and osteopathic GME programs: a good thing, but will they continue?
Cummings, M., Lemon, M.
Academic Medicine, 1999/09
Free full text

1468

Professional identification and affiliation of the 1992 graduate class of the colleges of osteopathic medicine
Aguwa, M. I., Liechty, D. K.
Journal of Osteopathic Medicine, 1999/08
Free full text

1469

OMM beyond the classroom – The Future is now
Veneziano, M.
The AAO Journal, 1999/06
Free full text

1470


1471

Call to develop and implement dually approved residency programs
Daftarian, H.
Journal of Osteopathic Medicine, 1999/04
Free full text


1473

An international study of osteopathic practice
Cameron, M.
Unpublished MSc thesis, 1999/01
Free full text

1474

Oklahoma physician needs
Grewe, T., Lapolla, M., Phillips, S., Mitchell, L.
Journal of Osteopathic Medicine, 1999/01
Free full text

1475

Student Movement of the Medicine/Public Health Initiative promotes nationwide preventive healthcare approach
Cardarelli, R., Pierce, T.
Journal of Osteopathic Medicine, 1998/12
Free full text

1476


1477

Osteopathic medical school applicants not allopathic medical school 'rejects'
Kasovac, M.
Journal of Osteopathic Medicine, 1998/10
Free full text

1478

Use of a consortium to provide continuity in physician training: the OU-COM experience
Meyer, C. T., Portanova, R., Gevitz, N., Dane, P., Costello, W., Parry, D., Brose, J., Ross-Lee, B.
Journal of Osteopathic Medicine, 1998/08
Free full text


1480

Professional identity: key to the future of the osteopathic medical profession in the United States
Johnson, S. M., Bordinat, D.
Journal of Osteopathic Medicine, 1998/06

1481

Role of the DOs in the 'Spanish Flu' Pandemic of 1918-1920
Richardson, M. E.
The AAO Journal, 1998/06
Free full text

1482

Re-examining the number of osteopathic residency programs
Baker, H. H.
Journal of Osteopathic Medicine, 1998/02

1483

Community health screening as a teaching laboratory in physical diagnosis
Boisvert, C. S., Thymius, B., Hudgins, P. M.
Journal of Osteopathic Medicine, 1998/01

1484

Inpatient osteopathic manipulative treatment: Impact on length of stay
Cantieri, M. S.
The AAO Journal, 1997/12
Free full text

1485

The anatomy of an OPTI: Part 2. The CORE system
Meyer, C. T., Portanova, R., Riley, C., Baker, D., Phillips, B., Mann, D., Smith, C., Snyder, G., Ross-Lee, B.
Journal of Osteopathic Medicine, 1997/11
Free full text

1486

Osteopathic manipulative treatment: Practice use and and opinions of the Texas College of Osteopathic Medicine alumni
Gamber, R. G., Kennedy, D. A., Erickson, R. C., Moss, J. A., McKay Hart, C., Zengerle, C., Stone, R. C., Gish, E. E.
The AAO Journal, 1997/09
Free full text

1487

The reformation of medicine in the United States: A commentary on an American reformation
Austin, E.
Journal of Osteopathic Medicine, 1997/09
Free full text

1488

Looking at the whole. Osteopathic health care in Michigan
Peters, B.
Michigan Health & Hospitals, 1997/06


1490

Comparison of entrance requirements for health care professions
Doxey, T. T., Phillips, R. B.
Journal of Manipulative and Physiological Therapeutics, 1997/02


1492

OMM Residency Training and Certification
Ettlinger, H., Pelkey, Z.
The AAO Journal, 1995/09
Free full text


1494

DOs who train in allopathic residency programs not 'disloyal'
Wogec, J.
The Journal of the American Osteopathic Association, 1994/12
Free full text

1495

A perspective from osteopathic medical schools
Arnstein, S. R., Haspel, L. U.
The Milbank Quarterly, 1994/12
Free full text

1496

Healthcare reform and practice choices: a survey of osteopathic medical students
Shubrook, J. H., Jr., Solomon, J. A., Ross-Lee
The Journal of the American Osteopathic Association, 1994/11
Free full text

1497

Osteopathic medical education adapts to a changing environment
Ward, W. D.
The Journal of the American Osteopathic Association, 1994/11
Free full text

1498

The danger of complacency
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/11
Free full text

1499

Colleges of Osteopathic Medicine
The Journal of the American Osteopathic Association, 1994/11
Free full text

1500

Membership of AOA Committees on Osteopathic Medical Education 1994-1995
The Journal of the American Osteopathic Association, 1994/11
Free full text

1501

Overview of financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1994/11
Free full text



1504


1505


1506

Results of the 1994 National Resident Matching Program: family practice
Kahn, N. B., Jr., Schmittling, G., Ostergaard, D. J., Graham
Family Medicine, 1994/09

1507

Clinical practice guidelines: a review
Hayes, O. W.
The Journal of the American Osteopathic Association, 1994/09
Free full text

1508

The osteopathic medicine game: new strategies for winning
Meyer, C. T.
The Journal of the American Osteopathic Association, 1994/09
Free full text

1509


1510

Effect of clerkship training at rural sites on students' clinical skills
Brandau, D., Heun, L.
Academic Medicine, 1994/08
Free full text

1511

National Ambulatory Medical Care Survey: 1992 summary
Schappert, S. M.
Advance Data from Vital and Health Statistics, 1994/08

1512

The outlook for osteopathic medical specialists within a reformed healthcare system
Ross-Lee, B., Weiser, M. A., Kiss, L.
The Journal of the American Osteopathic Association, 1994/07
Free full text

1513

The in-training examination in internal medicine
Garibaldi, R. A., Trontell, M. C., Waxman, H., Holbrook, J. H., Kanya, D. T., Khoshbin, S., Thompson, J., Casey, M., Subhiyah, R. G., Davidoff, F.
Annals of Internal Medicine, 1994/07

1514

Managed care and graduate medical education: mutual objectives, barriers, and prospects
Natkow, N., Fry, L. J.
The Journal of the American Osteopathic Association, 1994/07
Free full text

1515

Complexity of the healthcare crisis in rural America
Simpson, C., Simpson, M. A.
The Journal of the American Osteopathic Association, 1994/06
Free full text

1516

Specialty-oriented internships
Opipari, M. I.
The Journal of the American Osteopathic Association, 1994/06
Free full text

1517

State healthcare reform: an arena for the osteopathic medical profession's influence
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/05
Free full text

1518

Performance-based assessment of moral reasoning and ethical judgment among medical students
Smith, S. R., Balint, J. A., Krause, K. C., Moore-West, M., Viles, P. H.
Academic Medicine, 1994/05
Free full text

1519

Healthcare policy reform comes under fire
Brooker, A. S.
The Journal of the American Osteopathic Association, 1994/05
Free full text

1520

More suggested changes to osteopathic medical curriculum
Clark, R. C.
The Journal of the American Osteopathic Association, 1994/05
Free full text

1521

Alternative medicine in the United States
Wardwell, W. I.
Social Science & Medicine, 1994/04

1522

'Parallel and distinctive': the philosophic pathway for reform in osteopathic medical education
Gevitz, N.
The Journal of the American Osteopathic Association, 1994/04
Free full text

1523

Dark period in history of osteopathic medicine revisited
Frymann, V. M.
The Journal of the American Osteopathic Association, 1994/04
Free full text

1524

Preparing the osteopathic academic health centers for healthcare reform
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/04
Free full text

1525

Performance of candidates on the American Osteopathic Board of Internal Medicine subspecialty certifying examinations 1984-1992
Slick, G. L.
The Journal of the American Osteopathic Association, 1994/03
Free full text

1526

Opportunities and Issues for Osteopathic Hospitals
The AAO Journal, 1994/03
Free full text


1528

Outcome Data for Patients Experiencing Chronic Pain
Stiles, E. G.
The AAO Journal, 1994/03
Free full text

1529

Revamp primary care programs to include psychiatry training
Magen, J. G.
The Journal of the American Osteopathic Association, 1994/03
Free full text

1530

Medicaid reform: an opportunity for the osteopathic medical profession
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/03
Free full text

1531

Managed care: an opportunity for osteopathic physicians
Ross-Lee, B., Weiser, M. A.
The Journal of the American Osteopathic Association, 1994/02
Free full text

1532

Clarifying number of DOs in allopathic residency programs
Sprafka, S.
The Journal of the American Osteopathic Association, 1994/01
Free full text

1533

A strategy for the future success of osteopathic medicine
Wax, C. M.
The Journal of the American Osteopathic Association, 1994/01
Free full text

1534

The primary medicine initiative--continuity in medical education
Wood, D. L.
The Journal of the American Osteopathic Association, 1994/01
Free full text

1535

Debate continues on the call to reform the profession
Terry, R. R., Comeaux, Z., Finkelstein, L. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

1536

Crafting effective internal memos
Baker, H. H.
The Journal of the American Osteopathic Association, 1993/12
Free full text

1537

Response: Debate continues on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/12
Free full text

1538

Focused goals of osteopathic medical education achieve results
Ward, W. D.
The Journal of the American Osteopathic Association, 1993/11
Free full text


1540

No 'paradigm shift' needed at COMs
Richwine, W. B., Papa, F. J.
The Journal of the American Osteopathic Association, 1993/11
Free full text

1541

Important characteristics of a director of medical education
Powell, V. D., Jr., George
The Journal of the American Osteopathic Association, 1993/11
Free full text

1542

Financial assistance resources for osteopathic medical students
Reich, M. M.
The Journal of the American Osteopathic Association, 1993/11
Free full text

1543

Where were the DOs?
Miller, W.
Texas Medicine, 1993/10

1544

An MD's note to his osteopathic medical students
Friedlander, E. R.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1545

Do medical students' knowledge and attitudes about health and exercise affect their physical fitness?
Liang, M. T., Dombrowski, H. T., Allen, T. W., Chang, C. O., Andriulli, J., Bastianelli, M., Davina, E., Norris, S. D.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1546

A primer on graduate medical education financing
Carl, J. M., Knaus, R. J.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1547

Lifestyle changes associated with osteopathic medical education
Crapse, F. J., Jr., Hudgins, P. M., Baker
The Journal of the American Osteopathic Association, 1993/10
Free full text

1548

Promoting the health and fitness of osteopathic medical students
Licciardone, J. C.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1549

More comments on the call to reform the profession
McPartland, J. M., Pulsipher, D. W., Cope, M. K., Wagenknecht, D. A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1550

Response: More comments on the call to reform the profession
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/10
Free full text

1551

We Need National Health – Not National Health Insurance
Clark, R. C.
The AAO Journal, 1993/09
Free full text

1552

Primary care DOs, specialists--and OMM--important to profession
Wax, C. M.
The Journal of the American Osteopathic Association, 1993/09
Free full text

1553


1554

Teaching residents to write a research paper
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1993/09
Free full text

1555

The HIV-infected house officer: residency training issues
Fernandez, E. S., Troutman, H. T., Herbert, B., Condoluci, D. V.
The Journal of the American Osteopathic Association, 1993/08
Free full text

1556

Readers offer suggestions for reforms in osteopathic medicine
Rosenblum, J.
The Journal of the American Osteopathic Association, 1993/08
Free full text

1557


1558

Another view of the “crisis“ in osteopathic medicine
Baker, H. H.
Academic Medicine, 1993/07
Free full text

1559

Helping-not hurting--residents with substance use disorders
Sells, K. W., Gorby, W. G.
The Journal of the American Osteopathic Association, 1993/06
Free full text

1560

'Blueprint' for creating classroom facilities in teaching hospitals
Hayes, O. W.
The Journal of the American Osteopathic Association, 1993/06
Free full text

1561

A comparison of health care costs for chiropractic and medical patients
Stano, M.
Journal of Manipulative and Physiological Therapeutics, 1993/06


1563

Survey of physician practice behaviors related to diabetes mellitus in the U.S. I. Design and methods
Siebert, C., Lipsett, L. F., Greenblatt, J., Silverman, R. E.
Diabetes Care, 1993/05
Free full text

1564


1565

Research important to education--and society
Retz, K. C.
The Journal of the American Osteopathic Association, 1993/05
Free full text

1566

Arranging affiliation agreements and outside rotations
Willard, R. L.
The Journal of the American Osteopathic Association, 1993/04
Free full text

1567

Who cares for Missouri's Medicaid nursing home residents? Characteristics of attending physicians
Lawhorne, L. W., Walker, G., Zweig, S. C., Snyder, J.
Journal of the American Geriatrics Society, 1993/04

1568

Osteopathic medicine: a call for reform
Meyer, C. T., Price, A.
The Journal of the American Osteopathic Association, 1993/04
Free full text


1570

Outcomes assessment: 'buzz words' in medical education whose time has come
Allen, T. W.
The Journal of the American Osteopathic Association, 1993/03
Free full text

1571

Assessing outcomes of the educational program of the West Virginia School of Osteopathic Medicine
Cope, M. K., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

1572

Procedures to follow when dismissing an intern or resident
Opipari, M., Baker, H. H.
The Journal of the American Osteopathic Association, 1993/03
Free full text

1573

An approach to training and retaining primary care physicians in rural Appalachia
Roberts, A., Foster, R., Dennis, M., Davis, L., Wells, J., Bodemuller, M. F., Bailey, C. A.
Academic Medicine, 1993/02
Free full text

1574

Managing substance use disorders in resident physicians
Benzer, D. G.
The Journal of the American Osteopathic Association, 1993/02
Free full text

1575

Clinical teaching in the ambulatory care setting: how to capture the teachable moment
Bowling, J. R.
The Journal of the American Osteopathic Association, 1993/02
Free full text

1576

Integrate osteopathic principles and practices in postgraduate medical education--now
Kasovac, M., Jones, J. M.
The Journal of the American Osteopathic Association, 1993/01
Free full text

1577

The crisis in osteopathic medicine
Meyer, C. T., Price, A.
Academic Medicine, 1992/12

1578

With a look at the past, osteopathic medical education heads into its second century
Ward, D.
The Journal of the American Osteopathic Association, 1992/11
Free full text

1579

Four approaches to using patients to teach and evaluate clinical skills of residents, interns, and students
Medio, F. J., Morewitz, S. J.
The Journal of the American Osteopathic Association, 1992/11
Free full text

1580

Voices From the Future: what students, interns, and residents want from osteopathic graduate medical training
Kushner, D., Cooney, J.
The Journal of the American Osteopathic Association, 1992/10
Free full text

1581

Heed 'Voices From the Future' and reform GME training
Meyer, C. T.
The Journal of the American Osteopathic Association, 1992/10
Free full text

1582

Mississippi State Board of Medical Licensure annual report July 1, 1990 through June 30, 1991
Morgan, F. J.
Journal of the Mississippi State Medical Association, 1992/09

1583

Teaching the process of obtaining informed consent to medical students
Johnson, S. M., Kurtz, M. E., Tomlinson, T., Fleck, L.
Academic Medicine, 1992/09

1584

Strategy for Addressing Third Party Payors on OMT
O'Connell, J. A.
The AAO Journal, 1992/09
Free full text

1585

Challenge to osteopathic education. Returning to its primary care roots
Cummings, M.
JAMA: The Journal of the American Medical Association, 1992/09

1586

Graduate medical education
JAMA: The Journal of the American Medical Association, 1992/09

1587

Osteopathic medicine: 100 years in the making
Allen, T. W.
The Journal of the American Osteopathic Association, 1992/09
Free full text

1588

Suggestions for clinicians providing--and residents seeking--feedback
Sprafka, S.
The Journal of the American Osteopathic Association, 1992/08
Free full text

1589

One doctor's Rx for the recession
Rice, B.
Medical Economics, 1992/08

1590

Doctors Hospital chair Costin stresses active role of DOs on boards
AOHA: A Publication of the American Osteopathic Hospital Association, 1992/07

1591

Will Your Recipe Even Be In The Cookbook?
Ammann-Hasbrouck, L.
The AAO Journal, 1992/06
Free full text

1592

Is Osteopathic Education Ready For Its Next Century?
Corbett, S. R.
The AAO Journal, 1992/06
Free full text

1593

College of Podiatric Medicine and Surgery in Des Moines
Tomczak, R. L.
Journal of the American Podiatric Medical Association, 1992/06
Free full text

1594

Guidelines for designing resident rating forms
Gugelchuk, G. M., Daum, S. G.
The Journal of the American Osteopathic Association, 1992/06
Free full text

1595

Recruiting interns and residents to an osteopathic medical training program
Slick, G. L.
The Journal of the American Osteopathic Association, 1992/05
Free full text

1596

Revamped osteopathic hospital group flourishing
Burda, D.
Modern Healthcare, 1992/05

1597

Training osteopathic medical students in behavioral medicine and psychiatry
Magen, J.
The Journal of the American Osteopathic Association, 1992/05
Free full text

1598

'Loopholes' weaken hospital accreditation policy
Horspool, J. C.
The Journal of the American Osteopathic Association, 1992/04
Free full text

1599

The medical education system in Oklahoma
Lapolla, M., Duffy, D., Lewis, C. S.
The Journal of the Oklahoma State Medical Association, 1992/03

1600


1601

The physical fitness of first-year osteopathic medical students
Licciardone, J. C., Hagan, R. D.
The Journal of the American Osteopathic Association, 1992/03
Free full text

1602

'Blueprint' for designing a curriculum for intern and residency programs
Tomaszewski, D. D.
The Journal of the American Osteopathic Association, 1992/02
Free full text

1603

A curriculum database with boolean natural-language searching in HyperCard
Mann, D., Goodrum, K., DeWine, J. M., McVicker, J.
Proceedings Annual Symposium on Computer Application in Medical Care, 1992/01
Free full text

1604

Earnings in primary care: which doctors do best
Azevedo, D.
Medical Economics, 1991/12

1605

Let's Return to the Basics
Heatherington, J. S.
The AAO Journal, 1991/12
Free full text

1606

Evaluation of Managed Care Contracting
Schnack, T. H.
The AAO Journal, 1991/12
Free full text


1608

Superlatives and concerns in osteopathic medical education
Baker, H. H.
The Journal of the American Osteopathic Association, 1991/11
Free full text

1609

Incorporating OMT in hospital training
Cooper, G. J.
The Journal of the American Osteopathic Association, 1991/11
Free full text


1611

US osteopathic medical school finances
Reich, M. M.
The Journal of the American Osteopathic Association, 1991/11
Free full text

1612

Examining the complexities of HIV testing for healthcare workers
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/10
Free full text

1613

The increasing supply of physicians in US urban and rural areas, 1975 to 1988
Frenzen, P. D.
American Journal of Public Health, 1991/09

1614

Who Will Hatch Our Students?
Morey, L.
The AAO Journal, 1991/09
Free full text

1615

Osteopathic vs. chiropractic education: a student perspective
McNamee, K. P., Magarian, K., Phillips, R. B., Greenman, P. E.
Journal of Manipulative and Physiological Therapeutics, 1991/09

1616

A proposal to modify research and scholarly activities during osteopathic residency training
Coleridge, S. T.
The Journal of the American Osteopathic Association, 1991/09
Free full text

1617

Osteopathic interns' attitudes toward their education and training
Shlapentokh, V., O'Donnell, N., Grey, M. B.
The Journal of the American Osteopathic Association, 1991/08
Free full text

1618

Bias in medical education? Take my word for it!
Schulte, J.
Medical Economics, 1991/08

1619

Selected characteristics of graduate medical education in the United States
Rowley, B. D., Baldwin, D. C., Jr., McGuire
JAMA: The Journal of the American Medical Association, 1991/08

1620

Osteopathic medical educators should heed lesson from interns
Johnston, W. L.
The Journal of the American Osteopathic Association, 1991/08
Free full text

1621

Osteopathic principles and practices: maintaining a vital link in osteopathic education
Kappler, R. E.
The Journal of the American Osteopathic Association, 1991/07
Free full text

1622

Guide to clinical preventive services. Report of the US Preventive Services Task Force
Allen, T. W.
The Journal of the American Osteopathic Association, 1991/03
Free full text

1623

Who should teach osteopathic manipulative medicine?
Lo, K. S.
The Journal of the American Osteopathic Association, 1991/03
Free full text

1624

Evaluation of videodisc modules: a mixed method approach
Parkhurst, P. E., Lovell, K. L., Sprafka, S. A., Hodgins, M.
Proceedings Annual Symposium on Computer Application in Medical Care, 1991/02
Free full text



1627

Retain general practitioners' identity
McAffe, D. R.
The Journal of the American Osteopathic Association, 1990/12
Free full text



1630

Osteopathic postdoctoral education
Baker, H. H., Wachtler, J.
The Journal of the American Osteopathic Association, 1990/11
Free full text

1631

Research programs of the AOA and their role in osteopathic education
Retz, K. C.
The Journal of the American Osteopathic Association, 1990/11
Free full text

1632

Practicing what we teach: integrating osteopathic principles into practice
Allen, T. W.
The Journal of the American Osteopathic Association, 1990/10
Free full text

1633

Politics cloud state of osteopathic medical residency programs
Donovan, P. J.
The Journal of the American Osteopathic Association, 1990/10
Free full text

1634

Osteopathic medicine: the profession's role in society
Korr, I. M.
The Journal of the American Osteopathic Association, 1990/09
Free full text

1635

Allopathic residencies: current and former residents' viewpoints
Baron, M., Karp, S. J., Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/09
Free full text

1636

Commenting on L-tryptophan and osteopathic physicians in allopathic residencies
Davis, F. E.
The Journal of the American Osteopathic Association, 1990/09
Free full text


1638

Searching for clues to the origins of OMT
Beatty, D. R.
The Journal of the American Osteopathic Association, 1990/08
Free full text

1639

Scott Memorial lecture: the challenge of change
Greenman, P. E.
The Journal of the American Osteopathic Association, 1990/08
Free full text

1640

Development of an Expert System to Teach Diagnostic Skills
Elieson, S. W.
Unpublished PhD thesis, 1990/08
Free full text

1641

Louisa Burns memorial lecture: research in residencies
Belsky, D. H.
The Journal of the American Osteopathic Association, 1990/07
Free full text

1642

How effectively are osteopathic medical students coping with a stressful life-style?
Kurtz, M. E., Paulsen, R. D., Ferguson, D.
The Journal of the American Osteopathic Association, 1990/07
Free full text

1643

Factors influencing osteopathic physicians' decisions to enroll in allopathic residency programs
Pecora, A. A.
The Journal of the American Osteopathic Association, 1990/06


1645

The Century Club: a model for staff-supported medical education
Meyer, C. T.
The Journal of the American Osteopathic Association, 1990/05
Free full text

1646

The pull toward the vacuum: osteopathic medical education in the 1980s
Cummings, M.
The Journal of the American Osteopathic Association, 1990/04
Free full text

1647

A second opinion on geriatric training programs
Toffol, G. J., Schultz, D. R., Root, K. E., Weintraub, J. R.
The Journal of the American Osteopathic Association, 1990/03
Free full text

1648

General practice residency training and the osteopathic profession: trends and issues for the 1990s
Aquilina, A. D.
The Journal of the American Osteopathic Association, 1990/02
Free full text

1649

War, politics, and osteopathic medicine
Goldstein, M.
The Journal of the American Osteopathic Association, 1990/02
Free full text






1655

The orientations of medical students to osteopathic medicine
Aho, W. R.
Unpublished PhD thesis, 1970/01

 
 
 






  • ImpressumLegal noticeDatenschutz


ostlib.de/advanced



Supported by

OSTLIB recommends